Your browser is old and dusty. Try Google Chrome!

Details for slr0526

ORF slr0526
Accession NP_442742.1
Symbol panB
Category Pantothenate
Definition 3-methyl-2-oxobutanoate hydroxymethyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_4 Forward -234 -226 4.93597 0.224
NP_442151.1_6 Reverse -225 -239 13.1759 0.0573
NP_442151.1_6 Reverse -366 -380 5.40779 0.278
NP_441818.1_9 Reverse -130 -149 -7.37537 0.272
NP_441818.1_9 Reverse -52 -71 -10.227 0.292
NP_440226.1_1 Forward -234 -215 17.2074 0.0197
NP_440348.1_6 Forward -342 -323 4.81767 0.248
NP_442744.1_8 Reverse -225 -244 -6.29373 0.297
NP_442655.1_1 Reverse -220 -239 10.4225 0.0915
NP_442752.1_4 Reverse -225 -232 4.26735 0.293
NP_439997.1_5 Forward -213 -194 16.6517 0.237
NP_442975.1_10 Reverse -80 -94 6.58715 0.17
NP_441225.1_2 Forward -150 -131 3.34271 0.217
NP_441225.1_4 Forward -77 -58 -2.36049 0.237
NP_441675.1_4 Forward -176 -157 10.8159 0.182
NP_440110.1_8 Forward -342 -323 4.12936 0.204
NP_440110.1_8 Forward -343 -324 -0.787193 0.228
NP_441641.1_6 Reverse -79 -98 12.7212 0.224
NP_441035.1_3 Forward -262 -243 17.8957 0.0593
NP_440393.1_1 Reverse -172 -191 20.8016 0.17
NP_441935.1_1 Forward -385 -366 6.09597 0.288
NP_440893.1_3 Forward -52 -33 2.26028 0.273
NP_441208.1_9 Forward -237 -223 16.9125 0.0647
NP_442742.1_1 Forward -36 -17 21.7306 0.113
NP_442742.1_3 Forward -66 -47 17.404 0.162
NP_442742.1_4 Forward -147 -128 29.9904 0.0000954
NP_442742.1_6 Forward -292 -274 21.652 0.0804
NP_442742.1_9 Forward -213 -194 34.612 0.0000197
NP_442742.1_10 Forward -127 -108 23.008 0.0245
NP_441082.1_10 Reverse -143 -156 9.36073 0.25
NP_442367.1_1 Forward -194 -175 -11.3086 0.264
NP_442726.1_7 Reverse -258 -276 -1.25915 0.293
NP_441925.1_4 Forward -155 -136 -8.6544 0.211
NP_441925.1_4 Forward -212 -193 -16.3242 0.282
NP_441083.1_5 Reverse -225 -235 14.238 0.0159
NP_441083.1_5 Forward -369 -359 4.50326 0.141
NP_441083.1_5 Forward -234 -224 0.471689 0.226
NP_441083.1_5 Reverse -360 -370 -0.41329 0.267
NP_442827.1_8 Forward -377 -358 12.1917 0.0491
NP_441149.1_9 Forward -218 -199 8.94676 0.177
NP_441738.1_2 Forward -109 -102 6.52862 0.261
NP_441558.1_5 Forward -283 -264 4.32602 0.283
NP_442889.1_8 Forward -135 -121 8.55376 0.117
NP_442889.1_8 Forward -378 -364 3.04726 0.291
NP_441770.1_4 Reverse -131 -150 1.96607 0.145
NP_441770.1_4 Forward -390 -371 -7.4737 0.233
NP_442570.1_3 Forward -87 -68 1.37609 0.196
NP_442570.1_3 Forward -66 -47 -7.17871 0.268
NP_441716.1_1 Reverse -130 -144 2.65453 0.298
NP_440747.1_10 Forward -237 -225 -4.38592 0.0974
NP_441486.1_1 Reverse -222 -236 3.34284 0.0619
NP_441486.1_1 Reverse -363 -377 -0.590395 0.158
NP_441014.1_2 Forward -350 -331 14.4541 0.245
NP_441014.1_10 Forward -80 -61 -0.689632 0.252
NP_440376.1_1 Reverse -225 -234 5.99792 0.111
NP_440376.1_1 Forward -268 -259 3.7363 0.195
NP_440376.1_1 Forward -234 -225 -0.000272808 0.285
NP_442687.1_7 Forward -235 -225 7.74818 0.125
NP_442687.1_7 Reverse -224 -234 3.81494 0.286
NP_442589.1_3 Forward -348 -329 16.7582 0.247
NP_442485.1_3 Forward -75 -56 -4.42544 0.28
NP_442530.1_2 Reverse -210 -220 14.7297 0.203
NP_440642.1_10 Forward -81 -67 1.96562 0.284
NP_441013.1_2 Forward -204 -186 -3.42244 0.29
NP_440533.1_6 Reverse -330 -349 7.47261 0.297
NP_440887.1_8 Reverse -130 -144 21.9274 0.00296
NP_442782.1_2 Reverse -190 -204 4.32615 0.256
NP_442300.1_10 Forward -243 -224 9.43923 0.294
NP_441958.1_5 Forward -235 -225 0.865012 0.12
NP_441958.1_5 Reverse -224 -234 0.275027 0.162
NP_440950.1_8 Forward -400 -381 11.5651 0.188
NP_440993.1_3 Forward -244 -225 -2.06626 0.294
NP_440993.1_4 Reverse -49 -66 2.00546 0.3
NP_440934.1_4 Reverse -379 -398 10.9142 0.187
NP_442002.1_9 Reverse -224 -231 10.7572 0.185
NP_441294.1_7 Reverse -221 -235 8.48272 0.298
NP_441424.1_2 Forward -182 -163 9.40553 0.273
NP_442431.1_10 Reverse -49 -67 3.75572 0.213
NP_441752.1_6 Forward -65 -46 -0.885524 0.279
NP_440377.1_1 Reverse -158 -175 13.3996 0.241
NP_440377.1_1 Forward -112 -95 10.0175 0.299
NP_441000.1_6 Forward -235 -221 2.16287 0.148
NP_442771.1_1 Reverse -358 -376 -10.3056 0.254
NP_440147.1_4 Forward -371 -358 4.44418 0.16
NP_441550.1_8 Forward -236 -226 14.1392 0.0182
NP_441550.1_8 Reverse -358 -368 6.46942 0.206
NP_441916.1_10 Forward -119 -100 2.26107 0.25
NP_441041.1_4 Forward -234 -215 -11.5053 0.248
NP_440569.1_6 Reverse -187 -206 9.53756 0.175
NP_442004.1_7 Forward -351 -332 18.9773 0.0859
NP_439966.1_7 Reverse -183 -193 5.87944 0.204
NP_442941.1_5 Reverse -162 -176 14.9069 0.272
NP_440289.1_2 Reverse -222 -235 4.73917 0.0649
NP_440983.1_9 Reverse -186 -205 3.14605 0.285
NP_440260.1_8 Forward -88 -70 4.9357 0.154
NP_442281.1_1 Forward -239 -225 9.53707 0.0685
NP_442281.1_1 Reverse -65 -79 6.0955 0.136
NP_001035871.2_7 Reverse -192 -202 15.9097 0.14
NP_441644.1_6 Forward -375 -365 3.51951 0.277
NP_441644.1_6 Reverse -360 -370 3.32285 0.288
NP_442215.1_2 Reverse -223 -239 5.6634 0.0775
NP_440253.1_2 Forward -93 -75 12.9005 0.0255
NP_440253.1_2 Forward -234 -216 6.11567 0.0856
NP_440929.1_8 Forward -234 -225 6.68623 0.0887
NP_440780.1_1 Reverse -289 -308 8.35512 0.274
NP_440780.1_1 Reverse -203 -222 6.92274 0.289
NP_442933.1_10 Forward -234 -225 4.42462 0.246
NP_441751.2_8 Forward -78 -64 -2.85201 0.134
NP_442554.1_8 Reverse -226 -236 2.14332 0.281
NP_441762.1_7 Forward -94 -82 -6.15587 0.276
NP_442142.1_4 Forward -142 -129 8.86849 0.106
NP_439989.1_6 Forward -268 -249 6.29264 0.296
NP_443009.1_5 Forward -235 -224 7.33466 0.132
NP_443009.1_5 Reverse -252 -263 4.67974 0.234
NP_440947.1_7 Reverse -126 -145 18.4857 0.0318
NP_440183.1_9 Forward -248 -229 -19.7651 0.282
NP_440379.1_5 Forward -73 -54 -9.34199 0.263
NP_440379.1_5 Reverse -66 -85 -11.4069 0.296
NP_441020.2_6 Forward -276 -259 7.512 0.229
NP_441015.1_10 Reverse -50 -69 -2.36049 0.178
NP_441673.1_1 Reverse -225 -234 1.37636 0.114
NP_441673.1_1 Forward -234 -225 1.1797 0.163
NP_441826.1_2 Reverse -354 -368 -2.36035 0.271
NP_442719.1_2 Forward -213 -195 -1.16155 0.175
NP_442719.1_2 Forward -51 -33 -11.6829 0.294
NP_442808.1_1 Forward -206 -196 4.50281 0.197
NP_442808.1_1 Forward -205 -195 4.50281 0.197
NP_442808.1_1 Reverse -234 -244 2.73286 0.256
NP_440145.1_3 Forward -291 -272 -5.01543 0.257
NP_442542.1_2 Reverse -358 -371 7.98409 0.167
NP_440038.1_4 Reverse -365 -384 0.294447 0.277
NP_441114.1_3 Forward -77 -68 7.66954 0.231
NP_441114.1_3 Reverse -206 -215 6.39124 0.277
NP_440558.1_2 Forward -82 -63 -3.14714 0.234
NP_440111.2_4 Reverse -355 -374 13.7658 0.175
NP_441878.1_6 Forward -235 -225 0.57002 0.14
NP_441878.1_6 Reverse -69 -79 -7.39479 0.222
NP_441878.1_6 Forward -376 -366 -7.59145 0.245
NP_441878.1_6 Reverse -359 -369 -7.68978 0.255
NP_441036.1_8 Reverse -224 -234 6.76487 0.215
NP_441557.1_5 Reverse -225 -234 0.491382 0.144
NP_441557.1_5 Forward -234 -225 0.29472 0.174
NP_441445.1_1 Reverse -216 -235 2.55606 0.233
NP_441445.1_1 Forward -243 -224 1.37609 0.257
NP_441590.1_4 Reverse -249 -268 3.24359 0.29
NP_441433.1_8 Reverse -191 -210 -3.54046 0.283
NP_441574.1_1 Forward -274 -255 6.4893 0.112
NP_442347.1_2 Forward -233 -224 11.2095 0.056
NP_442645.1_2 Forward -384 -365 -16.7168 0.24
NP_442645.1_2 Reverse -245 -264 -17.2085 0.25
NP_441037.1_4 Forward -377 -367 7.80498 0.237
NP_442594.1_8 Forward -387 -368 4.52268 0.26
NP_442047.1_2 Forward -239 -225 13.3726 0.224
NP_441633.1_3 Forward -371 -358 0.314277 0.127
NP_441633.1_3 Reverse -223 -236 -6.2739 0.242
NP_442764.1_8 Reverse -165 -184 3.24438 0.268
NP_442998.1_5 Reverse -333 -343 10.6981 0.206
NP_442998.1_5 Reverse -372 -382 8.73149 0.261
NP_442998.1_5 Reverse -203 -213 8.04317 0.274
NP_442998.1_10 Forward -232 -225 5.93897 0.206
NP_440731.1_1 Reverse -322 -341 20.354 0.0517
NP_442201.1_10 Forward -245 -226 -14.5535 0.283
NP_441449.1_8 Forward -207 -188 14.179 0.259
NP_440915.1_6 Forward -26 -12 0.589577 0.159
NP_442855.1_3 Forward -277 -258 14.0608 0.21
NP_441179.1_9 Forward -141 -131 9.321 0.28
NP_440134.1_2 Reverse -364 -383 6.98095 0.286
NP_442031.1_5 Forward -195 -176 9.93088 0.164
NP_440306.1_5 Reverse -203 -222 -1.37718 0.292
NP_439985.1_1 Forward -105 -86 14.1591 0.138
NP_442993.1_1 Forward -234 -218 -8.88958 0.176
NP_442386.1_9 Reverse -235 -244 8.2591 0.205
NP_440570.1_5 Forward -203 -184 13.9625 0.111
NP_442054.1_3 Reverse -326 -345 3.14605 0.119
NP_441340.1_5 Reverse -367 -374 8.8889 0.084
NP_441947.1_10 Forward -86 -68 0.21581 0.276
NP_440586.1_8 Forward -261 -254 5.64364 0.297
NP_439937.1_9 Forward -215 -198 -1.63347 0.125
NP_439937.1_9 Reverse -81 -98 -17.268 0.296
NP_440439.1_1 Forward -24 -11 0.805932 0.175
NP_440439.1_1 Reverse -222 -235 -1.65234 0.275
NP_440372.1_2 Reverse -226 -233 4.07068 0.262
NP_442783.1_8 Forward -210 -191 23.008 0.0213
NP_440819.1_5 Reverse -153 -161 7.8859 0.266
NP_440316.1_10 Reverse -129 -139 8.04317 0.24
NP_440139.1_1 Reverse -219 -238 7.07848 0.137
NP_440210.1_10 Forward -82 -63 5.99684 0.296
NP_442384.1_10 Reverse -225 -238 5.03416 0.139
NP_442384.1_10 Reverse -360 -373 4.34585 0.16
NP_440399.1_1 Forward -172 -153 7.37428 0.3
NP_440163.1_10 Reverse -222 -232 11.3864 0.169
NP_440344.1_10 Forward -241 -224 -11.3676 0.212
NP_440282.1_10 Reverse -180 -199 -9.34199 0.277
NP_440531.1_6 Reverse -62 -81 -4.6221 0.284
NP_442280.1_10 Forward -82 -64 5.35702 0.287
NP_440700.1_8 Reverse -373 -387 11.6026 0.28
NP_440999.1_2 Forward -336 -317 9.73422 0.275
NP_440999.1_9 Reverse -80 -94 0.982901 0.172
NP_440888.1_2 Reverse -360 -374 14.5519 0.0168
NP_440888.1_2 Forward -234 -220 11.2087 0.0729
NP_440888.1_2 Reverse -265 -279 10.5204 0.0919
NP_440888.1_2 Forward -85 -71 7.47213 0.194
NP_440888.1_2 Reverse -13 -27 6.78381 0.22
NP_440888.1_2 Forward -163 -149 5.30886 0.284
NP_442892.1_6 Reverse -16 -35 2.55606 0.253
NP_442454.1_1 Reverse -88 -106 17.1692 0.148
NP_442277.1_2 Forward -80 -66 11.996 0.263
NP_442277.1_4 Reverse -364 -383 7.17681 0.148
NP_441543.1_3 Forward -206 -192 8.06211 0.286
NP_442315.1_1 Forward -195 -177 5.03403 0.256
NP_443064.1_6 Reverse -225 -235 16.5422 0.0796
NP_443064.1_6 Forward -369 -359 12.9547 0.0796
NP_443064.1_8 Reverse -132 -142 14.5325 0.299
NP_441306.1_7 Forward -72 -53 18.0924 0.133
NP_441462.1_2 Reverse -225 -235 8.63316 0.0339
NP_441462.1_2 Forward -369 -359 -1.10161 0.281
NP_442204.1_1 Forward -335 -324 6.05686 0.177
NP_442204.1_5 Forward -244 -225 -0.787193 0.298
NP_442487.1_5 Forward -252 -233 12.0933 0.194
NP_442537.1_3 Forward -250 -231 11.4058 0.28
NP_440516.1_8 Reverse -225 -234 7.17789 0.0754
NP_440516.1_8 Forward -234 -225 5.01461 0.118
NP_442768.1_6 Reverse -355 -374 19.174 0.234
NP_442080.1_7 Forward -239 -220 13.3725 0.0449
NP_441032.1_1 Forward -75 -56 11.1109 0.264
NP_441443.1_10 Forward -77 -59 5.22993 0.258
NP_442120.1_10 Forward -90 -71 -15.9302 0.296
NP_440673.1_3 Reverse -255 -262 10.9539 0.106
NP_440673.1_3 Forward -232 -225 10.1672 0.149
NP_440673.1_3 Forward -77 -70 8.98723 0.203
NP_440673.1_3 Reverse -362 -369 7.51227 0.252
NP_441052.1_2 Forward -64 -54 1.84832 0.225
NP_441052.1_2 Reverse -184 -194 0.766681 0.256
NP_441052.1_2 Forward -132 -122 0.471689 0.257
NP_441893.1_10 Reverse -178 -197 11.0125 0.242
NP_442864.1_2 Forward -144 -125 12.8808 0.23
NP_440314.1_9 Forward -212 -193 -8.85033 0.254
NP_441004.1_1 Reverse -64 -83 -17.7001 0.294
NP_441004.1_2 Reverse -59 -78 -0.000545616 0.247
NP_441004.1_4 Forward -378 -368 10.9931 0.254
NP_442813.1_4 Reverse -381 -400 -8.94866 0.299
NP_442139.1_7 Reverse -59 -78 9.3409 0.248
NP_441115.1_4 Reverse -224 -242 8.08151 0.263
NP_442694.1_4 Reverse -388 -397 11.4061 0.277
NP_442430.1_4 Forward -207 -188 13.9625 0.215
NP_441966.1_8 Reverse -340 -358 -3.81576 0.232
NP_442622.1_1 Reverse -372 -391 -12.9802 0.282
NP_442011.1_1 Reverse -224 -243 6.09597 0.186
NP_441668.1_4 Forward -385 -366 -2.65548 0.293
NP_442515.1_1 Forward -370 -356 3.14618 0.124
NP_440355.1_2 Forward -109 -90 27.1379 0.0017
NP_441046.1_2 Forward -387 -368 4.62101 0.228
NP_441349.1_10 Reverse -249 -268 -3.54046 0.144
NP_441349.1_10 Forward -244 -225 -7.4737 0.251
NP_442843.1_1 Forward -183 -164 -10.3253 0.277
NP_440396.1_1 Reverse -318 -337 -1.37718 0.214
NP_442450.1_5 Forward -236 -226 5.87989 0.218
NP_440588.1_2 Forward -378 -359 -4.91709 0.233
NP_441031.1_6 Forward -197 -178 10.7175 0.125
NP_440023.1_2 Forward -246 -227 8.25926 0.227
NP_440943.1_4 Reverse -326 -338 15.2803 0.194
NP_441003.1_9 Forward -364 -345 7.86593 0.227
NP_441570.1_1 Forward -268 -250 -16.9921 0.26
NP_441078.1_4 Reverse -225 -234 0.393051 0.205
NP_441078.1_4 Forward -234 -225 -0.000272808 0.205
NP_441539.1_5 Forward -382 -363 18.1907 0.27
NP_442443.1_1 Forward -351 -332 -6.09707 0.293
NP_441432.1_8 Forward -370 -361 11.9961 0.0519
NP_441432.1_8 Forward -112 -103 5.3096 0.17
NP_442320.1_8 Reverse -219 -233 -4.03198 0.142
NP_440629.1_4 Reverse -91 -110 10.2259 0.238
NP_440629.1_4 Reverse -323 -342 9.14423 0.255
NP_440199.1_10 Reverse -222 -232 12.6647 0.119
NP_441945.1_10 Forward -200 -181 7.66927 0.284
NP_442489.1_7 Forward -234 -225 0.688044 0.152
NP_442489.1_7 Reverse -225 -234 0.688044 0.152
NP_442489.1_7 Reverse -360 -369 -1.86856 0.259
NP_440559.1_1 Reverse -226 -235 4.81794 0.193
NP_441659.2_8 Reverse -13 -23 3.02829 0.177
NP_441659.2_8 Reverse -225 -235 0.0783647 0.277
NP_440860.1_8 Reverse -358 -377 15.9291 0.215
NP_441040.1_3 Forward -198 -179 13.2741 0.204
NP_442008.1_2 Reverse -331 -350 9.0459 0.188
NP_440831.1_3 Forward -243 -224 5.12514 0.29
NP_440459.1_2 Forward -283 -266 14.0018 0.119
NP_440459.1_2 Reverse -223 -240 12.5269 0.146
NP_440459.1_2 Forward -400 -383 10.0686 0.21
NP_442603.1_7 Reverse -225 -239 8.94708 0.161
NP_442603.1_7 Reverse -360 -374 6.19383 0.253
NP_442045.1_5 Forward -254 -235 -1.86883 0.29
NP_442199.1_7 Reverse -88 -107 4.91521 0.223
NP_442547.1_7 Reverse -60 -79 10.3196 0.279
NP_442497.1_10 Reverse -226 -235 0.393051 0.175
NP_440821.1_4 Reverse -223 -233 -0.41329 0.257
NP_441239.1_9 Forward -243 -231 4.26721 0.256
NP_440156.1_4 Forward -344 -334 8.92768 0.242
NP_441892.1_1 Reverse -61 -78 -1.73112 0.212
NP_441892.1_1 Forward -141 -124 -3.79607 0.249
NP_440796.1_3 Forward -376 -358 17.7179 0.187
NP_441508.1_4 Forward -205 -191 12.903 0.299
NP_441617.1_6 Reverse -96 -115 -1.86883 0.258
NP_440675.1_1 Reverse -357 -376 2.45773 0.267
NP_442402.1_4 Reverse -163 -182 -3.63955 0.219
NP_442402.1_4 Reverse -310 -329 -8.45774 0.282
NP_442039.1_7 Forward -172 -162 8.04317 0.267
NP_442053.1_1 Forward -234 -225 6.8829 0.111
NP_440505.1_3 Reverse -31 -41 8.63316 0.138
NP_440505.1_7 Reverse -192 -211 -1.86883 0.284
NP_442101.1_10 Forward -242 -223 -6.58872 0.194
NP_442533.1_6 Reverse -225 -234 4.91628 0.165
NP_442533.1_6 Forward -234 -225 4.42462 0.179
NP_442533.1_6 Forward -22 -13 3.14632 0.224
NP_442322.1_4 Forward -206 -189 4.16803 0.192
NP_442322.1_4 Forward -207 -190 -2.61678 0.234
NP_442322.1_4 Reverse -181 -198 -3.20676 0.243
NP_441482.1_7 Forward -240 -226 -10.5218 0.209
NP_440816.1_2 Forward -189 -170 8.08077 0.258
NP_440116.1_8 Reverse -226 -245 -7.57203 0.234
NP_441527.1_4 Reverse -27 -46 -5.10924 0.195
NP_441527.1_4 Forward -398 -379 -12.4621 0.288
NP_441059.1_2 Forward -179 -160 -7.27704 0.291
NP_440317.1_9 Forward -250 -231 18.7807 0.112
NP_441972.1_5 Reverse -226 -245 -0.295539 0.164
NP_439903.1_6 Forward -88 -69 4.32522 0.197
NP_442588.1_6 Reverse -187 -206 7.37428 0.173
NP_441286.1_1 Forward -370 -358 -4.68091 0.168
NP_442674.1_3 Reverse -62 -81 7.66846 0.216
NP_442674.1_3 Forward -140 -121 3.34192 0.294
NP_440670.1_8 Reverse -225 -234 8.55452 0.066
NP_440670.1_8 Forward -234 -225 5.99792 0.13
NP_441705.1_3 Reverse -189 -208 -3.83545 0.291
NP_440886.1_7 Reverse -224 -234 7.55106 0.0892
NP_440886.1_7 Reverse -83 -93 5.48612 0.181
NP_442072.1_9 Forward -370 -352 -13.9439 0.126
NP_442072.1_9 Forward -235 -217 -22.302 0.229
NP_441463.1_3 Forward -149 -130 -9.83364 0.286
NP_442794.1_1 Forward -238 -226 8.29878 0.114
NP_442087.1_2 Forward -185 -166 14.2768 0.22
NP_442087.1_2 Reverse -84 -103 13.5023 0.24
NP_441272.1_7 Reverse -196 -206 14.4347 0.225
NP_441237.1_6 Forward -343 -326 5.15205 0.234
NP_442743.1_1 Forward -215 -196 8.75009 0.264
NP_439910.1_2 Reverse -217 -234 6.13536 0.018
NP_440798.1_6 Reverse -226 -239 1.78924 0.197
NP_440142.1_7 Reverse -226 -245 12.2908 0.2
NP_442509.1_9 Forward -234 -224 13.3526 0.0571
NP_440554.1_4 Forward -233 -223 2.04498 0.279
NP_441885.1_5 Reverse -225 -235 -0.314959 0.195
NP_442341.1_7 Reverse -224 -238 10.521 0.0625
NP_442341.1_7 Reverse -122 -136 4.12949 0.2
NP_442341.1_7 Forward -370 -356 2.75286 0.247
NP_442341.1_9 Reverse -223 -237 13.077 0.0904
NP_441173.1_9 Forward -340 -332 10.9338 0.242
NP_442395.2_4 Reverse -224 -243 6.78348 0.142
NP_442534.1_7 Reverse -224 -243 12.5858 0.181
NP_440423.1_6 Reverse -62 -81 -15.7335 0.229
NP_440091.1_1 Reverse -221 -233 5.54551 0.114
NP_441902.1_3 Forward -330 -320 12.593 0.24
NP_440175.1_7 Reverse -132 -150 8.48479 0.297
NP_440216.1_1 Forward -234 -220 -5.70361 0.135
NP_440216.1_1 Reverse -225 -239 -11.8001 0.219
NP_440216.1_9 Reverse -71 -80 9.4395 0.286
NP_440216.1_9 Reverse -233 -242 7.17789 0.286
NP_440216.1_9 Reverse -72 -81 6.19458 0.289
NP_440172.1_1 Reverse -225 -235 3.71661 0.219
NP_442015.1_10 Forward -238 -225 15.6539 0.0201
NP_441226.1_7 Forward -155 -148 5.93863 0.266
NP_441766.1_2 Forward -234 -225 4.12963 0.194
NP_442252.1_4 Reverse -184 -203 12.0942 0.294
NP_440416.1_9 Forward -86 -67 -8.06369 0.109
NP_443052.1_8 Reverse -215 -234 -12.9802 0.27
NP_443052.1_9 Reverse -261 -280 -6.09707 0.276
NP_442116.1_6 Forward -101 -84 6.35461 0.28
NP_440261.1_5 Reverse -226 -239 -10.6988 0.203
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAACAAAAGGCCCAGGAAGTTTTGGCCTATGGCAATCAGCCCACGTTTATGACCCAGGATTTAGCCCAGTTGGGGGGTAAATATGACACAGTTATTTGTCTGGATGTGTTGATTCACTATCCAACGGAGGAGGCGTCAGCGATGATTAGCCACTTGGCTTCCCTGGCTGATCGCCGTTTAATTTTGAGCTTTGCCCCCAAAACCCTGGGCTTGACGGTGTTGAAAAAAATTGGGGGACTGTTTCCCGGTCCCAGTAAGACCACCAGGGCCTATCAACATAAAGAAGCAGACATTCGCAAAATTTTGGGAGATAACGGCTTTTCCATTGCCCGTACCGGCATGACCAGTACCCGTTTCTACTATTCCCGTATTTTAGAGGCGGTGCGCTCTTAAGTTCCC

CDS

ATGGCCATTACCCCCACCCAATTGTTGGATTGGAAGCGTCAACAACGGCCTATTGTGGCCCTTACTGCCTGGGATACGGCGATCGCCTCGGTGTTGGATGCGGCGGGAGTGGAAATTATTCTGGTGGGGGATTCCCTCGGAATGGTGGCTTTGGGCTACGAAACTACCCTACCGGTGAGCTTGGACACCATGATTCACCACACAGCGGCAGTTAAAAGGGGAGTACAAAGAGCCTTGGTGGTCTGTGACCTGCCCTTTTTGACCTATCAGGAAAGTCCAGCCCAGGCCATGGGGTCAGCGGGAAGGGTTTTGCAGGAAACCGGTGCCCAGGCAGTGAAATTAGAAGGGGGTCACCCCCGCATGGTGGAAACCGTAGCTCGACTAACGGAGGTGGGCATTCCGGTGATGGGTCATGTGGGCTTAACGCCCCAATCAGTCCATCAGTTGGGTTATCGGCAACAGGGCCAGGACCCGGCCACAGCGGAGAAAATTCTTCATCAGGCGATCGCCTTGGCAGAGGCGGGAGTGTTTGCCATTGTTTTAGAACATATTCCTAGCGAACTAGCGGCTAGTATCACTGAGCAGTTGCCCATTCCCACCATTGGCATTGGGGCAGGGCCCCAGTGTGACGGCCAGGTTTTGGTGACGGCGGATTTACTCGGTTTGACAGTCAAACAACCGCCCTTTGCTCCGGCCTATCTGAATTTACGACATACCATTACGGAAACAGTGCATAAATTCAGTGGAGAAGTGCGACAAAGACAATTTCCCCGGCGGGGTTAG

Protein

MAITPTQLLDWKRQQRPIVALTAWDTAIASVLDAAGVEIILVGDSLGMVALGYETTLPVSLDTMIHHTAAVKRGVQRALVVCDLPFLTYQESPAQAMGSAGRVLQETGAQAVKLEGGHPRMVETVARLTEVGIPVMGHVGLTPQSVHQLGYRQQGQDPATAEKILHQAIALAEAGVFAIVLEHIPSELAASITEQLPIPTIGIGAGPQCDGQVLVTADLLGLTVKQPPFAPAYLNLRHTITETVHKFSGEVRQRQFPRRG