Your browser is old and dusty. Try Google Chrome!

Details for slr0520

ORF slr0520
Accession NP_442529.1
Symbol purL
Category Purine ribonucleotide biosynthesis
Definition phosphoribosyl formylglycinamidine synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -100 -107 10.2655 0.154
NP_441418.1_6 Reverse -45 -64 -30.1882 0.262
NP_441418.1_6 Reverse -158 -177 -30.6798 0.291
NP_441453.1_4 Forward -108 -100 4.14932 0.264
NP_440226.1_1 Forward -54 -35 10.9142 0.0579
NP_442169.1_1 Forward -298 -279 -1.57384 0.265
NP_441098.1_3 Forward -149 -130 -4.01355 0.28
NP_442173.1_1 Reverse -100 -108 4.73931 0.258
NP_442752.1_4 Forward -54 -47 13.5105 0.0314
NP_442975.1_10 Forward -58 -44 5.50552 0.219
NP_442861.1_1 Reverse -57 -76 12.8808 0.26
NP_440061.1_9 Reverse -156 -170 5.01387 0.298
NP_442062.1_8 Forward -54 -44 4.50326 0.212
NP_440370.1_10 Forward -182 -163 10.1275 0.211
NP_441925.1_2 Forward -44 -25 6.78429 0.262
NP_441083.1_5 Forward -296 -286 3.12662 0.182
NP_441434.1_1 Forward -373 -359 6.98253 0.291
NP_441558.1_5 Reverse -162 -181 13.6675 0.0561
NP_440209.1_1 Reverse -164 -172 2.08437 0.286
NP_442889.1_8 Forward -57 -43 10.3237 0.0864
NP_441770.1_4 Forward -175 -156 -11.1119 0.29
NP_440747.1_10 Reverse -155 -167 -2.32097 0.0331
NP_441486.1_1 Reverse -42 -56 -1.77037 0.175
NP_442330.1_4 Forward -311 -292 12.1159 0.294
NP_442634.1_4 Reverse -97 -111 3.44117 0.108
NP_441014.1_10 Reverse -44 -63 10.52 0.118
NP_442848.1_5 Forward -115 -97 -2.3408 0.285
NP_443018.1_3 Reverse -100 -107 4.36568 0.254
NP_443018.1_3 Forward -172 -165 4.26735 0.267
NP_443018.1_3 Forward -107 -100 4.07068 0.299
NP_443018.1_3 Reverse -165 -172 4.07068 0.299
NP_441634.1_9 Reverse -100 -119 12.7816 0.198
NP_440376.1_1 Forward -167 -158 4.32629 0.163
NP_442485.1_3 Forward -65 -46 -5.50708 0.291
NP_442485.1_3 Reverse -43 -62 -6.09707 0.299
NP_440642.1_10 Forward -271 -257 2.5556 0.277
NP_441422.1_7 Forward -119 -102 -6.451 0.251
NP_442658.1_1 Forward -175 -165 12.6642 0.0497
NP_442658.1_1 Reverse -97 -107 4.89613 0.292
NP_440141.1_8 Reverse -242 -261 6.98095 0.251
NP_442205.1_9 Forward -114 -98 -2.00642 0.266
NP_441414.1_9 Reverse -164 -183 -8.26035 0.232
NP_442300.1_10 Reverse -102 -121 9.3409 0.294
NP_440203.1_5 Reverse -161 -171 12.6642 0.141
NP_440995.1_8 Reverse -35 -54 4.916 0.264
NP_442690.1_1 Forward -47 -28 -10.3253 0.212
NP_442911.1_2 Forward -183 -164 -4.52377 0.136
NP_440153.1_8 Forward -108 -95 7.39411 0.166
NP_440993.1_3 Forward -121 -102 4.71854 0.161
NP_440934.1_2 Reverse -195 -214 16.5191 0.0813
NP_441348.1_3 Reverse -271 -290 8.75091 0.235
NP_441916.1_7 Forward -108 -98 6.27322 0.102
NP_441916.1_7 Reverse -99 -109 5.38824 0.134
NP_440465.1_10 Reverse -96 -115 -0.590531 0.29
NP_441568.1_7 Reverse -9 -28 15.0441 0.114
NP_439966.1_9 Forward -212 -203 4.0313 0.253
NP_442941.1_3 Reverse -46 -56 -0.904945 0.274
NP_440260.1_8 Reverse -101 -119 -3.52077 0.252
NP_441334.1_7 Reverse -97 -116 -11.8003 0.126
NP_440723.1_4 Reverse -51 -70 -10.522 0.284
NP_441556.1_4 Forward -185 -166 12.3189 0.219
NP_442933.1_10 Reverse -99 -108 5.11294 0.204
NP_441751.2_8 Forward -172 -158 -5.40861 0.206
NP_442926.1_3 Reverse -100 -119 2.16274 0.295
NP_442554.1_8 Reverse -165 -175 2.04498 0.285
NP_442016.1_10 Forward -174 -155 4.22769 0.289
NP_441865.1_3 Reverse -29 -47 13.8838 0.242
NP_442301.1_1 Reverse -311 -330 3.6377 0.297
NP_442301.1_2 Forward -115 -96 6.58682 0.263
NP_441371.1_3 Forward -175 -157 7.59063 0.277
NP_441715.1_4 Reverse -46 -56 6.46988 0.143
NP_441715.1_4 Reverse -381 -391 5.87989 0.172
NP_440183.1_9 Reverse -47 -66 -13.5702 0.26
NP_440183.1_9 Reverse -269 -288 -20.945 0.294
NP_441468.1_1 Reverse -100 -107 4.46401 0.224
NP_441468.1_1 Forward -172 -165 4.07068 0.263
NP_441015.1_10 Reverse -211 -230 -8.85033 0.277
NP_441673.1_1 Reverse -158 -167 -8.06341 0.254
NP_440145.1_3 Reverse -35 -54 -5.11376 0.258
NP_440558.1_2 Forward -176 -157 5.99764 0.137
NP_440558.1_2 Forward -289 -270 -6.29373 0.273
NP_441518.1_3 Forward -64 -45 -7.17871 0.152
NP_442503.1_10 Forward -92 -73 16.5191 0.285
NP_441590.1_4 Forward -284 -265 8.06178 0.249
NP_440101.1_10 Forward -114 -95 9.24257 0.168
NP_442192.1_8 Reverse -95 -114 9.53756 0.289
NP_441574.1_1 Reverse -99 -118 3.04771 0.151
NP_441574.1_1 Forward -66 -47 -3.44213 0.238
NP_442347.1_2 Reverse -46 -55 4.52295 0.282
NP_442594.1_8 Reverse -259 -278 4.03102 0.274
NP_442594.1_8 Reverse -87 -106 3.83436 0.279
NP_441633.1_3 Reverse -43 -56 -1.849 0.165
NP_441633.1_3 Forward -35 -22 -2.34066 0.177
NP_442998.1_10 Reverse -47 -54 5.84064 0.235
NP_440640.1_9 Reverse -251 -270 11.2092 0.298
NP_440256.1_1 Reverse -42 -61 -7.4737 0.238
NP_440087.1_5 Forward -194 -175 9.53756 0.114
NP_441090.1_2 Reverse -202 -221 5.40766 0.154
NP_441559.1_8 Forward -290 -276 11.7993 0.0574
NP_441559.1_8 Forward -172 -158 -4.32697 0.222
NP_442866.1_9 Reverse -323 -342 9.0459 0.177
NP_440748.1_4 Reverse -261 -280 18.4848 0.137
NP_441199.1_6 Reverse -119 -138 0.58944 0.24
NP_441494.1_6 Forward -113 -100 6.50913 0.285
NP_442386.1_9 Reverse -157 -166 6.48915 0.219
NP_440570.1_5 Forward -124 -105 -2.95047 0.283
NP_441340.1_5 Reverse -165 -172 3.97235 0.274
NP_441340.1_5 Forward -107 -100 3.97235 0.274
NP_440586.1_8 Reverse -165 -172 9.57686 0.146
NP_440586.1_9 Forward -226 -207 8.06259 0.273
NP_442251.1_6 Reverse -46 -53 10.4622 0.12
NP_440027.1_3 Reverse -200 -218 5.72158 0.237
NP_439937.1_8 Forward -119 -100 -0.787193 0.242
NP_439937.1_9 Reverse -163 -180 -10.1882 0.224
NP_440408.1_7 Reverse -214 -233 7.07928 0.292
NP_441803.1_2 Reverse -207 -226 5.211 0.17
NP_440364.1_6 Forward -174 -161 14.08 0.275
NP_442262.1_10 Reverse -191 -198 7.90559 0.266
NP_440344.1_10 Forward -174 -157 -11.9575 0.235
NP_441060.1_3 Forward -159 -140 18.584 0.184
NP_441335.1_8 Forward -210 -191 6.29264 0.287
NP_442529.1_1 Forward -230 -211 28.3188 0.00167
NP_442529.1_2 Forward -65 -46 27.1388 0.0028
NP_442529.1_3 Forward -152 -133 27.6305 0.00256
NP_442529.1_4 Forward -86 -67 16.2241 0.154
NP_442529.1_5 Forward -260 -241 23.598 0.0387
NP_442529.1_6 Forward -209 -190 25.8605 0.000685
NP_442529.1_7 Forward -119 -100 24.8772 0.00227
NP_442529.1_8 Forward -45 -26 29.2038 0.000673
NP_442529.1_9 Forward -188 -169 26.2538 0.00252
NP_440297.1_9 Forward -285 -275 3.61828 0.263
NP_440894.1_10 Forward -227 -208 2.55606 0.288
NP_443036.1_8 Reverse -88 -107 11.7008 0.28
NP_440888.1_2 Forward -167 -153 8.25877 0.167
NP_440888.1_2 Forward -108 -94 7.66879 0.186
NP_440179.1_6 Reverse -333 -352 2.85105 0.29
NP_442277.1_7 Reverse -239 -255 -0.661641 0.227
NP_441543.1_2 Reverse -46 -55 5.60459 0.189
NP_442845.1_2 Reverse -158 -172 6.19444 0.215
NP_442845.1_2 Forward -114 -100 4.32615 0.261
NP_441469.1_8 Forward -13 -4 7.47288 0.227
NP_441469.1_8 Forward -174 -165 5.60459 0.258
NP_440220.1_4 Reverse -281 -300 -0.29631 0.261
NP_442428.1_5 Reverse -100 -107 4.759 0.223
NP_442428.1_5 Forward -172 -165 4.46401 0.267
NP_442859.1_2 Forward -172 -153 5.99764 0.201
NP_442120.1_10 Reverse -99 -118 -9.44032 0.242
NP_442120.1_10 Reverse -3 -22 -14.4552 0.288
NP_442120.1_10 Reverse -96 -115 -14.7502 0.289
NP_442120.1_10 Forward -303 -284 -14.8485 0.289
NP_441052.1_2 Forward -54 -44 4.60159 0.154
NP_442219.1_9 Forward -166 -157 2.06468 0.289
NP_440436.1_4 Forward -259 -250 5.50585 0.195
NP_441884.1_9 Reverse -99 -118 -9.73531 0.0652
NP_441004.1_1 Forward -312 -293 -16.1268 0.283
NP_442139.1_10 Reverse -294 -313 14.9449 0.188
NP_440296.1_4 Forward -348 -329 17.0931 0.183
NP_441966.1_7 Reverse -107 -126 -1.57461 0.288
NP_441851.1_9 Reverse -203 -222 12.5858 0.186
NP_441195.1_9 Reverse -156 -175 15.5357 0.133
NP_441046.1_2 Forward -74 -55 4.22769 0.229
NP_441409.1_6 Forward -173 -154 -12.0953 0.225
NP_440432.1_2 Reverse -267 -286 0.294447 0.249
NP_442843.1_1 Reverse -100 -119 -10.9153 0.282
NP_440474.1_8 Reverse -46 -60 8.84875 0.175
NP_440933.1_6 Forward -66 -47 16.9124 0.0354
NP_442168.1_5 Reverse -100 -119 12.0942 0.137
NP_440588.1_2 Reverse -107 -126 -5.99873 0.266
NP_440954.1_1 Reverse -99 -118 -12.1936 0.3
NP_442006.1_2 Forward -63 -46 -7.04099 0.169
NP_441003.1_9 Reverse -45 -64 6.19431 0.254
NP_441570.1_1 Forward -54 -36 -11.8789 0.204
NP_441570.1_1 Forward -357 -339 -11.9772 0.206
NP_441570.1_1 Forward -173 -155 -17.2871 0.269
NP_441078.1_4 Forward -167 -158 -1.77023 0.266
NP_440539.1_9 Reverse -189 -208 -5.9004 0.286
NP_442443.1_1 Forward -214 -195 -5.70374 0.284
NP_441732.1_1 Forward -372 -358 18.2506 0.297
NP_441732.1_2 Forward -118 -102 -16.3627 0.165
NP_441732.1_2 Forward -97 -81 -16.9527 0.223
NP_442489.1_7 Forward -167 -158 -1.77023 0.247
NP_440757.1_7 Reverse -106 -124 13.6872 0.11
NP_440565.1_7 Reverse -88 -107 0.294447 0.249
NP_442079.1_7 Reverse -46 -65 1.0811 0.263
NP_441659.2_8 Forward -108 -98 4.0116 0.146
NP_440363.1_9 Reverse -96 -114 15.2604 0.187
NP_442346.1_5 Forward -109 -99 8.63316 0.131
NP_442346.1_5 Reverse -163 -173 8.63316 0.131
NP_440545.1_3 Forward -112 -95 1.31714 0.121
NP_441629.1_3 Forward -97 -78 -4.1312 0.29
NP_441653.1_2 Reverse -249 -268 3.62625 0.264
NP_440010.1_10 Forward -132 -113 10.7175 0.209
NP_440010.1_10 Forward -66 -47 10.3242 0.209
NP_440847.1_3 Forward -267 -253 17.6985 0.115
NP_442603.1_7 Forward -221 -207 8.25877 0.178
NP_441948.1_4 Reverse -270 -288 -0.865831 0.139
NP_440751.1_9 Reverse -13 -32 4.22769 0.245
NP_442498.1_5 Forward -116 -97 8.35759 0.289
NP_440671.1_4 Reverse -184 -198 9.43936 0.184
NP_442073.1_6 Reverse -149 -168 0.196116 0.25
NP_442140.1_3 Reverse -165 -175 13.1564 0.0624
NP_441696.1_6 Forward -172 -153 0.294447 0.294
NP_441259.1_8 Reverse -48 -67 13.9616 0.247
NP_440035.1_10 Forward -304 -286 17.3648 0.229
NP_440821.1_4 Forward -56 -46 -0.314959 0.251
NP_441951.1_9 Reverse -324 -343 4.03102 0.254
NP_441892.1_1 Forward -117 -100 10.0686 0.0683
NP_441892.1_1 Reverse -155 -172 -3.40274 0.239
NP_441892.1_1 Reverse -258 -275 -5.86102 0.29
NP_440604.1_6 Forward -343 -324 -0.590531 0.183
NP_440462.1_6 Forward -56 -46 2.7333 0.278
NP_442340.1_3 Reverse -145 -164 -10.7186 0.291
NP_442787.1_9 Reverse -14 -33 14.3558 0.296
NP_442479.1_9 Forward -184 -165 -8.55534 0.266
NP_442840.1_7 Forward -115 -96 9.24257 0.163
NP_442402.1_4 Reverse -129 -148 -8.16275 0.278
NP_439942.1_7 Reverse -273 -292 -5.31042 0.278
NP_440696.1_3 Forward -177 -159 3.46073 0.206
NP_442039.1_7 Reverse -154 -164 7.55152 0.275
NP_442380.1_10 Reverse -197 -215 8.08229 0.263
NP_440505.1_3 Reverse -156 -166 6.46988 0.18
NP_440914.1_1 Reverse -158 -168 8.32233 0.197
NP_441011.1_8 Reverse -100 -109 4.91628 0.296
NP_442533.1_6 Reverse -99 -108 1.76968 0.289
NP_442533.1_6 Reverse -111 -120 1.57302 0.294
NP_442232.1_3 Forward -20 -1 -12.5869 0.282
NP_442322.1_4 Forward -288 -271 -1.33848 0.226
NP_441219.1_6 Forward -64 -46 9.75391 0.273
NP_440007.1_9 Reverse -85 -99 1.96621 0.281
NP_441106.1_1 Reverse -98 -107 5.01461 0.191
NP_441106.1_1 Forward -109 -100 5.01461 0.191
NP_441106.1_1 Forward -174 -165 2.55633 0.28
NP_440429.1_1 Reverse -130 -149 20.1564 0.0458
NP_440429.1_2 Reverse -196 -215 10.1275 0.267
NP_440429.1_4 Reverse -61 -80 23.2056 0.0515
NP_440429.1_5 Reverse -31 -50 34.021 0.0000196
NP_439903.1_6 Forward -374 -355 -0.689632 0.284
NP_442306.1_10 Reverse -94 -113 -21.24 0.254
NP_441286.1_1 Reverse -44 -56 -6.35254 0.26
NP_442382.1_5 Reverse -197 -216 18.0924 0.15
NP_440028.1_6 Forward -215 -197 10.1472 0.289
NP_441463.1_3 Forward -64 -45 -9.34199 0.278
NP_440107.1_5 Reverse -157 -176 1.57275 0.178
NP_441962.1_4 Reverse -283 -302 -10.817 0.232
NP_441962.1_4 Forward -198 -179 -13.6686 0.277
NP_440855.1_5 Forward -169 -150 2.55527 0.288
NP_441431.1_2 Forward -111 -97 11.7987 0.132
NP_441836.1_2 Reverse -93 -112 3.53937 0.151
NP_441993.1_1 Reverse -99 -118 1.36194 0.28
NP_441174.1_2 Reverse -96 -110 11.5043 0.296
NP_440311.1_3 Forward -188 -169 12.0942 0.297
NP_439988.1_3 Reverse -100 -114 6.19444 0.278
NP_440554.1_4 Forward -107 -97 4.99491 0.167
NP_440554.1_4 Reverse -165 -175 2.43831 0.265
NP_442862.1_3 Forward -348 -331 5.25038 0.279
NP_441885.1_5 Forward -167 -157 -0.708283 0.222
NP_441885.1_5 Reverse -334 -344 -1.78992 0.284
NP_442703.1_6 Forward -382 -363 16.1855 0.233
NP_442341.1_7 Reverse -157 -171 5.1128 0.167
NP_440275.1_3 Forward -175 -165 5.48657 0.145
NP_440091.1_1 Forward -177 -165 7.70879 0.0785
NP_439962.1_4 Forward -119 -100 -5.60541 0.28
NP_442373.1_2 Reverse -93 -112 -11.6036 0.297
NP_440244.1_1 Reverse -257 -276 -7.4737 0.287
NP_442116.1_6 Reverse -27 -44 5.87715 0.289
NP_440988.1_4 Forward -216 -197 17.6007 0.0875
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAAATAATCCGGCGCTCTTTAGCAGTAAAGTGATTTCATTTTCGAGATCTAGATTTGGGGCTAGTCTTGCCGAGAAAGACTTTCTAAGGCAGGATTAACAGTGGCAGATTCCCCGGTAAGGCCCTCCATGTCCCATTCCTACCATTGTCGTATTTACGTTACCCTACGTCCCTCCGTGCTTGACCCCGCTGGGACTGCTGTGCAATCTGGTTTGCAACAATTGGGCTACGATGGCGTTTCCCAGGTCAGAATTGGTAAATACATTGAGTTAACCCTCGAGGCCCCGGACGAAGCCACCGCTTCCCAACAGCTAGACACCATGTGTGACCAACTATTGGCCAATACGGTGATCGAAAATTATTGCTTTGAAATTACCGCCCTAGAAGGTGCCGTCACACC

CDS

ATGACCAGTTTTGGTATTATTGTTTTCCCCGGTTCCAACTGCGATCGGGACATTGCCACCGTCACCGCCGGTTTATTAGACCAGCCAACTCGATTTATTTGGCACCAAGAAACCGATCTCCACGGGGTAGATGTGGTGGTTTTGCCAGGGGGCTTCAGCTACGGTGATTATCTCCGCTGTGGGGCGATCGCCAGATTTTCTCCTATTATGACCGCCATCATTGACCATGCCAACGCAGGCAAAAGGGTGTTGGGTATCTGTAACGGTTTTCAGGTGCTAACGGAAGTTGGTTTACTGCCGGGGGCTTTAATTCGCAATCGGGATTTACATTTCATCTGTGACCGGGTGACCGTGCGGGTTGAAAGTAACCAGACAGTCTGGACAAAGGGTTACCAATCCCAACAGGTAATCACCCTTCCCATTGCCCACGGCGAGGGCCGCTATTTTGCTGATGGGGATACGTTGAAAGCCTTGGAGGATAACGAGCAAATTCTCTTCCGCTACAGCAACGCCCAGGGGGAATTGACAACGGACAGCAATCCCAACGGTTCTTTGCACAATATTGCTGGCATTACCAATGTCCAAGGTAATGTGCTGGGCATGATGCCCCACCCAGAACGGGCGGCCGATCGCCTACTCAAGGCCACTGATGGCCTGGCCATGTTTATCAGTTAG

Protein

MTSFGIIVFPGSNCDRDIATVTAGLLDQPTRFIWHQETDLHGVDVVVLPGGFSYGDYLRCGAIARFSPIMTAIIDHANAGKRVLGICNGFQVLTEVGLLPGALIRNRDLHFICDRVTVRVESNQTVWTKGYQSQQVITLPIAHGEGRYFADGDTLKALEDNEQILFRYSNAQGELTTDSNPNGSLHNIAGITNVQGNVLGMMPHPERAADRLLKATDGLAMFIS