Your browser is old and dusty. Try Google Chrome!

Details for slr0514

ORF slr0514
Accession NP_442522.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -282 -296 1.17956 0.193
NP_441061.1_2 Forward -289 -275 -0.000409212 0.219
NP_440795.1_7 Forward -289 -282 14.6904 0.0123
NP_440795.1_7 Reverse -282 -289 14.6904 0.0123
NP_441418.1_6 Forward -290 -271 -11.0136 0.043
NP_441418.1_6 Reverse -281 -300 -30.6798 0.291
NP_440815.1_5 Reverse -45 -64 4.71934 0.286
NP_442291.1_5 Forward -291 -275 8.12167 0.0575
NP_440897.1_6 Forward -290 -271 -2.45958 0.214
NP_441453.1_4 Reverse -281 -289 16.539 0.00633
NP_441453.1_4 Forward -290 -282 16.539 0.00633
NP_442151.1_6 Reverse -281 -295 5.99778 0.253
NP_442838.1_7 Forward -295 -276 -10.0303 0.232
NP_441818.1_1 Forward -289 -278 9.20294 0.25
NP_441818.1_9 Forward -334 -315 -9.93197 0.291
NP_440226.1_1 Reverse -281 -300 13.0775 0.0391
NP_440226.1_1 Forward -290 -271 8.84924 0.0817
NP_442169.1_1 Forward -335 -316 -3.14714 0.29
NP_440259.1_4 Reverse -61 -75 9.79275 0.278
NP_440150.1_6 Forward -293 -274 9.24257 0.19
NP_442173.1_1 Forward -289 -281 15.4574 0.00633
NP_442173.1_1 Reverse -282 -290 15.4574 0.00633
NP_442752.1_4 Forward -290 -283 13.8055 0.0199
NP_442752.1_4 Reverse -281 -288 13.8055 0.0199
NP_443027.1_4 Reverse -279 -289 16.2046 0.0437
NP_443027.1_4 Forward -292 -282 13.943 0.0452
NP_440613.1_9 Reverse -159 -178 21.1406 0.1
NP_441812.1_3 Forward -291 -277 7.9644 0.254
NP_442975.1_10 Forward -294 -280 12.782 0.0459
NP_442975.1_10 Reverse -277 -291 3.73557 0.252
NP_441225.1_1 Reverse -283 -302 -3.44213 0.191
NP_440784.1_7 Forward -289 -282 15.9687 0.0123
NP_440784.1_7 Reverse -282 -289 15.9687 0.0123
NP_440784.1_7 Reverse -254 -261 5.84064 0.248
NP_440061.1_9 Reverse -279 -293 9.83206 0.137
NP_440061.1_9 Forward -180 -166 7.07881 0.219
NP_440110.1_4 Reverse -270 -289 3.73603 0.215
NP_440110.1_8 Forward -292 -273 -1.37718 0.238
NP_442062.1_8 Reverse -281 -291 19.4496 0.000558
NP_442062.1_8 Forward -290 -280 10.3048 0.0493
NP_441859.1_3 Forward -263 -244 3.83357 0.233
NP_441802.1_1 Forward -80 -61 7.37428 0.248
NP_440304.1_4 Reverse -279 -289 19.9412 0.00364
NP_440304.1_4 Forward -292 -282 9.91146 0.051
NP_442242.1_4 Forward -289 -282 14.3954 0.0124
NP_442242.1_4 Reverse -282 -289 14.3954 0.0124
NP_440044.1_8 Forward -289 -270 1.47442 0.172
NP_441208.1_9 Forward -293 -279 8.55439 0.219
NP_441208.1_9 Forward -57 -43 8.06273 0.219
NP_441208.1_9 Reverse -278 -292 7.66941 0.22
NP_441594.1_6 Forward -299 -280 1.37609 0.268
NP_440370.1_10 Forward -299 -280 12.9791 0.137
NP_440132.1_1 Forward -292 -274 13.8838 0.154
NP_442110.1_7 Forward -290 -276 1.67122 0.222
NP_442110.1_7 Reverse -281 -295 0.786239 0.248
NP_441082.1_10 Forward -333 -320 9.36073 0.25
NP_441083.1_5 Reverse -281 -291 11.3864 0.0159
NP_441083.1_5 Forward -290 -280 11.2881 0.0159
NP_441083.1_5 Forward -178 -168 -0.511621 0.269
NP_442827.1_8 Forward -298 -279 14.7483 0.0402
NP_441434.1_7 Reverse -283 -297 12.8809 0.106
NP_441738.1_2 Forward -288 -281 15.28 0.0102
NP_441738.1_2 Reverse -283 -290 15.28 0.0102
NP_441558.1_5 Reverse -279 -298 14.0608 0.0523
NP_441558.1_5 Reverse -335 -354 5.11266 0.26
NP_440209.1_1 Reverse -281 -289 18.1123 0.00295
NP_440209.1_1 Forward -290 -282 18.1123 0.00295
NP_441444.1_1 Forward -388 -369 6.09597 0.26
NP_441713.1_1 Forward -296 -277 14.5524 0.0256
NP_441770.1_4 Reverse -170 -189 -12.4886 0.291
NP_440178.1_7 Reverse -280 -299 -11.4069 0.0927
NP_442570.1_3 Reverse -161 -180 -3.24547 0.217
NP_441716.1_1 Forward -290 -276 13.2743 0.0689
NP_442111.1_4 Reverse -280 -294 9.34103 0.0609
NP_442111.1_4 Forward -291 -277 7.17775 0.103
NP_440906.1_5 Forward -289 -282 15.8704 0.0124
NP_440906.1_5 Reverse -282 -289 15.8704 0.0124
NP_440747.1_10 Forward -293 -281 7.70879 0.00236
NP_440747.1_10 Reverse -278 -290 -1.92764 0.0192
NP_441130.1_10 Forward -292 -278 9.93102 0.118
NP_441486.1_1 Reverse -278 -292 3.8345 0.0534
NP_441486.1_1 Forward -293 -279 -5.40861 0.237
NP_442634.1_2 Reverse -181 -200 6.78429 0.205
NP_442634.1_2 Reverse -275 -294 0.58944 0.287
NP_442634.1_4 Reverse -279 -293 6.29277 0.0508
NP_442634.1_4 Forward -292 -278 5.80112 0.051
NP_442634.1_4 Reverse -149 -163 -5.70361 0.271
NP_440403.1_4 Forward -299 -280 -9.44032 0.275
NP_441014.1_8 Reverse -318 -337 -9.34199 0.295
NP_442848.1_1 Reverse -275 -289 5.99778 0.0803
NP_442848.1_1 Forward -296 -282 -2.75368 0.263
NP_442848.1_9 Reverse -170 -189 8.55425 0.182
NP_443018.1_3 Forward -289 -282 14.8871 0.0123
NP_443018.1_3 Reverse -282 -289 14.8871 0.0123
NP_443018.1_3 Forward -177 -170 9.38056 0.128
NP_443018.1_3 Forward -199 -192 5.34899 0.212
NP_441316.1_7 Reverse -279 -294 5.19144 0.121
NP_441634.1_8 Reverse -279 -293 4.03116 0.138
NP_441634.1_8 Reverse -340 -354 -0.590395 0.262
NP_441634.1_8 Reverse -167 -181 -4.52363 0.295
NP_440376.1_1 Forward -290 -281 19.4693 0.000692
NP_440376.1_1 Reverse -281 -290 19.4693 0.000692
NP_440376.1_1 Reverse -169 -178 2.65466 0.216
NP_440376.1_1 Forward -55 -46 0.884706 0.259
NP_442687.1_7 Forward -291 -281 15.8113 0.0125
NP_442687.1_7 Reverse -280 -290 9.02648 0.0994
NP_442687.1_7 Reverse -55 -65 4.69992 0.238
NP_441422.1_7 Reverse -279 -296 6.33202 0.0992
NP_440533.1_9 Reverse -281 -300 6.68596 0.189
NP_442658.1_1 Forward -292 -282 18.7607 0.00222
NP_442658.1_1 Reverse -279 -289 13.0576 0.04
NP_442658.1_1 Forward -372 -362 5.28945 0.274
NP_442782.1_2 Reverse -281 -295 2.45787 0.275
NP_442205.1_9 Forward -296 -280 7.2367 0.107
NP_442205.1_9 Reverse -275 -291 -1.80975 0.264
NP_440656.1_8 Reverse -270 -289 0.982764 0.124
NP_442544.1_6 Forward -260 -241 -5.50708 0.298
NP_441256.1_1 Forward -293 -274 -4.81876 0.233
NP_442937.1_5 Forward -295 -276 10.6192 0.157
NP_441165.1_10 Reverse -253 -271 11.2289 0.239
NP_441958.1_2 Forward -299 -280 13.4708 0.203
NP_441958.1_5 Reverse -280 -290 21.2195 0.000805
NP_441958.1_5 Forward -291 -281 12.2714 0.00183
NP_440203.1_5 Reverse -334 -344 12.5659 0.146
NP_440203.1_5 Forward -287 -277 10.4026 0.225
NP_440984.1_7 Forward -295 -281 7.17775 0.182
NP_441162.1_3 Forward -338 -319 8.84924 0.254
NP_442911.1_2 Reverse -271 -290 -3.63879 0.115
NP_440153.1_5 Forward -289 -275 9.5377 0.123
NP_440153.1_5 Reverse -282 -296 2.75286 0.219
NP_441591.1_10 Forward -190 -171 18.7807 0.0439
NP_440993.1_2 Reverse -276 -292 17.6598 0.0447
NP_441099.1_9 Forward -167 -148 14.8474 0.248
NP_442002.1_9 Forward -291 -284 10.7572 0.185
NP_440809.1_9 Reverse -272 -290 -7.35568 0.225
NP_441646.1_1 Forward -297 -278 10.3242 0.117
NP_442438.1_10 Forward -295 -281 14.7492 0.0307
NP_442438.1_10 Reverse -276 -290 3.8345 0.156
NP_442885.1_4 Forward -244 -231 15.7313 0.264
NP_441000.1_6 Forward -291 -277 3.04785 0.12
NP_441000.1_6 Reverse -252 -266 2.45787 0.139
NP_441000.1_6 Reverse -280 -294 -3.73699 0.225
NP_440605.1_4 Forward -300 -281 13.4738 0.25
NP_442771.1_1 Reverse -279 -297 3.16574 0.0672
NP_440147.1_4 Reverse -279 -292 11.819 0.0326
NP_440147.1_4 Reverse -167 -180 3.95252 0.175
NP_440147.1_4 Forward -292 -279 2.77255 0.202
NP_441175.1_7 Reverse -56 -75 7.7676 0.22
NP_441550.1_8 Reverse -279 -289 13.0576 0.0273
NP_441550.1_8 Forward -292 -282 10.501 0.066
NP_441550.1_8 Reverse -251 -261 5.38779 0.252
NP_441916.1_1 Reverse -114 -133 10.1275 0.233
NP_441916.1_7 Forward -290 -280 18.9579 0.00144
NP_441916.1_7 Reverse -281 -291 18.4663 0.00144
NP_440465.1_10 Reverse -278 -297 -1.18052 0.29
NP_441041.1_4 Reverse -151 -170 -0.983855 0.0994
NP_441041.1_4 Forward -346 -327 -13.3736 0.285
NP_441041.1_7 Forward -293 -281 16.2608 0.0165
NP_441547.1_2 Reverse -270 -288 5.13236 0.228
NP_442004.1_6 Forward -290 -276 9.04604 0.14
NP_441725.1_5 Forward -289 -279 11.1898 0.0247
NP_441725.1_5 Reverse -282 -292 9.02648 0.0553
NP_439966.1_7 Forward -292 -282 17.4824 0.00636
NP_439966.1_7 Reverse -279 -289 14.8275 0.0177
NP_439966.1_7 Reverse -317 -327 4.40448 0.273
NP_439966.1_7 Forward -306 -296 4.10949 0.289
NP_439966.1_9 Forward -292 -283 10.7178 0.0863
NP_442941.1_3 Forward -289 -279 19.9412 0.00262
NP_442941.1_3 Reverse -282 -292 2.53664 0.14
NP_442941.1_3 Reverse -152 -162 -1.29827 0.297
NP_442941.1_5 Reverse -61 -75 14.2385 0.298
NP_440289.1_2 Forward -293 -280 3.36254 0.0799
NP_440289.1_2 Reverse -278 -291 -2.73398 0.262
NP_442281.1_1 Forward -295 -281 16.9119 0.00698
NP_441334.1_7 Reverse -279 -298 -10.817 0.12
NP_441334.1_7 Forward -292 -273 -11.3086 0.122
NP_442256.1_2 Forward -292 -274 -7.06068 0.214
NP_440437.1_1 Reverse -275 -294 -1.96717 0.207
NP_442012.1_1 Reverse -275 -294 6.29264 0.133
NP_441556.1_10 Reverse -2 -16 11.2925 0.231
NP_440498.1_1 Reverse -272 -290 -2.53746 0.242
NP_440498.1_1 Forward -299 -281 -2.83245 0.248
NP_440498.1_1 Reverse -187 -205 -3.91409 0.281
NP_442982.1_5 Reverse -271 -290 11.4058 0.114
NP_441644.1_6 Forward -290 -280 19.0557 0.000803
NP_441644.1_6 Forward -178 -168 13.6475 0.0181
NP_441644.1_6 Reverse -281 -291 10.1076 0.0628
NP_442215.1_2 Reverse -329 -345 -1.71142 0.187
NP_442215.1_2 Forward -187 -171 -5.74299 0.256
NP_442215.1_2 Forward -292 -276 -7.31629 0.291
NP_440253.1_2 Reverse -281 -299 -0.669169 0.218
NP_440929.1_8 Forward -290 -281 19.2726 0.000701
NP_440929.1_8 Reverse -281 -290 19.2726 0.000701
NP_442933.1_1 Forward -44 -25 7.01823 0.257
NP_442933.1_10 Forward -290 -281 17.601 0.00325
NP_442933.1_10 Reverse -281 -290 17.601 0.00325
NP_441751.2_8 Forward -289 -275 7.86607 0.0336
NP_441751.2_8 Reverse -282 -296 -3.147 0.134
NP_442554.1_8 Forward -289 -279 16.9913 0.0065
NP_442554.1_8 Reverse -282 -292 16.008 0.0065
NP_442554.1_8 Reverse -170 -180 9.61647 0.0576
NP_442554.1_8 Forward -177 -167 3.32329 0.23
NP_442554.1_8 Reverse -338 -348 2.33998 0.274
NP_441762.1_7 Reverse -280 -292 12.527 0.0142
NP_441762.1_7 Forward -291 -279 2.20226 0.0676
NP_441762.1_7 Forward -359 -347 -7.53251 0.293
NP_442142.1_4 Forward -293 -280 15.7516 0.0264
NP_442142.1_4 Reverse -278 -291 8.2785 0.118
NP_442292.1_1 Forward -289 -280 17.5026 0.00435
NP_442292.1_1 Reverse -282 -291 9.63616 0.0183
NP_442476.1_6 Reverse -282 -296 10.3243 0.0704
NP_442381.1_8 Reverse -278 -297 -14.9469 0.29
NP_443009.1_5 Reverse -280 -291 19.626 0.00102
NP_443009.1_5 Forward -66 -55 12.6445 0.0456
NP_443009.1_5 Forward -291 -280 7.82632 0.118
NP_442250.1_6 Forward -341 -322 9.14423 0.274
NP_442408.2_1 Forward -290 -271 7.47261 0.143
NP_441715.1_4 Forward -289 -279 14.238 0.0295
NP_441715.1_4 Reverse -282 -292 9.32148 0.097
NP_441198.1_8 Reverse -279 -289 13.2713 0.108
NP_441468.1_1 Forward -289 -282 15.8704 0.0124
NP_441468.1_1 Reverse -282 -289 15.8704 0.0124
NP_442099.1_1 Forward -340 -322 18.0137 0.262
NP_441020.2_6 Reverse -279 -296 16.5584 0.0272
NP_441020.2_6 Forward -292 -275 12.3302 0.0975
NP_441015.1_10 Forward -295 -276 -8.94866 0.278
NP_441673.1_1 Forward -290 -281 20.8459 0.000698
NP_441673.1_1 Reverse -281 -290 20.8459 0.000698
NP_442253.1_5 Forward -181 -164 -1.92778 0.276
NP_441826.1_2 Forward -296 -282 2.5562 0.125
NP_441826.1_2 Reverse -275 -289 0.589577 0.18
NP_441826.1_2 Forward -178 -164 -4.03198 0.291
NP_441330.1_1 Forward -271 -252 -15.1435 0.265
NP_442868.1_6 Forward -292 -282 8.53483 0.0555
NP_442868.1_6 Reverse -279 -289 1.06167 0.205
NP_442427.1_3 Forward -295 -277 15.2604 0.0961
NP_442808.1_1 Forward -291 -281 18.4657 0.00201
NP_442808.1_1 Reverse -280 -290 8.73102 0.0481
NP_442808.1_1 Forward -179 -169 7.25606 0.0831
NP_442808.1_1 Forward -352 -342 2.33954 0.27
NP_440145.1_3 Forward -300 -281 18.4857 0.00887
NP_442820.1_3 Reverse -223 -233 15.8108 0.248
NP_442542.1_2 Forward -292 -279 12.3107 0.114
NP_442050.1_5 Reverse -279 -289 18.0724 0.00365
NP_442050.1_5 Forward -292 -282 8.23937 0.234
NP_440558.1_2 Forward -350 -331 -0.39387 0.203
NP_440162.1_1 Forward -39 -20 20.4727 0.154
NP_442789.1_4 Forward -292 -273 -7.96535 0.299
NP_441518.1_3 Forward -300 -281 -6.98204 0.148
NP_441518.1_3 Reverse -271 -290 -10.9153 0.252
NP_441878.1_6 Reverse -280 -290 10.5014 0.0176
NP_441878.1_6 Forward -291 -281 10.4031 0.0176
NP_441878.1_6 Reverse -168 -178 0.668351 0.139
NP_441878.1_6 Forward -179 -169 0.57002 0.14
NP_441878.1_6 Forward -66 -56 -6.90313 0.198
NP_441036.1_8 Forward -291 -281 17.7779 0.000554
NP_441036.1_8 Reverse -280 -290 15.713 0.00724
NP_441557.1_5 Forward -290 -281 19.9609 0.000699
NP_441557.1_5 Reverse -281 -290 19.9609 0.000699
NP_441557.1_8 Reverse -320 -330 13.2542 0.224
NP_441445.1_1 Reverse -160 -179 3.93269 0.204
NP_442066.2_9 Reverse -147 -160 9.75405 0.163
NP_442419.1_2 Forward -295 -276 -1.67217 0.246
NP_441739.1_2 Forward -314 -298 8.12098 0.193
NP_441308.1_8 Reverse -279 -289 13.353 0.218
NP_441308.1_8 Forward -292 -282 9.22315 0.226
NP_441308.1_8 Forward -162 -152 8.04317 0.288
NP_440101.1_10 Forward -296 -277 12.9791 0.135
NP_442183.1_1 Reverse -281 -295 14.5526 0.0311
NP_442183.1_1 Forward -290 -276 10.7177 0.0807
NP_442183.1_1 Forward -160 -146 7.86607 0.131
NP_441549.1_9 Reverse -277 -295 -6.56903 0.201
NP_441549.1_9 Forward -294 -276 -7.15901 0.206
NP_442347.1_2 Reverse -282 -291 11.1111 0.056
NP_442347.1_2 Forward -289 -280 3.34298 0.284
NP_442645.1_2 Forward -274 -255 -17.7001 0.261
NP_441037.1_4 Forward -292 -282 16.2838 0.0168
NP_441037.1_4 Reverse -279 -289 7.31769 0.237
NP_440690.1_9 Reverse -106 -125 12.7825 0.231
NP_441633.1_3 Reverse -279 -292 3.95252 0.0699
NP_441633.1_3 Forward -190 -177 3.06754 0.0764
NP_441633.1_3 Forward -292 -279 -3.91395 0.177
NP_441633.1_3 Reverse -54 -67 -5.38892 0.236
NP_441633.1_3 Forward -264 -251 -6.47056 0.253
NP_440136.1_2 Forward -289 -282 15.9687 0.0123
NP_440136.1_2 Reverse -282 -289 15.9687 0.0123
NP_442998.1_10 Forward -288 -281 15.5754 0.0102
NP_442998.1_10 Reverse -283 -290 15.5754 0.0102
NP_440899.1_8 Reverse -60 -79 -6.58872 0.231
NP_440299.1_1 Forward -294 -281 10.0485 0.0615
NP_440299.1_1 Reverse -277 -290 7.09854 0.121
NP_441799.1_1 Reverse -277 -291 18.7801 0.008
NP_441799.1_1 Forward -294 -280 11.897 0.0503
NP_440640.1_6 Forward -340 -321 14.2574 0.119
NP_441007.1_10 Forward -295 -282 4.24752 0.182
NP_441007.1_10 Reverse -276 -289 1.19926 0.207
NP_441007.1_10 Reverse -146 -159 -0.177378 0.268
NP_440256.1_1 Forward -293 -274 8.35759 0.0236
NP_440256.1_1 Reverse -278 -297 -9.24366 0.275
NP_441512.1_4 Reverse -277 -296 12.7825 0.212
NP_441559.1_8 Reverse -337 -351 2.2612 0.147
NP_441559.1_8 Reverse -276 -290 -0.983719 0.18
NP_441559.1_8 Reverse -201 -215 -5.50694 0.264
NP_441559.1_8 Forward -210 -196 -5.60527 0.267
NP_441559.1_8 Forward -220 -206 -6.09693 0.274
NP_441559.1_8 Forward -60 -46 -6.19526 0.275
NP_441559.1_8 Reverse -51 -65 -6.58858 0.279
NP_441559.1_8 Forward -295 -281 -6.88358 0.281
NP_441559.1_8 Forward -183 -169 -7.37523 0.291
NP_440915.1_6 Forward -294 -280 14.7492 0.0183
NP_440915.1_6 Forward -332 -318 8.55439 0.0533
NP_440915.1_6 Forward -355 -341 -2.06536 0.258
NP_440717.1_3 Reverse -314 -328 13.1753 0.227
NP_442785.1_7 Reverse -44 -58 9.34103 0.265
NP_442866.1_1 Forward -295 -276 -7.08038 0.264
NP_440748.1_5 Forward -344 -325 0.392778 0.252
NP_440702.1_2 Forward -336 -317 -6.78538 0.261
NP_441939.1_3 Reverse -282 -301 11.3075 0.114
NP_441199.1_6 Forward -294 -275 1.96607 0.205
NP_442993.1_1 Reverse -281 -297 0.255197 0.0642
NP_442993.1_1 Reverse -169 -185 -11.3479 0.244
NP_440677.1_6 Reverse -272 -291 10.3242 0.27
NP_442386.1_9 Forward -291 -282 15.7322 0.0144
NP_442386.1_9 Forward -352 -343 9.34074 0.166
NP_442386.1_9 Forward -179 -170 8.35743 0.201
NP_442386.1_9 Reverse -280 -289 6.39082 0.219
NP_442386.1_10 Forward -329 -316 3.5592 0.273
NP_441340.1_5 Forward -289 -282 15.6737 0.0124
NP_441340.1_5 Reverse -282 -289 15.6737 0.0124
NP_441947.1_4 Forward -342 -323 10.3242 0.3
NP_442240.1_2 Reverse -282 -301 -4.81876 0.0848
NP_440161.1_3 Forward -292 -273 9.53756 0.242
NP_440586.1_8 Forward -289 -282 13.2151 0.026
NP_440586.1_8 Reverse -282 -289 13.2151 0.026
NP_442251.1_6 Forward -289 -282 15.2804 0.0124
NP_442251.1_6 Reverse -282 -289 15.2804 0.0124
NP_442959.1_7 Forward -306 -287 6.98095 0.138
NP_441262.1_3 Reverse -281 -288 14.7888 0.0223
NP_441262.1_3 Forward -290 -283 14.7888 0.0223
NP_440027.1_3 Reverse -169 -187 7.58986 0.208
NP_440027.1_3 Forward -300 -282 4.54162 0.257
NP_443051.1_1 Reverse -280 -289 19.5676 0.00335
NP_443051.1_1 Forward -291 -282 10.4228 0.00754
NP_441232.1_10 Reverse -270 -289 1.27776 0.284
NP_439984.1_10 Reverse -312 -326 12.2903 0.232
NP_439937.1_9 Forward -179 -162 -9.00826 0.179
NP_439937.1_9 Forward -291 -274 -16.2847 0.287
NP_441595.1_5 Reverse -170 -188 3.75572 0.295
NP_440439.1_1 Reverse -278 -291 18.5055 0.0105
NP_440439.1_1 Forward -293 -280 16.5389 0.0126
NP_440372.1_2 Forward -289 -282 16.3621 0.0124
NP_440372.1_2 Reverse -282 -289 16.3621 0.0124
NP_441803.1_2 Reverse -170 -189 1.76941 0.226
NP_439977.1_5 Forward -296 -277 4.22769 0.154
NP_442368.1_3 Reverse -108 -126 3.95239 0.3
NP_440139.1_1 Reverse -275 -294 2.26028 0.235
NP_441572.1_7 Forward -296 -277 -1.37718 0.188
NP_440267.1_2 Reverse -276 -290 9.14375 0.162
NP_441903.1_7 Reverse -171 -190 12.4875 0.231
NP_442384.1_10 Forward -290 -277 16.0472 0.00946
NP_442384.1_10 Forward -259 -246 2.2809 0.23
NP_442384.1_10 Reverse -281 -294 0.707601 0.282
NP_442114.1_4 Reverse -281 -292 12.1534 0.107
NP_440530.1_6 Reverse -66 -80 15.0024 0.255
NP_442790.1_4 Forward -367 -348 -5.99873 0.144
NP_442262.1_10 Forward -289 -282 14.1988 0.0123
NP_442262.1_10 Reverse -282 -289 14.1988 0.0123
NP_442262.1_10 Forward -177 -170 9.47889 0.187
NP_442262.1_10 Forward -199 -192 7.6106 0.274
NP_441689.1_5 Reverse -279 -289 17.8758 0.0158
NP_442244.1_6 Forward -293 -274 -0.4922 0.291
NP_440344.1_10 Reverse -274 -291 -3.69774 0.0862
NP_440531.1_6 Reverse -273 -292 -4.03212 0.273
NP_440487.1_1 Forward -293 -274 -5.21209 0.214
NP_440562.1_10 Reverse -272 -290 7.09898 0.284
NP_441640.1_8 Reverse -326 -345 -1.67217 0.22
NP_441640.1_8 Forward -177 -158 -2.75381 0.238
NP_440297.1_9 Forward -289 -279 9.22315 0.0917
NP_440297.1_9 Reverse -282 -292 -0.216628 0.282
NP_442280.1_10 Reverse -159 -177 5.84403 0.281
NP_441896.1_3 Forward -299 -280 4.52268 0.142
NP_440894.1_7 Forward -63 -44 10.1267 0.241
NP_442067.1_4 Forward -301 -282 15.8307 0.0681
NP_440999.1_9 Forward -294 -280 10.6193 0.0502
NP_440888.1_2 Forward -290 -276 15.1419 0.0122
NP_440888.1_2 Reverse -281 -295 14.2569 0.0193
NP_440888.1_2 Reverse -319 -333 10.3237 0.0974
NP_440888.1_2 Forward -160 -146 5.70218 0.267
NP_442892.1_6 Reverse -259 -278 1.76941 0.294
NP_442892.1_9 Reverse -63 -77 14.1586 0.293
NP_442948.1_2 Forward -291 -272 5.70265 0.253
NP_442277.1_4 Reverse -272 -291 6.58682 0.157
NP_442277.1_4 Reverse -346 -365 1.37531 0.281
NP_442033.1_10 Reverse -279 -298 -14.4552 0.298
NP_441759.1_2 Reverse -273 -292 5.40766 0.166
NP_441543.1_2 Reverse -282 -291 18.486 0.00236
NP_441543.1_2 Forward -289 -280 15.9293 0.00518
NP_442845.1_2 Reverse -163 -177 9.63603 0.171
NP_442845.1_2 Forward -334 -320 9.34103 0.177
NP_442845.1_2 Reverse -275 -289 5.50613 0.231
NP_441551.1_5 Forward -294 -278 18.6423 0.0365
NP_441551.1_5 Reverse -343 -359 7.92432 0.241
NP_440982.1_1 Reverse -319 -338 3.14526 0.297
NP_442710.1_7 Forward -76 -57 -7.41496 0.295
NP_441469.1_8 Forward -291 -282 16.126 0.00797
NP_441469.1_8 Reverse -280 -289 6.5879 0.227
NP_443064.1_6 Forward -290 -280 10.8217 0.13
NP_442337.1_8 Reverse -158 -177 6.98095 0.199
NP_442578.1_5 Reverse -316 -335 0.392778 0.272
NP_442578.1_7 Forward -289 -282 14.5921 0.026
NP_442578.1_7 Reverse -282 -289 14.5921 0.026
NP_440710.1_1 Reverse -273 -291 -0.275845 0.163
NP_441462.1_2 Forward -290 -280 20.2362 0.000805
NP_441462.1_2 Reverse -281 -291 11.5831 0.00406
NP_441462.1_2 Forward -160 -150 -0.806614 0.254
NP_441621.1_7 Reverse -279 -293 6.58777 0.068
NP_441621.1_7 Forward -292 -278 4.12949 0.0934
NP_443062.1_6 Reverse -273 -292 10.4225 0.113
NP_443062.1_6 Forward -105 -86 7.86593 0.159
NP_443062.1_6 Forward -73 -54 1.57275 0.272
NP_441410.1_4 Reverse -160 -179 13.9616 0.193
NP_442204.1_1 Reverse -277 -288 7.72849 0.116
NP_441560.1_5 Forward -353 -334 12.2908 0.284
NP_441351.1_8 Reverse -177 -196 5.211 0.204
NP_441351.1_8 Forward -322 -303 1.0811 0.276
NP_440516.1_8 Forward -290 -281 16.9127 0.00442
NP_440516.1_8 Reverse -281 -290 16.9127 0.00442
NP_440516.1_8 Forward -358 -349 -0.196935 0.185
NP_442428.1_5 Forward -289 -282 15.8704 0.0124
NP_442428.1_5 Reverse -282 -289 15.8704 0.0124
NP_440673.1_3 Forward -288 -281 12.4288 0.0426
NP_440673.1_3 Reverse -283 -290 12.4288 0.0426
NP_441052.1_2 Reverse -281 -291 10.5014 0.0285
NP_441052.1_2 Forward -290 -280 10.4031 0.0285
NP_441052.1_2 Forward -178 -168 3.91327 0.17
NP_442219.1_9 Reverse -282 -291 8.35786 0.0681
NP_442219.1_9 Forward -289 -280 8.25953 0.0681
NP_440436.1_4 Reverse -282 -291 18.1905 0.00233
NP_440436.1_4 Forward -289 -280 9.24241 0.0871
NP_441884.1_8 Reverse -280 -299 -7.08038 0.241
NP_441884.1_9 Forward -293 -274 -4.22878 0.0594
NP_441719.1_4 Forward -289 -282 16.3621 0.0124
NP_441719.1_4 Reverse -282 -289 16.3621 0.0124
NP_441733.1_10 Forward -293 -280 8.08242 0.143
NP_442366.1_3 Forward -291 -273 -2.53746 0.229
NP_439949.1_7 Reverse -301 -315 20.8458 0.0244
NP_440296.1_10 Forward -293 -274 4.52268 0.177
NP_442312.1_1 Reverse -293 -312 16.3224 0.176
NP_440094.1_9 Forward -341 -322 3.34271 0.173
NP_443054.1_2 Reverse -279 -293 12.291 0.0722
NP_442430.1_10 Forward -300 -281 11.6017 0.245
NP_441851.1_9 Forward -338 -319 7.66927 0.279
NP_441851.1_10 Forward -291 -281 16.008 0.00552
NP_441851.1_10 Forward -352 -342 10.1081 0.103
NP_441851.1_10 Reverse -280 -290 8.53483 0.114
NP_442622.1_5 Forward -292 -273 -4.72043 0.206
NP_441542.1_4 Reverse -72 -86 3.34284 0.285
NP_442856.1_7 Forward -187 -168 -4.13045 0.257
NP_441668.1_4 Forward -75 -56 -0.0988766 0.248
NP_442515.1_1 Reverse -280 -294 -3.24533 0.289
NP_441396.1_5 Reverse -296 -305 7.37455 0.279
NP_441982.1_6 Forward -399 -390 13.0583 0.274
NP_441982.1_6 Forward -318 -309 12.7718 0.274
NP_441349.1_10 Reverse -271 -290 0.982764 0.0852
NP_441349.1_10 Forward -300 -281 -2.45882 0.119
NP_441409.1_6 Reverse -275 -294 -8.06369 0.162
NP_440432.1_9 Forward -289 -274 -0.610089 0.166
NP_439960.1_4 Forward -291 -272 18.0915 0.125
NP_440474.1_8 Forward -289 -275 11.012 0.119
NP_442450.1_5 Reverse -279 -289 9.41981 0.115
NP_442168.1_5 Reverse -282 -301 -3.24547 0.281
NP_440588.1_2 Reverse -272 -291 9.53756 0.0442
NP_442335.1_7 Reverse -350 -364 13.8636 0.228
NP_440483.1_1 Forward -333 -314 -8.752 0.295
NP_441570.1_1 Forward -290 -272 11.5239 0.00743
NP_441570.1_1 Reverse -281 -299 -8.24065 0.107
NP_441078.1_4 Forward -290 -281 19.6659 0.0007
NP_441078.1_4 Reverse -281 -290 19.6659 0.0007
NP_441078.1_4 Reverse -169 -178 -1.6719 0.266
NP_441078.1_4 Forward -178 -169 -1.77023 0.266
NP_442729.1_8 Reverse -147 -160 4.64084 0.289
NP_442348.1_2 Reverse -304 -313 16.0277 0.113
NP_440707.1_6 Forward -63 -44 10.0284 0.297
NP_440707.1_9 Forward -400 -381 3.44104 0.268
NP_442443.1_1 Reverse -199 -218 -4.22878 0.268
NP_442443.1_1 Forward -366 -347 -6.49039 0.294
NP_440526.1_3 Reverse -282 -293 9.49793 0.0826
NP_440526.1_3 Reverse -320 -331 0.54986 0.275
NP_441432.1_8 Reverse -280 -289 16.8143 0.00595
NP_441432.1_8 Forward -291 -282 8.25953 0.0755
NP_441432.1_8 Reverse -168 -177 3.44131 0.245
NP_442320.1_8 Forward -296 -282 7.9644 0.0185
NP_441732.1_2 Reverse -277 -293 2.12349 0.0253
NP_441732.1_2 Forward -294 -278 -16.0677 0.164
NP_440629.1_6 Reverse -275 -294 20.4103 0.0271
NP_440629.1_6 Forward -296 -277 14.2621 0.183
NP_440760.1_1 Reverse -281 -300 -20.2567 0.222
NP_442797.1_7 Forward -359 -341 3.46073 0.234
NP_442797.1_7 Reverse -348 -366 -0.964162 0.291
NP_441131.1_5 Reverse -168 -187 3.14605 0.255
NP_442274.1_3 Reverse -286 -305 7.57094 0.297
NP_442274.1_8 Reverse -347 -365 13.6652 0.286
NP_440199.1_10 Reverse -278 -288 12.9597 0.114
NP_440713.1_4 Reverse -271 -290 3.93269 0.234
NP_442489.1_2 Reverse -158 -177 19.174 0.126
NP_442489.1_2 Reverse -326 -345 3.14605 0.246
NP_442489.1_7 Forward -290 -281 20.1576 0.000695
NP_442489.1_7 Reverse -281 -290 20.1576 0.000695
NP_442489.1_7 Forward -178 -169 -1.57357 0.213
NP_442489.1_7 Forward -65 -56 -1.6719 0.235
NP_442489.1_7 Reverse -169 -178 -1.6719 0.235
NP_442489.1_7 Reverse -56 -65 -1.96689 0.28
NP_440559.1_1 Reverse -282 -291 8.75118 0.0586
NP_440559.1_1 Forward -289 -280 8.65285 0.0586
NP_441659.2_8 Forward -290 -280 20.9245 0.000805
NP_441659.2_8 Reverse -281 -291 11.9764 0.0147
NP_441659.2_8 Forward -178 -168 3.22496 0.169
NP_440426.1_7 Reverse -271 -290 0.786102 0.256
NP_442913.1_10 Forward -268 -249 3.6377 0.102
NP_441040.1_5 Reverse -246 -265 2.85105 0.279
NP_442346.1_1 Forward -334 -315 12.1925 0.27
NP_442346.1_5 Reverse -280 -290 16.303 0.00248
NP_442346.1_5 Forward -291 -281 9.02648 0.118
NP_442346.1_5 Reverse -168 -178 5.5849 0.238
NP_442346.1_5 Reverse -252 -262 4.69992 0.276
NP_440352.1_5 Reverse -225 -244 12.2664 0.229
NP_440545.1_3 Forward -294 -277 13.8052 0.0166
NP_440545.1_3 Reverse -277 -294 9.08529 0.0411
NP_440545.1_3 Reverse -165 -182 -4.48438 0.227
NP_440025.1_1 Forward -294 -275 9.43923 0.194
NP_440025.1_4 Reverse -68 -87 10.3242 0.262
NP_440831.1_3 Forward -367 -348 6.67837 0.271
NP_441923.1_6 Forward -364 -350 7.86607 0.296
NP_442311.1_5 Forward -90 -71 2.16274 0.254
NP_441888.1_7 Reverse -51 -65 11.111 0.0956
NP_441888.1_7 Reverse -201 -215 6.6861 0.225
NP_441948.1_4 Reverse -274 -292 11.0322 0.0519
NP_441833.1_4 Forward -289 -282 15.9687 0.0124
NP_441833.1_4 Reverse -282 -289 15.9687 0.0124
NP_441895.1_2 Forward -305 -286 -26.8449 0.256
NP_442162.1_9 Forward -289 -282 16.2637 0.0124
NP_442162.1_9 Reverse -282 -289 16.2637 0.0124
NP_440671.1_4 Forward -296 -282 9.2427 0.184
NP_441044.1_4 Forward -316 -298 7.39397 0.223
NP_442199.1_5 Forward -196 -177 -1.67217 0.181
NP_442199.1_5 Forward -186 -167 -5.60541 0.251
NP_442140.1_3 Reverse -282 -292 17.4829 0.0159
NP_442140.1_3 Forward -177 -167 5.38824 0.211
NP_442140.1_7 Forward -96 -83 21.5538 0.0704
NP_442723.1_1 Reverse -308 -327 4.32522 0.276
NP_440875.1_9 Reverse -283 -293 18.3004 0.0104
NP_441813.1_5 Reverse -279 -289 15.9097 0.01
NP_441813.1_5 Forward -292 -282 10.0098 0.0208
NP_440590.1_4 Reverse -282 -295 3.65753 0.0702
NP_440590.1_4 Reverse -170 -183 -5.78224 0.289
NP_440567.1_1 Forward -289 -275 15.6342 0.017
NP_440567.1_1 Reverse -282 -296 4.62115 0.116
NP_442497.1_10 Forward -289 -280 17.601 0.00813
NP_442497.1_10 Reverse -282 -291 10.4228 0.0087
NP_440821.1_4 Forward -292 -282 18.7612 0.00422
NP_440821.1_4 Reverse -279 -289 11.0914 0.0146
NP_440821.1_8 Forward -82 -68 18.824 0.178
NP_441239.1_9 Forward -292 -280 16.0669 0.0175
NP_441239.1_9 Reverse -279 -291 14.6903 0.0258
NP_441239.1_9 Forward -180 -168 13.0187 0.0389
NP_441951.1_1 Reverse -219 -238 17.6007 0.266
NP_440400.1_1 Reverse -316 -335 -0.984623 0.285
NP_441892.1_1 Forward -299 -282 -3.10775 0.233
NP_442669.1_1 Reverse -359 -378 6.78429 0.0758
NP_440604.1_6 Forward -290 -271 -2.45882 0.221
NP_441508.1_4 Forward -396 -382 13.8579 0.29
NP_441017.1_8 Reverse -301 -316 10.0097 0.203
NP_440212.1_9 Forward -394 -375 1.71454 0.262
NP_440949.1_7 Forward -312 -293 16.3215 0.162
NP_442138.1_10 Forward -290 -271 -6.49039 0.285
NP_440546.1_4 Forward -290 -280 13.5365 0.0459
NP_440546.1_4 Reverse -281 -291 11.8882 0.0679
NP_440546.1_4 Reverse -169 -179 10.6277 0.109
NP_440546.1_4 Forward -328 -318 7.71902 0.224
NP_440441.1_7 Forward -337 -318 9.63589 0.248
NP_441656.1_3 Reverse -152 -171 8.06259 0.293
NP_440462.1_6 Forward -292 -282 17.9746 0.00578
NP_440462.1_6 Reverse -279 -289 16.893 0.00853
NP_441184.1_3 Forward -298 -279 1.27776 0.296
NP_442340.1_3 Forward -198 -179 -7.67036 0.238
NP_440868.1_4 Forward -294 -282 16.7552 0.0136
NP_440868.1_4 Reverse -277 -289 15.7719 0.0164
NP_440868.1_4 Reverse -291 -303 1.80894 0.174
NP_441497.1_3 Reverse -256 -275 -0.885524 0.2
NP_441868.1_1 Reverse -58 -77 15.6125 0.201
NP_442402.1_4 Reverse -218 -237 -6.29447 0.255
NP_442402.1_4 Reverse -380 -399 -7.96609 0.278
NP_442402.1_10 Reverse -308 -318 10.4026 0.29
NP_441848.1_10 Forward -246 -233 19.8272 0.0736
NP_440696.1_3 Forward -188 -170 0.0191479 0.237
NP_442039.1_4 Forward -289 -282 15.1821 0.0124
NP_442039.1_4 Reverse -282 -289 15.1821 0.0124
NP_441811.1_4 Forward -360 -341 7.7676 0.166
NP_442837.1_3 Forward -289 -282 15.7721 0.0124
NP_442837.1_3 Reverse -282 -289 15.7721 0.0124
NP_442053.1_1 Forward -290 -281 18.3876 0.0007
NP_442053.1_1 Reverse -281 -290 18.3876 0.0007
NP_440505.1_3 Reverse -279 -289 15.123 0.014
NP_440505.1_3 Forward -292 -282 14.1397 0.0235
NP_440505.1_3 Reverse -54 -64 9.91146 0.122
NP_442532.1_7 Reverse -281 -295 6.29277 0.171
NP_441576.1_10 Reverse -55 -74 21.4356 0.0735
NP_440914.1_1 Forward -290 -280 16.3248 0.00196
NP_440914.1_1 Reverse -281 -291 8.6151 0.186
NP_440914.1_1 Forward -351 -341 6.17532 0.293
NP_441011.1_8 Reverse -282 -291 16.9127 0.00602
NP_441011.1_8 Forward -289 -280 16.6177 0.00602
NP_442101.1_10 Forward -298 -279 -13.0786 0.285
NP_442533.1_1 Forward -337 -318 -15.7335 0.257
NP_442533.1_1 Forward -338 -319 -16.7168 0.275
NP_442533.1_6 Forward -290 -281 17.2076 0.00137
NP_442533.1_6 Reverse -281 -290 17.2076 0.00137
NP_442533.1_6 Forward -178 -169 13.5694 0.021
NP_442533.1_6 Reverse -169 -178 6.78456 0.103
NP_442533.1_6 Reverse -319 -328 1.37636 0.3
NP_442541.1_3 Reverse -315 -334 5.70265 0.244
NP_442541.1_10 Forward -178 -164 1.47397 0.286
NP_440263.1_6 Forward -301 -282 11.0125 0.274
NP_442232.1_3 Forward -298 -279 -14.6519 0.288
NP_442232.1_3 Reverse -273 -292 -15.3402 0.291
NP_441482.1_7 Forward -296 -282 0.786239 0.0554
NP_441482.1_7 Reverse -275 -289 -3.34366 0.118
NP_439944.1_9 Forward -289 -279 17.6796 0.00347
NP_439944.1_9 Reverse -282 -292 10.4031 0.0887
NP_441028.1_6 Reverse -9 -19 3.51951 0.292
NP_442202.1_10 Reverse -45 -59 2.65453 0.288
NP_440116.1_5 Forward -293 -276 4.95539 0.176
NP_440115.1_6 Forward -293 -283 10.5998 0.115
NP_440115.1_6 Reverse -278 -288 6.46988 0.181
NP_441602.1_4 Forward -301 -282 16.6174 0.235
NP_441602.1_4 Reverse -270 -289 8.94757 0.279
NP_441170.1_2 Forward -61 -42 5.30933 0.149
NP_441106.1_1 Reverse -280 -289 18.486 0.0028
NP_441106.1_1 Forward -291 -282 18.191 0.0028
NP_439903.1_6 Forward -293 -274 2.6536 0.222
NP_442588.1_6 Forward -256 -237 0.0977854 0.252
NP_442306.1_10 Reverse -276 -295 8.55425 0.0289
NP_441286.1_1 Reverse -280 -292 5.34885 0.0259
NP_441286.1_1 Forward -291 -279 4.8572 0.0272
NP_442674.1_3 Forward -180 -161 3.34192 0.294
NP_440670.1_8 Forward -290 -281 18.3876 0.000699
NP_440670.1_8 Reverse -281 -290 18.3876 0.000699
NP_440670.1_8 Forward -65 -56 3.53964 0.257
NP_440886.1_7 Forward -291 -281 17.7774 0.0011
NP_440886.1_7 Reverse -280 -290 8.04271 0.0805
NP_440886.1_7 Forward -179 -169 6.46942 0.123
NP_440886.1_7 Reverse -348 -358 5.09279 0.201
NP_442072.1_9 Reverse -280 -298 -23.187 0.284
NP_440907.2_8 Reverse -282 -292 17.4824 0.00685
NP_440907.2_8 Forward -289 -279 9.51767 0.103
NP_440907.2_8 Reverse -343 -353 4.01116 0.283
NP_441021.1_1 Forward -199 -180 3.04771 0.083
NP_441021.1_8 Reverse -276 -294 4.14905 0.225
NP_441463.1_3 Forward -198 -179 0.196116 0.132
NP_441463.1_6 Reverse -279 -293 17.3355 0.114
NP_442842.1_4 Reverse -152 -171 7.27595 0.223
NP_441626.1_2 Forward -289 -282 15.7721 0.0124
NP_441626.1_2 Reverse -282 -289 15.7721 0.0124
NP_442365.1_7 Forward -294 -275 -1.27885 0.191
NP_440107.1_5 Reverse -274 -293 2.45773 0.178
NP_442615.1_1 Forward -299 -281 11.3272 0.018
NP_442615.1_1 Reverse -272 -290 -7.06068 0.273
NP_441962.1_4 Forward -205 -186 -14.7502 0.293
NP_440387.1_1 Forward -290 -274 16.2831 0.0047
NP_440387.1_1 Reverse -281 -297 13.5299 0.00861
NP_440387.1_1 Forward -160 -144 -4.85801 0.203
NP_441431.1_2 Forward -181 -167 13.9619 0.0774
NP_441431.1_2 Forward -293 -279 11.4053 0.138
NP_441431.1_2 Forward -182 -168 7.17714 0.247
NP_442647.1_7 Reverse -321 -334 7.78743 0.239
NP_441993.1_1 Reverse -281 -300 9.4509 0.136
NP_441993.1_1 Reverse -163 -182 1.16703 0.284
NP_441174.1_2 Reverse -278 -292 20.6491 0.00279
NP_440114.1_10 Forward -290 -276 15.9292 0.0214
NP_440114.1_10 Reverse -281 -295 8.16106 0.213
NP_440114.1_10 Reverse -169 -183 7.37441 0.236
NP_442698.1_10 Reverse -165 -184 -0.787193 0.297
NP_441510.2_2 Forward -294 -275 2.85027 0.272
NP_441510.2_7 Forward -132 -118 10.5204 0.28
NP_440095.1_8 Forward -334 -315 10.9142 0.182
NP_441720.1_2 Reverse -277 -296 4.62021 0.231
NP_440766.1_4 Reverse -277 -291 6.78443 0.0973
NP_439988.1_7 Forward -288 -274 12.8803 0.292
NP_439910.1_2 Forward -168 -151 -22.184 0.215
NP_440457.1_1 Reverse -277 -289 11.5437 0.092
NP_440457.1_1 Forward -294 -282 -0.354346 0.262
NP_440798.1_6 Reverse -282 -295 9.75405 0.0892
NP_440798.1_6 Forward -289 -276 3.16588 0.152
NP_440473.1_1 Reverse -166 -185 13.282 0.196
NP_442509.1_9 Reverse -281 -291 16.2041 0.00739
NP_442509.1_9 Forward -290 -280 8.04271 0.192
NP_442439.1_8 Forward -179 -160 17.2074 0.134
NP_440554.1_4 Forward -289 -279 16.1063 0.0189
NP_440554.1_4 Reverse -282 -292 13.943 0.0218
NP_441885.1_5 Reverse -281 -291 11.4848 0.00668
NP_441885.1_5 Forward -290 -280 11.3864 0.00668
NP_440478.1_10 Forward -292 -278 7.27608 0.264
NP_440478.1_10 Reverse -171 -185 6.48943 0.291
NP_442341.1_7 Reverse -280 -294 1.86788 0.278
NP_442341.1_9 Forward -292 -278 4.91554 0.287
NP_441756.1_5 Forward -294 -275 -4.42544 0.294
NP_442395.2_4 Reverse -348 -367 5.50519 0.161
NP_443000.1_7 Reverse -279 -289 17.4829 0.00719
NP_443000.1_7 Forward -292 -282 2.04498 0.226
NP_440507.2_3 Forward -299 -280 9.24175 0.227
NP_440507.2_4 Reverse -340 -359 9.83255 0.28
NP_440727.1_8 Reverse -378 -392 18.5371 0.198
NP_441842.1_2 Forward -267 -250 16.2635 0.195
NP_441842.1_10 Reverse -274 -288 15.0442 0.0474
NP_440275.1_3 Forward -292 -282 17.9746 0.0082
NP_440275.1_3 Reverse -279 -289 9.12481 0.055
NP_440091.1_1 Forward -294 -282 10.8554 0.0429
NP_440091.1_1 Reverse -277 -289 8.39711 0.0653
NP_443010.1_10 Forward -293 -276 7.79575 0.165
NP_442451.1_2 Forward -322 -303 -8.94866 0.258
NP_441122.1_1 Reverse -165 -180 3.42148 0.281
NP_440149.1_8 Reverse -281 -300 -6.88371 0.265
NP_441105.1_3 Forward -301 -282 -7.17871 0.248
NP_440216.1_1 Forward -290 -276 7.57108 0.00935
NP_440216.1_1 Reverse -281 -295 5.60446 0.0191
NP_440216.1_9 Forward -176 -167 7.37455 0.286
NP_440172.1_1 Forward -290 -280 17.5813 0.00421
NP_440172.1_1 Reverse -281 -291 8.73149 0.0586
NP_442015.1_10 Forward -294 -281 2.77255 0.187
NP_442015.1_10 Reverse -277 -290 1.88757 0.204
NP_442015.1_10 Reverse -202 -215 -0.767364 0.281
NP_441226.1_7 Forward -289 -282 14.4934 0.0123
NP_441226.1_7 Reverse -282 -289 14.4934 0.0123
NP_441111.1_7 Forward -289 -281 18.7023 0.00294
NP_441111.1_7 Reverse -282 -290 18.7023 0.00294
NP_442379.1_10 Reverse -274 -291 3.87375 0.162
NP_441766.1_2 Forward -290 -281 17.5026 0.00297
NP_441766.1_2 Reverse -281 -290 17.5026 0.00297
NP_441766.1_2 Reverse -349 -358 1.47469 0.289
NP_440416.1_9 Reverse -274 -293 -17.3068 0.237
NP_440416.1_9 Reverse -162 -181 -20.4534 0.285
NP_440416.1_9 Forward -297 -278 -21.0434 0.29
NP_443052.1_8 Forward -300 -281 -9.24366 0.187
NP_440261.1_5 Reverse -282 -295 -1.16069 0.0662
NP_440261.1_5 Forward -261 -248 -6.76555 0.201
NP_440261.1_5 Forward -289 -276 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGGTGGAAAAAGTCAGCCTTTTCTTTCCAAACACTGGCTCCGGAGAGCGGGGAACCCATGTCAATGTCAGTGGGGCTGGGGTGCTGAAAAATGCCCCCAATCGAGACGCGGCGATCGCCTTCCTGGAATATCTAGCCAGTGATGACGCCCAACGTTATTTTGCTGAGGGCAACAATGAGTATCCGGTAATTCCAGGGGTACCCATTGATCCTGTGCTAGCCGCCCATGGCCAACTAAAAGGAGACCCCCTCAATGTTTCTAACTTGGGACGTTACCAACCCGATTCAGCTCGTTTAATGAATGAAGTTGGCTGGCAGTAATGCAAAAAAAATTGGACAATTGCCGGAGTTTGGCCTCTGATTATTGCATATAAATTGCATATAGGGGTTAGAACACGAT

CDS

ATGGTTTTGGCAGGATCAAACGCCGTTCTCAAACTTTCAGAGGTACGGTGTTTTTGTTGCCAGTCTTCTGTTTCTTCCCTTTTTTTGGATTCCATGTGGCCCCTCTCCTGGCATCAGTTAAAATTTCCCCTAGCATTTATCTGTGCTTCTACAATCCATGGAGGGTTACTCTGGTTACCCTTGCCCCCCCCAGCAGCGGAGTTGGAGCCTCTCCCCCCCCCATCAAAGGATTCTGCTTCCGAGGCGATCGCCACAGTGCCCCTCGCCGACCTAGTGACACCGGCCCCCATGGCAGAACCTCCGCCAAAGAAATCCCCCCAAGTTTTAGCGCCTCTCCCTGGGTCTCAATCTGTTCGTGAAGTAGTGCCTGATGTTATAGCGCCACCACCATCTCCTCCCCAAACCACTCCTCTACCGAAAGCCTCCCCTAAAGCAGTAAAGGCACCCCAGGGCGAACCGAATCAAAGGCAGGACAACGAAAAAATTGAGCCTGAATCGGTTCCAGAATCCCGCTCTGACCAAGGGCAGGAGGTTGAGAATGAGATTAAAAGTATTGAACCCTCCTCCTTCCCTCAGCCTAAGAGGGAACTCATCGCTGGCATTGCCCACTTAGAAGGAGCTCAATCAGGATGCTACGGCTCAGAGGATTGTCATTTTCTGGCAGGGGCCACGGTGCGGGACGTCACCCAAGACCTCCAAGCCCGTTTGGAGGCACAAGGCTTCCGTCTGAGTGAGAGTTATCGAGATACGGGATTGCGGGTATATGAGGTTTATCGGCAAGACAAACTACCCCAATTTCTCCACATCGTCAGTGATAATGCGGGACGGGATGCGTTTTATCTTCTCTCCCCCCAACAAAAAACCTTAGAGGAACTTAGATCGCAATGA

Protein

MVLAGSNAVLKLSEVRCFCCQSSVSSLFLDSMWPLSWHQLKFPLAFICASTIHGGLLWLPLPPPAAELEPLPPPSKDSASEAIATVPLADLVTPAPMAEPPPKKSPQVLAPLPGSQSVREVVPDVIAPPPSPPQTTPLPKASPKAVKAPQGEPNQRQDNEKIEPESVPESRSDQGQEVENEIKSIEPSSFPQPKRELIAGIAHLEGAQSGCYGSEDCHFLAGATVRDVTQDLQARLEAQGFRLSESYRDTGLRVYEVYRQDKLPQFLHIVSDNAGRDAFYLLSPQQKTLEELRSQ