Your browser is old and dusty. Try Google Chrome!

Details for slr0517

ORF slr0517
Accession NP_442526.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -137 -123 6.48943 0.117
NP_441061.1_2 Forward -365 -351 -0.000409212 0.219
NP_441061.1_2 Reverse -130 -144 -0.590395 0.234
NP_441061.1_5 Forward -109 -95 17.7968 0.289
NP_440557.1_1 Reverse -211 -230 0.196116 0.265
NP_440795.1_7 Forward -137 -130 14.6904 0.0123
NP_440795.1_7 Reverse -130 -137 14.6904 0.0123
NP_441418.1_6 Forward -138 -119 -19.5684 0.0906
NP_441418.1_6 Reverse -129 -148 -29.4998 0.228
NP_442291.1_5 Reverse -128 -144 -3.97304 0.261
NP_440897.1_6 Forward -138 -119 1.86696 0.17
NP_441453.1_4 Reverse -129 -137 16.539 0.00633
NP_441453.1_4 Forward -138 -130 16.539 0.00633
NP_441453.1_4 Reverse -202 -210 4.83764 0.237
NP_442151.1_6 Forward -138 -124 7.9644 0.184
NP_442151.1_6 Reverse -129 -143 6.19444 0.244
NP_442838.1_7 Reverse -124 -143 -10.6203 0.232
NP_441818.1_1 Forward -137 -126 9.69459 0.232
NP_440226.1_1 Reverse -129 -148 6.68596 0.122
NP_440226.1_1 Forward -138 -119 2.75272 0.253
NP_442655.1_2 Reverse -93 -112 7.96426 0.147
NP_442655.1_2 Reverse -92 -111 7.27595 0.159
NP_442173.1_1 Forward -137 -129 15.4574 0.00633
NP_442173.1_1 Reverse -130 -138 15.4574 0.00633
NP_442752.1_4 Forward -138 -131 13.8055 0.0199
NP_442752.1_4 Reverse -129 -136 13.8055 0.0199
NP_443027.1_4 Forward -140 -130 16.2046 0.0437
NP_443027.1_4 Reverse -127 -137 14.828 0.0437
NP_441812.1_3 Reverse -128 -142 15.0442 0.106
NP_441812.1_3 Forward -139 -125 7.9644 0.254
NP_442975.1_10 Reverse -125 -139 13.7653 0.0459
NP_442975.1_10 Forward -142 -128 3.34225 0.259
NP_442975.1_10 Forward -215 -201 1.47397 0.297
NP_440784.1_7 Forward -137 -130 15.9687 0.0123
NP_440784.1_7 Reverse -130 -137 15.9687 0.0123
NP_442062.1_8 Forward -138 -128 19.4496 0.000558
NP_442062.1_8 Reverse -129 -139 10.3048 0.0493
NP_440761.1_4 Reverse -124 -143 -13.9635 0.257
NP_440304.1_4 Forward -140 -130 19.9412 0.00364
NP_440304.1_4 Reverse -127 -137 10.8948 0.051
NP_442242.1_4 Forward -137 -130 14.3954 0.0124
NP_442242.1_4 Reverse -130 -137 14.3954 0.0124
NP_440044.1_8 Reverse -130 -149 0.58944 0.195
NP_442762.1_10 Forward -359 -340 -2.26216 0.205
NP_440011.1_1 Forward -356 -337 20.8456 0.0761
NP_442602.1_3 Forward -381 -362 9.83255 0.0751
NP_442602.1_3 Forward -254 -235 -2.75381 0.265
NP_441619.1_8 Forward -144 -130 8.65209 0.237
NP_442742.1_9 Reverse -331 -350 -1.18052 0.182
NP_441365.1_5 Forward -280 -261 -4.22878 0.169
NP_442110.1_7 Forward -138 -124 1.96621 0.222
NP_441082.1_10 Reverse -97 -110 12.0157 0.236
NP_441925.1_4 Forward -112 -93 -17.0125 0.287
NP_441083.1_5 Forward -138 -128 11.3864 0.0159
NP_441083.1_5 Reverse -129 -139 11.2881 0.0159
NP_441083.1_5 Forward -211 -201 -0.511621 0.269
NP_442827.1_8 Reverse -121 -140 2.16195 0.165
NP_441434.1_1 Reverse -264 -278 9.17885 0.246
NP_441738.1_2 Forward -136 -129 15.28 0.0102
NP_441738.1_2 Reverse -131 -138 15.28 0.0102
NP_441558.1_5 Forward -140 -121 5.01433 0.265
NP_440209.1_1 Reverse -129 -137 18.1123 0.00295
NP_440209.1_1 Forward -138 -130 18.1123 0.00295
NP_442889.1_1 Forward -361 -342 -14.6519 0.279
NP_442889.1_8 Reverse -126 -140 11.4053 0.0733
NP_442889.1_8 Forward -141 -127 6.78381 0.175
NP_440178.1_7 Reverse -128 -147 -22.6167 0.268
NP_440178.1_7 Forward -139 -120 -23.1083 0.294
NP_442570.1_3 Forward -357 -338 -4.32711 0.23
NP_442570.1_3 Reverse -100 -119 -9.63698 0.3
NP_441624.1_7 Reverse -339 -353 10.816 0.217
NP_441163.1_4 Reverse -340 -359 16.9866 0.205
NP_440343.1_9 Forward -359 -340 16.3224 0.139
NP_440906.1_5 Forward -137 -130 15.8704 0.0124
NP_440906.1_5 Reverse -130 -137 15.8704 0.0124
NP_440747.1_10 Forward -141 -129 -2.02597 0.0196
NP_440747.1_10 Reverse -126 -138 -2.02597 0.0196
NP_440747.1_10 Reverse -199 -211 -2.71429 0.0639
NP_440322.1_4 Forward -354 -335 9.43923 0.249
NP_441486.1_1 Reverse -126 -140 11.6026 0.0153
NP_441486.1_1 Forward -141 -127 1.96621 0.0939
NP_442634.1_4 Reverse -127 -141 -1.8687 0.149
NP_442634.1_4 Forward -140 -126 -2.26202 0.149
NP_442634.1_4 Reverse -349 -363 -4.52363 0.206
NP_441014.1_5 Reverse -106 -124 11.3272 0.258
NP_441014.1_8 Reverse -338 -357 -0.0988766 0.218
NP_442848.1_1 Forward -144 -130 -1.37704 0.263
NP_442848.1_5 Reverse -368 -386 8.7706 0.232
NP_441012.1_4 Forward -203 -190 5.62415 0.291
NP_443018.1_3 Forward -137 -130 14.8871 0.0123
NP_443018.1_3 Reverse -130 -137 14.8871 0.0123
NP_441316.1_7 Reverse -127 -142 6.07642 0.107
NP_441634.1_8 Forward -159 -145 5.89945 0.114
NP_441634.1_8 Forward -140 -126 2.45787 0.167
NP_441634.1_9 Forward -359 -340 17.7965 0.104
NP_440376.1_1 Forward -138 -129 19.4693 0.000692
NP_440376.1_1 Reverse -129 -138 19.4693 0.000692
NP_440376.1_1 Forward -55 -46 -0.000272808 0.285
NP_441588.1_4 Forward -136 -126 6.96153 0.178
NP_441588.1_4 Forward -152 -142 6.37155 0.2
NP_442687.1_7 Reverse -128 -138 15.8113 0.0125
NP_442687.1_7 Forward -139 -129 9.02648 0.0994
NP_441846.1_10 Forward -358 -339 -21.7317 0.256
NP_441013.1_2 Reverse -340 -358 1.49411 0.248
NP_441763.1_10 Reverse -118 -137 10.9134 0.143
NP_442658.1_1 Reverse -127 -137 15.9091 0.00966
NP_442658.1_1 Forward -140 -130 13.0576 0.04
NP_442658.1_1 Forward -156 -146 8.04271 0.199
NP_440141.1_8 Forward -63 -44 16.9124 0.12
NP_442544.1_6 Forward -145 -126 -5.80207 0.298
NP_441414.1_9 Forward -138 -119 12.3892 0.0161
NP_441414.1_9 Reverse -129 -148 3.53937 0.0582
NP_440607.1_5 Forward -356 -337 -0.885524 0.281
NP_441958.1_5 Forward -139 -129 21.2195 0.000805
NP_441958.1_5 Reverse -128 -138 12.2714 0.00183
NP_442836.1_10 Reverse -102 -112 14.4347 0.212
NP_442836.1_10 Forward -74 -64 8.73149 0.299
NP_442685.1_2 Reverse -91 -101 15.8113 0.164
NP_440984.1_7 Reverse -124 -138 11.3077 0.122
NP_440984.1_7 Forward -159 -145 6.88276 0.195
NP_442911.1_2 Reverse -119 -138 6.19431 0.03
NP_442911.1_2 Forward -148 -129 -2.95047 0.105
NP_440369.1_5 Forward -372 -353 14.8474 0.18
NP_442064.1_4 Reverse -192 -211 12.585 0.151
NP_440602.1_8 Forward -138 -124 9.5377 0.298
NP_442002.1_1 Forward -357 -339 -7.94566 0.261
NP_442002.1_9 Reverse -128 -135 10.7572 0.185
NP_440809.1_9 Forward -147 -129 -6.86402 0.225
NP_440809.1_9 Reverse -120 -138 -7.94566 0.225
NP_441646.1_1 Forward -232 -213 -1.7705 0.294
NP_442438.1_10 Reverse -124 -138 9.83269 0.0602
NP_442438.1_10 Forward -306 -292 3.04785 0.166
NP_441000.1_6 Forward -139 -125 -3.34366 0.221
NP_440147.1_4 Reverse -127 -140 2.77255 0.202
NP_440147.1_4 Forward -140 -127 2.37923 0.208
NP_441550.1_8 Forward -140 -130 13.0576 0.0273
NP_441550.1_8 Reverse -127 -137 6.0761 0.214
NP_441916.1_7 Reverse -129 -139 18.9579 0.00144
NP_441916.1_7 Forward -138 -128 18.4663 0.00144
NP_441041.1_4 Forward -138 -119 1.0811 0.0818
NP_441041.1_4 Reverse -345 -364 -13.6686 0.293
NP_441041.1_7 Reverse -126 -138 10.916 0.0864
NP_440715.1_1 Reverse -351 -370 14.7491 0.131
NP_442396.1_5 Forward -142 -129 9.36073 0.13
NP_442396.1_5 Reverse -125 -138 6.90245 0.215
NP_441725.1_5 Forward -137 -127 11.2881 0.0247
NP_441725.1_5 Reverse -130 -140 11.1898 0.0247
NP_439966.1_7 Reverse -127 -137 18.4657 0.00473
NP_439966.1_7 Forward -140 -130 14.8275 0.0177
NP_439966.1_9 Reverse -127 -136 0.983037 0.253
NP_442941.1_3 Reverse -130 -140 19.9412 0.00262
NP_442941.1_3 Forward -137 -127 11.4848 0.0116
NP_442941.1_3 Forward -210 -200 -0.314959 0.256
NP_440289.1_2 Reverse -126 -139 14.5723 0.0107
NP_440289.1_2 Forward -141 -128 -2.83231 0.262
NP_441514.1_4 Forward -67 -48 14.1533 0.25
NP_442281.1_1 Reverse -124 -138 19.0751 0.00329
NP_442281.1_1 Forward -143 -129 8.25877 0.0832
NP_442281.1_5 Forward -135 -116 16.1249 0.202
NP_440437.1_1 Reverse -355 -374 0.0977854 0.172
NP_440437.1_1 Reverse -123 -142 -0.590531 0.183
NP_441860.1_6 Reverse -272 -291 18.7011 0.228
NP_440498.1_1 Reverse -120 -138 11.0322 0.0786
NP_441644.1_6 Reverse -129 -139 19.0557 0.000803
NP_441644.1_6 Forward -138 -128 10.1076 0.0628
NP_442215.1_2 Reverse -43 -59 -2.49807 0.198
NP_442215.1_2 Forward -140 -124 -3.67804 0.22
NP_442177.1_5 Reverse -99 -113 20.1574 0.0617
NP_442029.1_6 Reverse -346 -365 2.45773 0.296
NP_440253.1_2 Forward -138 -120 -1.16082 0.234
NP_440929.1_8 Forward -138 -129 19.2726 0.000701
NP_440929.1_8 Reverse -129 -138 19.2726 0.000701
NP_440566.1_6 Reverse -94 -113 11.2092 0.224
NP_440566.1_6 Forward -140 -121 10.2259 0.258
NP_442933.1_10 Forward -138 -129 17.601 0.00325
NP_442933.1_10 Reverse -129 -138 17.601 0.00325
NP_440891.1_8 Reverse -76 -95 15.0348 0.233
NP_441751.2_8 Reverse -130 -144 5.60446 0.0419
NP_441751.2_8 Forward -137 -123 -4.03198 0.158
NP_441751.2_8 Forward -210 -196 -4.91696 0.187
NP_442554.1_8 Reverse -130 -140 16.9913 0.0065
NP_442554.1_8 Forward -137 -127 13.8447 0.0145
NP_442167.1_6 Reverse -150 -166 11.4642 0.256
NP_441762.1_7 Forward -139 -127 2.98891 0.0676
NP_441762.1_7 Reverse -128 -140 2.20226 0.0676
NP_442313.1_5 Reverse -197 -216 6.29264 0.236
NP_442142.1_4 Reverse -126 -139 16.4399 0.0264
NP_442142.1_4 Forward -141 -128 8.18017 0.12
NP_442292.1_1 Reverse -130 -139 17.5026 0.00435
NP_442292.1_1 Forward -137 -128 9.63616 0.0183
NP_442476.1_6 Reverse -130 -144 0.491246 0.258
NP_440421.1_1 Forward -97 -83 13.5693 0.297
NP_443009.1_5 Forward -139 -128 19.626 0.00102
NP_443009.1_5 Reverse -128 -139 7.82632 0.118
NP_441715.1_4 Forward -137 -127 16.303 0.0117
NP_441715.1_4 Reverse -130 -140 14.238 0.0295
NP_443034.1_3 Forward -177 -158 18.0924 0.0683
NP_441198.1_8 Forward -140 -130 13.2713 0.108
NP_441468.1_1 Forward -137 -130 15.8704 0.0124
NP_441468.1_1 Reverse -130 -137 15.8704 0.0124
NP_441020.2_6 Forward -140 -123 16.5584 0.0272
NP_441020.2_6 Reverse -127 -144 15.6735 0.037
NP_441673.1_1 Forward -138 -129 20.8459 0.000698
NP_441673.1_1 Reverse -129 -138 20.8459 0.000698
NP_441876.1_9 Reverse -336 -346 12.3692 0.267
NP_441826.1_2 Reverse -123 -137 4.22782 0.104
NP_442868.1_6 Forward -140 -130 1.06167 0.205
NP_442868.1_6 Reverse -127 -137 0.963343 0.205
NP_442868.1_6 Reverse -200 -210 -0.118297 0.264
NP_442719.1_2 Reverse -331 -349 -2.34152 0.186
NP_442361.1_3 Reverse -123 -136 9.65572 0.276
NP_441911.1_10 Forward -124 -105 6.63086 0.299
NP_442808.1_1 Reverse -128 -138 18.4657 0.00201
NP_442808.1_1 Forward -139 -129 8.73102 0.0481
NP_442808.1_1 Reverse -339 -349 3.51951 0.238
NP_442808.1_1 Reverse -338 -348 3.22451 0.247
NP_442808.1_1 Forward -113 -103 1.35624 0.287
NP_442820.1_3 Reverse -330 -340 17.7774 0.187
NP_442820.1_3 Forward -312 -302 14.0409 0.277
NP_442542.1_9 Reverse -122 -136 9.83206 0.128
NP_442050.1_5 Forward -140 -130 18.0724 0.00365
NP_442050.1_5 Reverse -127 -137 9.12434 0.193
NP_442050.1_8 Reverse -123 -142 12.0425 0.276
NP_441114.1_3 Reverse -31 -40 6.39124 0.277
NP_441878.1_6 Forward -139 -129 10.5014 0.0176
NP_441878.1_6 Reverse -128 -138 10.4031 0.0176
NP_441036.1_8 Reverse -128 -138 17.7779 0.000554
NP_441036.1_8 Forward -139 -129 15.713 0.00724
NP_441557.1_5 Forward -138 -129 19.9609 0.000699
NP_441557.1_5 Reverse -129 -138 19.9609 0.000699
NP_441557.1_8 Reverse -341 -351 15.0242 0.183
NP_442066.2_9 Forward -142 -129 12.999 0.154
NP_442066.2_9 Reverse -125 -138 9.36073 0.175
NP_441308.1_8 Forward -140 -130 13.353 0.218
NP_441308.1_8 Reverse -127 -137 10.1081 0.22
NP_441458.1_10 Forward -147 -128 1.96607 0.277
NP_442183.1_1 Reverse -129 -143 22.3207 0.00245
NP_442183.1_1 Forward -138 -124 13.4709 0.0423
NP_442135.1_8 Reverse -118 -136 15.9488 0.207
NP_442347.1_2 Forward -137 -128 11.1111 0.056
NP_442347.1_2 Reverse -130 -139 3.34298 0.284
NP_441037.1_4 Forward -140 -130 7.31769 0.237
NP_441037.1_4 Reverse -127 -137 7.02532 0.237
NP_441633.1_3 Reverse -127 -140 -3.91395 0.177
NP_441633.1_3 Forward -140 -127 -5.88057 0.236
NP_442764.1_8 Forward -316 -297 4.12936 0.262
NP_440136.1_2 Forward -137 -130 15.9687 0.0123
NP_440136.1_2 Reverse -130 -137 15.9687 0.0123
NP_442998.1_5 Forward -373 -363 16.008 0.149
NP_442998.1_5 Forward -341 -331 15.3197 0.149
NP_442998.1_10 Forward -136 -129 15.5754 0.0102
NP_442998.1_10 Reverse -131 -138 15.5754 0.0102
NP_442998.1_10 Forward -209 -202 10.4622 0.0819
NP_440899.1_1 Forward -342 -323 7.91948 0.247
NP_440299.1_1 Forward -142 -129 3.85363 0.228
NP_440299.1_1 Reverse -125 -138 2.18201 0.294
NP_441799.1_1 Forward -142 -128 16.0269 0.0153
NP_441799.1_1 Reverse -125 -139 11.9953 0.0487
NP_441799.1_9 Forward -139 -120 -2.75381 0.221
NP_441007.1_10 Forward -143 -130 10.344 0.0683
NP_441007.1_10 Reverse -124 -137 3.26421 0.182
NP_440256.1_1 Forward -141 -122 7.47261 0.0257
NP_440256.1_1 Reverse -126 -145 4.62101 0.0429
NP_440915.1_6 Reverse -125 -139 5.80112 0.0879
NP_440915.1_6 Reverse -198 -212 -3.54032 0.298
NP_440717.1_1 Forward -137 -118 8.35759 0.265
NP_440215.1_10 Forward -343 -324 17.109 0.142
NP_441464.1_10 Reverse -100 -114 10.7177 0.242
NP_441464.1_10 Reverse -101 -115 9.83269 0.262
NP_440695.1_5 Forward -138 -119 -0.39387 0.284
NP_440695.1_5 Reverse -129 -148 -1.27885 0.284
NP_442993.1_1 Forward -138 -122 0.255197 0.0642
NP_442993.1_1 Reverse -356 -372 -11.1512 0.235
NP_442993.1_1 Reverse -129 -145 -11.2495 0.24
NP_442386.1_9 Reverse -128 -137 15.7322 0.0144
NP_442386.1_9 Forward -139 -130 6.39082 0.219
NP_441340.1_5 Forward -137 -130 15.6737 0.0124
NP_441340.1_5 Reverse -130 -137 15.6737 0.0124
NP_440161.1_3 Reverse -127 -146 15.9291 0.0977
NP_440586.1_8 Forward -137 -130 13.2151 0.026
NP_440586.1_8 Reverse -130 -137 13.2151 0.026
NP_440586.1_8 Forward -20 -13 5.64364 0.297
NP_442251.1_6 Forward -137 -130 15.2804 0.0124
NP_442251.1_6 Reverse -130 -137 15.2804 0.0124
NP_441262.1_3 Reverse -129 -136 14.7888 0.0223
NP_441262.1_3 Forward -138 -131 14.7888 0.0223
NP_443051.1_1 Forward -139 -130 19.5676 0.00335
NP_443051.1_1 Reverse -128 -137 10.4228 0.00754
NP_439937.1_9 Reverse -329 -346 -12.9415 0.278
NP_439937.1_9 Forward -32 -15 -15.0064 0.287
NP_439937.1_9 Forward -316 -299 -16.1864 0.287
NP_440439.1_1 Forward -141 -128 8.9674 0.0488
NP_440439.1_1 Reverse -126 -139 8.08242 0.0559
NP_439943.1_2 Reverse -344 -363 12.2908 0.251
NP_440372.1_2 Forward -137 -130 16.3621 0.0124
NP_440372.1_2 Reverse -130 -137 16.3621 0.0124
NP_440139.1_1 Reverse -123 -142 1.17865 0.269
NP_442384.1_10 Reverse -129 -142 13.884 0.018
NP_442384.1_10 Forward -138 -125 6.50913 0.0995
NP_441018.1_7 Reverse -98 -117 6.19431 0.297
NP_442790.1_4 Forward -147 -128 -8.85033 0.176
NP_442262.1_10 Forward -137 -130 14.1988 0.0123
NP_442262.1_10 Reverse -130 -137 14.1988 0.0123
NP_441689.1_5 Forward -140 -130 17.8758 0.0158
NP_441689.1_5 Reverse -127 -137 8.53436 0.132
NP_440163.1_10 Reverse -126 -136 15.2213 0.0762
NP_440344.1_10 Reverse -122 -139 2.10379 0.0288
NP_440344.1_10 Forward -145 -128 -9.49926 0.147
NP_440282.1_10 Reverse -119 -138 -5.99873 0.25
NP_440282.1_10 Forward -148 -129 -9.24366 0.275
NP_440531.1_6 Forward -146 -127 -5.50708 0.299
NP_442123.1_3 Forward -138 -119 13.2741 0.174
NP_441965.1_10 Forward -141 -125 9.39998 0.123
NP_441965.1_10 Reverse -126 -142 7.2367 0.151
NP_442065.1_5 Forward -322 -303 -3.44213 0.249
NP_440297.1_9 Forward -137 -127 9.32148 0.0917
NP_440297.1_9 Reverse -130 -140 9.22315 0.0917
NP_440297.1_9 Reverse -46 -56 3.81494 0.26
NP_442280.1_10 Reverse -192 -210 4.77262 0.294
NP_440894.1_10 Reverse -334 -353 2.55606 0.288
NP_440999.1_9 Reverse -125 -139 8.55439 0.074
NP_440888.1_2 Forward -138 -124 16.2235 0.00758
NP_440888.1_2 Reverse -129 -143 12.9786 0.0354
NP_440600.1_4 Forward -146 -128 3.06741 0.119
NP_440600.1_4 Forward -219 -201 -2.3408 0.195
NP_440575.1_8 Forward -64 -45 -7.57203 0.298
NP_441543.1_2 Forward -137 -128 18.486 0.00236
NP_441543.1_2 Reverse -130 -139 15.9293 0.00518
NP_441543.1_2 Forward -210 -201 12.2911 0.0401
NP_442845.1_2 Forward -144 -130 6.09611 0.217
NP_441178.1_6 Reverse -336 -355 8.25844 0.26
NP_440982.1_1 Reverse -340 -359 3.9319 0.294
NP_441469.1_8 Reverse -128 -137 16.126 0.00797
NP_441469.1_8 Forward -139 -130 6.5879 0.227
NP_442315.1_2 Reverse -98 -110 8.29878 0.297
NP_443064.1_6 Reverse -129 -139 10.8217 0.13
NP_442578.1_7 Forward -137 -130 14.5921 0.026
NP_442578.1_7 Reverse -130 -137 14.5921 0.026
NP_440710.1_1 Forward -146 -128 -1.55415 0.182
NP_441462.1_2 Reverse -129 -139 20.2362 0.000805
NP_441462.1_2 Forward -138 -128 11.5831 0.00406
NP_441621.1_7 Reverse -127 -141 -5.50694 0.254
NP_443062.1_1 Forward -138 -120 16.5415 0.0308
NP_443062.1_1 Reverse -129 -147 15.859 0.0346
NP_443062.1_1 Forward -360 -342 3.57305 0.293
NP_443062.1_6 Reverse -284 -303 5.50599 0.204
NP_443062.1_6 Reverse -121 -140 4.42435 0.218
NP_442204.1_1 Reverse -347 -358 2.41861 0.266
NP_442204.1_1 Forward -142 -131 -0.0396598 0.285
NP_442204.1_5 Reverse -119 -138 10.8159 0.0865
NP_440255.1_5 Reverse -32 -46 15.7678 0.246
NP_440516.1_6 Reverse -46 -60 11.602 0.202
NP_440516.1_8 Forward -138 -129 16.9127 0.00442
NP_440516.1_8 Reverse -129 -138 16.9127 0.00442
NP_440516.1_8 Reverse -202 -211 -0.590259 0.283
NP_442428.1_5 Forward -137 -130 15.8704 0.0124
NP_442428.1_5 Reverse -130 -137 15.8704 0.0124
NP_441032.1_2 Reverse -295 -314 13.3725 0.102
NP_440673.1_3 Forward -136 -129 12.4288 0.0426
NP_440673.1_3 Reverse -131 -138 12.4288 0.0426
NP_440673.1_3 Forward -79 -72 7.41394 0.263
NP_440673.1_7 Reverse -118 -137 -0.000545616 0.28
NP_441052.1_2 Forward -138 -128 10.5014 0.0285
NP_441052.1_2 Reverse -129 -139 10.4031 0.0285
NP_441052.1_2 Forward -211 -201 7.74818 0.0642
NP_442219.1_8 Reverse -35 -54 11.6459 0.175
NP_442219.1_8 Forward -49 -30 8.65027 0.241
NP_442219.1_9 Forward -137 -128 8.35786 0.0681
NP_442219.1_9 Reverse -130 -139 8.25953 0.0681
NP_440436.1_4 Forward -137 -128 18.1905 0.00233
NP_440436.1_4 Reverse -130 -139 9.24241 0.0871
NP_441884.1_9 Reverse -126 -145 -25.7633 0.29
NP_441719.1_2 Reverse -43 -57 12.9639 0.292
NP_441719.1_4 Forward -137 -130 16.3621 0.0124
NP_441719.1_4 Reverse -130 -137 16.3621 0.0124
NP_441733.1_10 Forward -141 -128 5.62415 0.21
NP_441231.1_3 Reverse -365 -384 13.2733 0.259
NP_442366.1_3 Forward -139 -121 -2.73412 0.232
NP_440129.1_10 Reverse -122 -136 3.63784 0.191
NP_442873.1_3 Reverse -119 -138 3.04693 0.299
NP_441115.1_4 Forward -139 -121 18.7995 0.012
NP_441115.1_4 Forward -22 -4 9.55647 0.21
NP_441115.1_4 Reverse -128 -146 7.78652 0.272
NP_442206.1_10 Reverse -129 -144 5.97809 0.178
NP_442854.1_6 Reverse -129 -148 0.491109 0.296
NP_440094.1_9 Forward -139 -120 0.687771 0.199
NP_443054.1_2 Forward -140 -126 12.4876 0.0722
NP_441851.1_10 Reverse -128 -138 16.008 0.00552
NP_441851.1_10 Forward -139 -129 8.53483 0.114
NP_442011.1_1 Reverse -128 -147 3.73603 0.239
NP_441668.1_4 Forward -148 -129 1.67108 0.212
NP_442515.1_1 Reverse -128 -142 4.52282 0.107
NP_442515.1_1 Forward -139 -125 -4.62196 0.298
NP_441982.1_6 Forward -375 -366 10.48 0.296
NP_440165.1_5 Reverse -128 -147 -7.17871 0.259
NP_442709.1_3 Forward -389 -370 3.73603 0.275
NP_441046.1_2 Reverse -7 -26 0.294447 0.271
NP_441349.1_10 Forward -148 -129 9.73422 0.0238
NP_440432.1_9 Reverse -130 -145 -3.36336 0.179
NP_442843.1_1 Reverse -13 -32 -0.787193 0.192
NP_439960.1_10 Reverse -195 -213 -4.79907 0.297
NP_440474.1_8 Forward -137 -123 14.6503 0.0612
NP_440474.1_8 Reverse -130 -144 4.42388 0.279
NP_442450.1_5 Forward -140 -130 9.41981 0.115
NP_442450.1_5 Reverse -127 -137 9.32148 0.115
NP_441031.1_8 Forward -336 -317 -3.73712 0.248
NP_440195.1_4 Reverse -117 -136 10.1275 0.172
NP_442006.1_2 Reverse -63 -80 -16.7758 0.264
NP_442006.1_2 Reverse -243 -260 -18.0541 0.287
NP_441570.1_1 Reverse -129 -147 3.06741 0.0225
NP_441570.1_1 Forward -138 -120 -8.14232 0.104
NP_441078.1_4 Forward -138 -129 19.6659 0.0007
NP_441078.1_4 Reverse -129 -138 19.6659 0.0007
NP_441078.1_4 Reverse -202 -211 5.80125 0.104
NP_441078.1_4 Forward -211 -202 5.70292 0.111
NP_442729.1_8 Forward -142 -129 11.1307 0.125
NP_442729.1_8 Reverse -125 -138 9.45906 0.125
NP_442729.1_8 Reverse -310 -323 6.31247 0.203
NP_441539.1_1 Reverse -35 -49 13.9619 0.284
NP_442348.1_2 Forward -55 -46 10.6195 0.259
NP_440526.1_3 Forward -137 -126 1.92649 0.267
NP_441432.1_8 Forward -139 -130 16.8143 0.00595
NP_441432.1_8 Reverse -128 -137 8.25953 0.0755
NP_441432.1_8 Reverse -201 -210 5.99792 0.124
NP_442320.1_8 Reverse -123 -137 4.62115 0.0472
NP_442320.1_8 Forward -144 -130 -4.7203 0.185
NP_442344.1_7 Forward -137 -118 17.5024 0.0188
NP_441732.1_2 Forward -142 -126 -16.7561 0.195
NP_440199.1_10 Reverse -126 -136 14.533 0.0861
NP_441057.1_4 Forward -359 -341 -1.84914 0.272
NP_441072.1_2 Forward -142 -123 13.6675 0.159
NP_442010.1_1 Reverse -362 -380 9.6548 0.241
NP_440713.1_4 Forward -136 -117 6.88262 0.184
NP_442489.1_2 Reverse -118 -137 9.0459 0.168
NP_442489.1_7 Forward -138 -129 20.1576 0.000695
NP_442489.1_7 Reverse -129 -138 20.1576 0.000695
NP_440386.1_3 Forward -65 -46 -4.6221 0.221
NP_442079.1_7 Reverse -130 -149 4.916 0.184
NP_442079.1_7 Forward -137 -118 1.27776 0.258
NP_440559.1_1 Forward -137 -128 8.75118 0.0586
NP_440559.1_1 Reverse -130 -139 8.65285 0.0586
NP_441659.2_8 Reverse -129 -139 20.9245 0.000805
NP_441659.2_8 Forward -138 -128 11.9764 0.0147
NP_442913.1_10 Reverse -120 -139 -2.16383 0.182
NP_442346.1_5 Forward -139 -129 16.303 0.00248
NP_442346.1_5 Reverse -128 -138 9.02648 0.118
NP_442346.1_10 Reverse -185 -204 2.85105 0.194
NP_440025.1_3 Forward -42 -28 10.3203 0.29
NP_442603.1_7 Reverse -129 -143 6.39049 0.245
NP_440449.1_6 Reverse -121 -139 9.71478 0.17
NP_441948.1_4 Forward -357 -339 3.85406 0.105
NP_441948.1_4 Reverse -122 -140 -4.11075 0.217
NP_441833.1_4 Forward -137 -130 15.9687 0.0124
NP_441833.1_4 Reverse -130 -137 15.9687 0.0124
NP_441895.1_10 Forward -52 -33 -19.2734 0.282
NP_442162.1_9 Forward -137 -130 16.2637 0.0124
NP_442162.1_9 Reverse -130 -137 16.2637 0.0124
NP_442199.1_5 Reverse -121 -140 -3.54046 0.208
NP_442140.1_3 Forward -137 -127 8.33817 0.119
NP_442723.1_1 Reverse -330 -349 22.123 0.0357
NP_440875.1_9 Forward -136 -126 8.37203 0.233
NP_441813.1_5 Reverse -127 -137 17.188 0.00979
NP_441813.1_5 Forward -140 -130 15.9097 0.01
NP_440590.1_4 Forward -137 -124 3.36254 0.0746
NP_440567.1_1 Forward -137 -123 13.8643 0.0196
NP_440567.1_1 Reverse -130 -144 2.35953 0.176
NP_442497.1_10 Reverse -130 -139 17.601 0.00813
NP_442497.1_10 Forward -137 -128 10.4228 0.0087
NP_440821.1_4 Reverse -127 -137 19.0562 0.00399
NP_440821.1_4 Forward -140 -130 11.0914 0.0146
NP_441239.1_9 Forward -140 -128 14.6903 0.0258
NP_441239.1_9 Reverse -127 -139 13.3137 0.037
NP_441239.1_9 Reverse -194 -206 4.46387 0.253
NP_441892.1_1 Forward -147 -130 -2.71443 0.227
NP_441892.1_1 Reverse -342 -359 -5.66436 0.285
NP_440604.1_6 Reverse -129 -148 0.58944 0.166
NP_440604.1_6 Forward -138 -119 -0.787193 0.189
NP_442270.1_9 Forward -230 -211 -9.14533 0.228
NP_442643.1_3 Reverse -168 -187 -4.22878 0.261
NP_441769.1_3 Reverse -48 -67 -3.73788 0.245
NP_440354.1_7 Forward -144 -126 7.00065 0.278
NP_440546.1_4 Reverse -129 -139 13.5365 0.0459
NP_440546.1_4 Forward -138 -128 11.8882 0.0679
NP_440546.1_4 Reverse -202 -212 8.6886 0.176
NP_440462.1_6 Forward -140 -130 16.893 0.00853
NP_440462.1_6 Reverse -127 -137 15.418 0.0142
NP_440868.1_4 Reverse -125 -137 10.7571 0.0364
NP_440868.1_4 Forward -142 -130 8.10212 0.0602
NP_440401.1_9 Forward -107 -100 14.5917 0.287
NP_442402.1_10 Reverse -365 -375 16.2041 0.118
NP_441084.1_6 Forward -140 -126 9.92586 0.257
NP_442460.1_3 Forward -394 -375 11.4058 0.272
NP_441843.2_9 Forward -136 -118 16.8141 0.0994
NP_442882.1_7 Reverse -122 -136 11.2087 0.261
NP_442923.1_6 Forward -281 -267 10.6112 0.292
NP_442039.1_4 Forward -137 -130 15.1821 0.0124
NP_442039.1_4 Reverse -130 -137 15.1821 0.0124
NP_441926.1_3 Reverse -202 -218 14.0215 0.0513
NP_441926.1_3 Reverse -356 -372 2.71347 0.257
NP_442837.1_3 Forward -137 -130 15.7721 0.0124
NP_442837.1_3 Reverse -130 -137 15.7721 0.0124
NP_440160.1_9 Reverse -291 -310 8.45592 0.264
NP_442053.1_1 Forward -138 -129 18.3876 0.0007
NP_442053.1_1 Reverse -129 -138 18.3876 0.0007
NP_440505.1_3 Forward -140 -130 15.123 0.014
NP_440505.1_3 Reverse -127 -137 13.8447 0.0247
NP_440505.1_3 Forward -57 -47 8.04317 0.147
NP_440505.1_3 Reverse -200 -210 7.55152 0.151
NP_440505.1_3 Forward -90 -80 6.56821 0.176
NP_441701.1_3 Forward -358 -341 6.43035 0.289
NP_441102.1_1 Forward -137 -118 7.7676 0.214
NP_441252.1_6 Forward -375 -368 11.6422 0.288
NP_441203.1_1 Reverse -130 -149 -17.5035 0.296
NP_442532.1_7 Reverse -129 -143 2.94952 0.214
NP_441408.2_7 Forward -120 -101 -5.50708 0.295
NP_440914.1_1 Reverse -129 -139 16.3248 0.00196
NP_440914.1_1 Forward -138 -128 8.6151 0.186
NP_440914.1_1 Forward -111 -101 7.44401 0.237
NP_441011.1_8 Forward -137 -128 16.9127 0.00602
NP_441011.1_8 Reverse -130 -139 16.6177 0.00602
NP_442533.1_1 Forward -358 -339 -17.7985 0.295
NP_442533.1_6 Forward -138 -129 17.2076 0.00137
NP_442533.1_6 Reverse -129 -138 17.2076 0.00137
NP_442541.1_10 Reverse -369 -383 1.86729 0.273
NP_442322.1_4 Reverse -338 -355 0.0381458 0.21
NP_442322.1_4 Reverse -337 -354 -0.453507 0.219
NP_442322.1_4 Forward -213 -196 -1.33848 0.226
NP_441482.1_7 Forward -144 -130 13.5693 0.0135
NP_441482.1_7 Forward -205 -191 -11.3085 0.254
NP_439944.1_9 Reverse -130 -140 17.6796 0.00347
NP_439944.1_9 Forward -137 -127 10.3048 0.0887
NP_441028.1_6 Reverse -366 -376 7.74772 0.218
NP_440116.1_8 Forward -137 -118 -1.67217 0.12
NP_440007.1_9 Reverse -92 -106 4.12949 0.267
NP_440007.1_9 Reverse -347 -361 2.65453 0.277
NP_440007.1_9 Reverse -125 -139 1.37622 0.285
NP_441106.1_1 Forward -139 -130 18.486 0.0028
NP_441106.1_1 Reverse -128 -137 18.191 0.0028
NP_439903.1_6 Reverse -126 -145 11.3067 0.095
NP_439903.1_6 Forward -141 -122 2.26028 0.231
NP_441286.1_1 Forward -139 -127 5.05386 0.0259
NP_441286.1_1 Reverse -128 -140 4.8572 0.0272
NP_440670.1_8 Forward -138 -129 18.3876 0.000699
NP_440670.1_8 Reverse -129 -138 18.3876 0.000699
NP_441930.1_2 Forward -55 -45 11.2881 0.298
NP_440886.1_7 Reverse -128 -138 17.7774 0.0011
NP_440886.1_7 Forward -139 -129 8.04271 0.0805
NP_442614.1_2 Forward -138 -124 7.07942 0.275
NP_439995.1_5 Reverse -119 -138 10.9142 0.197
NP_442717.1_2 Forward -399 -380 -5.11376 0.25
NP_442072.1_9 Forward -139 -121 -11.9772 0.0799
NP_441808.1_1 Forward -147 -128 3.93269 0.204
NP_440907.2_8 Reverse -130 -140 9.51767 0.103
NP_440907.2_8 Forward -137 -127 7.84605 0.117
NP_440841.1_4 Forward -57 -38 -9.53865 0.26
NP_442459.1_8 Reverse -124 -143 11.8975 0.161
NP_441463.1_3 Reverse -119 -138 10.4225 0.0481
NP_441463.1_3 Forward -148 -129 -1.47551 0.141
NP_441463.1_3 Reverse -35 -54 -7.57203 0.259
NP_441626.1_2 Forward -137 -130 15.7721 0.0124
NP_441626.1_2 Reverse -130 -137 15.7721 0.0124
NP_442365.1_7 Reverse -125 -144 -4.52377 0.245
NP_442365.1_7 Reverse -198 -217 -6.68705 0.299
NP_442615.1_1 Reverse -120 -138 5.72234 0.0374
NP_442615.1_1 Forward -147 -129 -0.0791831 0.111
NP_442615.1_1 Reverse -193 -211 -4.50408 0.188
NP_440387.1_1 Reverse -129 -145 13.8249 0.00803
NP_440387.1_1 Forward -138 -122 -3.28472 0.157
NP_440814.1_8 Forward -342 -323 -0.590531 0.285
NP_440114.1_10 Forward -138 -124 15.4376 0.0252
NP_440114.1_10 Reverse -129 -143 14.7492 0.0346
NP_440114.1_10 Reverse -356 -370 6.3911 0.273
NP_441510.2_7 Reverse -123 -137 11.897 0.28
NP_440287.1_6 Forward -140 -121 -0.197208 0.298
NP_440293.1_3 Forward -356 -337 19.2723 0.0335
NP_440293.1_3 Reverse -102 -121 -6.78538 0.293
NP_440293.1_9 Reverse -103 -117 10.8611 0.261
NP_442743.1_1 Reverse -336 -355 8.25844 0.264
NP_441311.1_2 Reverse -53 -67 12.192 0.236
NP_442930.1_1 Reverse -57 -67 9.02601 0.299
NP_439910.1_2 Reverse -121 -138 -11.9575 0.0788
NP_440457.1_1 Forward -142 -130 0.0389777 0.25
NP_440457.1_1 Reverse -125 -137 -0.0593532 0.25
NP_442940.1_5 Reverse -319 -338 16.9124 0.16
NP_440798.1_6 Reverse -123 -136 0.60927 0.254
NP_440798.1_9 Forward -172 -153 9.24257 0.297
NP_441332.1_6 Reverse -339 -349 14.0671 0.163
NP_441332.1_6 Forward -112 -102 10.7754 0.287
NP_442509.1_9 Forward -138 -128 16.2041 0.00739
NP_442509.1_9 Reverse -129 -139 8.04271 0.192
NP_442514.1_5 Reverse -338 -357 -8.45774 0.285
NP_440554.1_4 Reverse -130 -140 16.1063 0.0189
NP_440554.1_4 Forward -137 -127 14.6313 0.02
NP_441845.1_6 Reverse -117 -135 -1.75081 0.296
NP_441885.1_5 Forward -138 -128 11.4848 0.00668
NP_441885.1_5 Reverse -129 -139 11.3864 0.00668
NP_441885.1_5 Forward -211 -201 0.0783647 0.183
NP_441428.1_8 Reverse -121 -140 10.6192 0.178
NP_442341.1_7 Forward -139 -125 7.57108 0.102
NP_442341.1_7 Reverse -128 -142 6.09611 0.135
NP_442341.1_9 Forward -140 -126 8.3571 0.171
NP_442341.1_9 Reverse -127 -141 4.62054 0.296
NP_441173.1_9 Reverse -366 -374 13.1954 0.184
NP_441173.1_9 Reverse -367 -375 12.507 0.206
NP_443000.1_7 Forward -140 -130 17.4829 0.00719
NP_443000.1_7 Reverse -127 -137 8.73149 0.0437
NP_441842.1_10 Reverse -122 -136 17.3058 0.0246
NP_440275.1_3 Forward -140 -130 9.12481 0.055
NP_440275.1_3 Reverse -127 -137 8.4365 0.0602
NP_442932.1_9 Forward -352 -333 5.01433 0.271
NP_440091.1_1 Reverse -125 -137 10.7571 0.0429
NP_442275.1_3 Reverse -301 -320 11.2092 0.278
NP_441902.1_3 Forward -345 -335 12.8845 0.232
NP_443010.1_10 Reverse -126 -143 3.73713 0.252
NP_440258.1_2 Reverse -265 -284 18.6823 0.137
NP_440880.1_5 Reverse -98 -116 12.9005 0.236
NP_442495.1_4 Forward -356 -346 17.5813 0.0771
NP_440149.1_8 Forward -55 -36 -5.9004 0.235
NP_440149.1_8 Forward -138 -119 -6.1954 0.244
NP_441105.1_3 Forward -149 -130 -6.68705 0.239
NP_441105.1_3 Reverse -118 -137 -6.78538 0.241
NP_442373.1_2 Forward -356 -337 -9.34199 0.26
NP_440216.1_1 Forward -138 -124 8.25939 0.0061
NP_440216.1_1 Reverse -129 -143 -2.85201 0.0608
NP_440216.1_6 Reverse -122 -138 4.87675 0.189
NP_440172.1_1 Reverse -129 -139 17.5813 0.00421
NP_440172.1_1 Forward -138 -128 8.73149 0.0586
NP_442015.1_10 Reverse -125 -138 0.805932 0.218
NP_442329.1_8 Forward -78 -59 4.12936 0.293
NP_441226.1_7 Forward -137 -130 14.4934 0.0123
NP_441226.1_7 Reverse -130 -137 14.4934 0.0123
NP_441111.1_7 Forward -137 -129 18.7023 0.00294
NP_441111.1_7 Reverse -130 -138 18.7023 0.00294
NP_441766.1_2 Forward -138 -129 17.5026 0.00297
NP_441766.1_2 Reverse -129 -138 17.5026 0.00297
NP_442417.1_5 Reverse -129 -143 10.226 0.122
NP_440416.1_9 Reverse -122 -141 -14.1602 0.173
NP_443052.1_8 Reverse -119 -138 -0.0988766 0.0684
NP_442403.1_8 Forward -136 -117 -0.983855 0.256
NP_440261.1_5 Forward -137 -124 -1.06236 0.0655
NP_440261.1_5 Reverse -130 -143 -10.5021 0.201
NP_440988.1_10 Reverse -115 -129 3.64026 0.285
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAACCAGGATAAACTCTGGGGTGTCTTGGGGAAAATCCAATTGCATGGCCTGGGGTAGGGGGGCAAAACTGGCATCCTGGTAGCCCCGCATTGTGGCCCGGAGATTATCATTCTGTTCTTCAAAATGAACTAATTTAACGTCTAGTCCCCGCTTGGTGAATAGACCCTTAGATTCGGCATACAGAATCACGCTATAGCCAGGCCAGTCATTCATGCCTACTATGAGCGGCTGTAAAACTTGCTTGGGACGCAGGCTAATTAAGGCGATCGCCGTTAGGATGAGGATAAGCCCAAACCCCAACAGCTTTTTAAGGGAATACTTCATTGCGGTCTGGGAAATATTAAGGGAATTGGCAAATCTGATCAATGCACCTATTCCGGCCAACACATTCAGTAACCT

CDS

ATGGAAAAATCACCGTTGAGTCCCCCCGGCTATTGCCTTTATAAAGGGACTACCAGAGATCGGCGGTTACTGGTGGATTTTCTGGAGCGTACCTACCATTCCCTTTTCCCGGAACTGTGCGACTTTCCCCATTTAGAACAAACAGTGGAAAGCTATTTTTCTTGGCGATCGCCATTGTGGTGGGTTGTGCCGGAAACGACCCAAGGAAATTCTAATCATAACGACCATGATAGCCCTTTTTTTCCACGGGAAGATCCCCTGGGATTAATGGCCCAAATCAATCCGACAATTGGGCCAGCCGATGGTTTTAATCAAACAAATTCGGCAGAGAAAATCACTCGTCCCCAACCCATTGCCGGCCTTTGGTTAGGTAACGCCATTGATCAGGTCACAGGCGATCGCCATGGACATATTTTCATGCTCTATGTGGAGCCGGCCCACCGTCGTCGGGGCATTGCTACTTCCTTGATGGAACAGGCCCAACAATGGGGCCAACAAAGAGGTGATCGATTAATAGCATTGCAGGTTTTTAGCCATAACCAAGGGGCAATGAAATTATATGAAAAATTTGGTTTTACTCCCCATGCTTTGGTCATGCAAAAAAGCTTGATATAA

Protein

MEKSPLSPPGYCLYKGTTRDRRLLVDFLERTYHSLFPELCDFPHLEQTVESYFSWRSPLWWVVPETTQGNSNHNDHDSPFFPREDPLGLMAQINPTIGPADGFNQTNSAEKITRPQPIAGLWLGNAIDQVTGDRHGHIFMLYVEPAHRRRGIATSLMEQAQQWGQQRGDRLIALQVFSHNQGAMKLYEKFGFTPHALVMQKSLI