Your browser is old and dusty. Try Google Chrome!

Details for slr0513

ORF slr0513
Accession NP_442521.1
Symbol
Category iron transport system substrate-binding protein, periplasmic protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -368 -382 8.25939 0.0917
NP_442291.1_3 Reverse -266 -285 10.4217 0.281
NP_441623.1_1 Reverse -263 -281 -2.0458 0.241
NP_441818.1_9 Forward -279 -260 -3.63879 0.228
NP_441818.1_9 Reverse -308 -327 -7.96535 0.274
NP_442752.1_4 Forward -279 -272 12.1338 0.0546
NP_441812.1_2 Forward -296 -277 15.8307 0.226
NP_442861.1_4 Forward -45 -26 20.9431 0.00914
NP_441934.1_10 Reverse -64 -78 20.7474 0.0409
NP_441250.1_3 Reverse -160 -179 5.11266 0.241
NP_440061.1_9 Reverse -260 -274 14.1586 0.0722
NP_441054.1_4 Reverse -252 -270 -4.20908 0.3
NP_440304.1_4 Reverse -9 -19 5.28991 0.218
NP_440132.1_6 Forward -389 -370 10.5209 0.187
NP_441925.1_4 Reverse -263 -282 -14.8492 0.263
NP_441083.1_5 Reverse -270 -280 4.69992 0.134
NP_441083.1_5 Forward -140 -130 2.92996 0.187
NP_440410.1_8 Forward -372 -353 14.6499 0.266
NP_441327.1_1 Reverse -231 -250 2.86785 0.279
NP_441533.1_1 Reverse -223 -242 14.5524 0.221
NP_441014.1_10 Forward -21 -2 -2.75457 0.287
NP_443018.1_3 Forward -270 -263 10.2655 0.107
NP_441634.1_8 Reverse -260 -274 -4.22864 0.295
NP_440376.1_1 Forward -279 -270 0.196389 0.283
NP_441846.1_10 Forward -289 -270 -21.1417 0.256
NP_440642.1_10 Reverse -340 -354 13.9619 0.127
NP_440571.1_5 Forward -202 -183 13.9625 0.221
NP_440571.1_6 Reverse -223 -242 13.2252 0.296
NP_440360.1_10 Reverse -264 -278 2.65453 0.261
NP_440141.1_4 Forward -385 -366 -11.7019 0.298
NP_441855.2_4 Reverse -262 -281 12.2225 0.2
NP_442496.1_5 Forward -286 -268 5.52568 0.288
NP_442205.1_9 Reverse -35 -51 -3.08806 0.278
NP_439990.1_8 Reverse -62 -81 -2.16383 0.283
NP_442690.1_1 Forward -47 -28 -9.14533 0.194
NP_442064.1_4 Reverse -363 -382 12.88 0.147
NP_443055.1_6 Forward -279 -261 5.62325 0.179
NP_443055.1_6 Reverse -262 -280 0.706727 0.24
NP_442002.1_1 Forward -288 -270 1.19912 0.185
NP_442002.1_9 Reverse -24 -31 11.3472 0.185
NP_442431.1_10 Forward -282 -264 1.59244 0.251
NP_441916.1_7 Reverse -117 -127 1.55333 0.282
NP_441916.1_7 Reverse -262 -272 1.06167 0.294
NP_442396.1_5 Reverse -105 -118 5.23083 0.292
NP_441725.1_5 Forward -19 -9 7.05986 0.106
NP_441514.1_6 Forward -372 -365 12.7238 0.29
NP_441087.1_6 Forward -28 -10 -4.01314 0.296
NP_443030.1_4 Forward -389 -370 -4.72043 0.251
NP_441644.1_6 Forward -271 -261 4.30615 0.242
NP_441644.1_6 Reverse -262 -272 3.32285 0.288
NP_443049.1_6 Forward -280 -270 14.3735 0.114
NP_442215.1_1 Reverse -54 -73 2.55606 0.293
NP_442554.1_8 Reverse -263 -273 4.99491 0.163
NP_442554.1_8 Forward -270 -260 4.60159 0.18
NP_442554.1_9 Reverse -339 -358 12.9785 0.279
NP_442970.1_3 Forward -180 -162 13.6192 0.197
NP_442142.1_4 Forward -217 -204 3.55864 0.251
NP_441020.2_6 Forward -281 -264 7.61033 0.225
NP_442719.1_2 Reverse -235 -253 -0.571569 0.162
NP_441251.1_7 Reverse -19 -32 12.704 0.266
NP_441612.1_2 Forward -271 -261 7.00028 0.268
NP_442227.1_2 Reverse -264 -283 -3.73712 0.295
NP_441911.1_10 Forward -357 -338 7.69133 0.274
NP_442808.1_1 Reverse -269 -279 4.60114 0.195
NP_441101.1_10 Reverse -264 -283 -6.98204 0.29
NP_440145.1_4 Reverse -271 -281 17.4824 0.0863
NP_442342.1_9 Reverse -268 -284 12.6449 0.103
NP_440630.1_7 Reverse -262 -281 -7.96535 0.287
NP_441114.1_3 Forward -18 -9 7.57121 0.231
NP_440558.1_2 Reverse -364 -383 -1.96717 0.22
NP_440162.1_1 Forward -189 -170 16.4469 0.285
NP_441878.1_6 Forward -272 -262 10.5014 0.0176
NP_441878.1_6 Reverse -261 -271 0.57002 0.14
NP_441878.1_6 Reverse -10 -20 -7.49312 0.231
NP_441878.1_6 Forward -280 -270 -7.98478 0.285
NP_441534.1_3 Forward -242 -223 15.5349 0.225
NP_441557.1_8 Reverse -271 -281 13.9425 0.201
NP_442777.1_1 Reverse -270 -289 17.7965 0.158
NP_442397.1_9 Forward -73 -54 1.47442 0.283
NP_442047.1_2 Reverse -251 -265 14.3559 0.19
NP_441633.1_3 Reverse -260 -273 -6.07724 0.236
NP_440299.1_1 Forward -18 -5 3.36198 0.247
NP_440299.1_1 Reverse -264 -277 2.37867 0.291
NP_440640.1_6 Forward -291 -272 -1.18052 0.299
NP_442334.1_2 Forward -281 -264 -4.38605 0.2
NP_440915.1_6 Forward -283 -269 18.6825 0.0113
NP_442866.1_4 Forward -72 -53 9.24257 0.164
NP_441464.1_8 Reverse -268 -282 4.52282 0.269
NP_441271.1_3 Reverse -362 -380 18.4062 0.143
NP_440586.1_8 Forward -270 -263 9.08521 0.178
NP_443051.1_5 Forward -261 -242 3.83436 0.298
NP_440408.1_7 Forward -383 -364 14.0608 0.171
NP_440316.1_10 Forward -280 -270 7.55152 0.246
NP_442790.1_4 Forward -82 -63 -15.8318 0.297
NP_442262.1_10 Forward -270 -263 9.18389 0.211
NP_440189.1_10 Reverse -135 -154 6.88262 0.242
NP_441965.1_10 Forward -274 -258 5.27008 0.213
NP_441965.1_10 Forward -370 -354 2.12349 0.289
NP_440297.1_9 Forward -19 -9 6.96153 0.161
NP_440297.1_9 Reverse -263 -273 -0.314959 0.282
NP_442280.1_10 Reverse -358 -376 13.1491 0.158
NP_441592.1_4 Forward -271 -252 -2.45882 0.265
NP_440894.1_10 Reverse -286 -305 5.80098 0.227
NP_443036.1_1 Reverse -366 -385 8.94676 0.287
NP_441268.1_1 Forward -189 -170 13.5117 0.238
NP_441123.1_6 Forward -28 -10 9.0656 0.279
NP_442710.1_7 Reverse -185 -204 0.177711 0.193
NP_440148.1_1 Forward -202 -183 4.52268 0.186
NP_443062.1_1 Forward -388 -370 8.64343 0.15
NP_442204.1_1 Reverse -1 -12 3.89358 0.266
NP_440516.1_8 Forward -279 -270 -0.491928 0.262
NP_441443.1_1 Forward -281 -262 1.96607 0.195
NP_440673.1_3 Forward -18 -11 8.98723 0.203
NP_441052.1_2 Forward -271 -261 10.4031 0.0285
NP_441733.1_10 Forward -282 -269 7.59077 0.153
NP_441004.1_1 Reverse -5 -24 -16.2252 0.283
NP_441004.1_1 Forward -277 -258 -17.5035 0.292
NP_441004.1_1 Forward -382 -363 -18.1918 0.298
NP_441004.1_2 Forward -282 -263 -0.885524 0.259
NP_441004.1_4 Forward -274 -264 10.4031 0.254
NP_441004.1_4 Reverse -8 -18 10.1081 0.254
NP_440296.1_10 Forward -282 -263 -14.6519 0.27
NP_442694.1_4 Reverse -99 -108 11.7011 0.277
NP_442206.1_10 Forward -376 -361 -0.315096 0.29
NP_443054.1_2 Forward -143 -129 3.14618 0.24
NP_441545.1_6 Forward -371 -352 14.6508 0.196
NP_442515.1_1 Reverse -261 -275 -4.22864 0.298
NP_440593.1_9 Reverse -265 -279 9.5377 0.245
NP_442689.1_8 Forward -43 -26 0.0388413 0.191
NP_440432.1_9 Reverse -271 -286 -6.31328 0.296
NP_441124.1_5 Reverse -240 -250 14.918 0.21
NP_440431.1_3 Reverse -230 -249 -12.0953 0.296
NP_442006.1_2 Forward -280 -263 -15.7924 0.228
NP_442006.1_3 Forward -285 -267 -4.99573 0.298
NP_440483.1_1 Forward -284 -265 -3.04881 0.21
NP_440078.1_2 Reverse -199 -218 16.9124 0.159
NP_441078.1_4 Forward -271 -262 -1.6719 0.266
NP_441078.1_4 Reverse -262 -271 -1.77023 0.266
NP_440526.1_3 Reverse -271 -282 10.6779 0.0646
NP_442815.1_2 Forward -381 -363 6.60732 0.212
NP_442727.1_10 Reverse -168 -187 4.12936 0.189
NP_442751.1_1 Forward -345 -326 17.6075 0.222
NP_442489.1_7 Reverse -262 -271 5.21127 0.077
NP_442489.1_7 Forward -271 -262 -1.6719 0.235
NP_440941.1_1 Forward -281 -271 15.123 0.278
NP_442079.1_7 Forward -387 -368 -0.197208 0.29
NP_440426.1_7 Forward -136 -117 1.37609 0.241
NP_441800.1_7 Forward -342 -324 -0.865831 0.233
NP_442346.1_5 Forward -272 -262 6.8632 0.188
NP_442346.1_5 Reverse -261 -271 4.89658 0.269
NP_442346.1_5 Reverse -10 -20 4.79825 0.272
NP_441856.1_3 Forward -154 -135 -2.55715 0.267
NP_440555.1_4 Forward -373 -354 7.96426 0.214
NP_440486.1_6 Forward -278 -259 15.5357 0.207
NP_441653.1_2 Forward -290 -271 6.04209 0.235
NP_441050.1_5 Forward -76 -58 3.06741 0.207
NP_442699.1_7 Reverse -378 -392 20.8458 0.158
NP_442943.1_1 Reverse -195 -210 5.68962 0.21
NP_440017.1_4 Forward -268 -250 11.1305 0.289
NP_442089.1_6 Reverse -88 -107 4.916 0.262
NP_441239.1_9 Reverse -268 -280 7.21714 0.169
NP_441239.1_9 Forward -273 -261 4.8572 0.239
NP_441892.1_1 Forward -280 -263 -4.77938 0.268
NP_440665.1_8 Reverse -378 -397 18.879 0.0436
NP_441017.1_6 Reverse -7 -21 13.7653 0.174
NP_440546.1_4 Forward -279 -269 11.1125 0.0963
NP_441603.1_5 Reverse -275 -294 17.3048 0.147
NP_441672.1_10 Forward -365 -346 15.7324 0.244
NP_440812.1_2 Forward -89 -70 8.94757 0.249
NP_442402.1_4 Reverse -157 -176 -8.55607 0.283
NP_441084.1_6 Forward -273 -259 10.6046 0.234
NP_442923.1_6 Reverse -32 -46 10.8022 0.275
NP_442679.1_1 Forward -267 -248 4.42435 0.147
NP_440825.1_6 Reverse -99 -118 13.9625 0.242
NP_441701.1_3 Forward -386 -369 18.2301 0.126
NP_442532.1_1 Reverse -174 -188 9.23901 0.284
NP_441408.2_7 Forward -385 -366 -4.42544 0.281
NP_442533.1_6 Reverse -262 -271 6.8829 0.101
NP_442533.1_6 Forward -271 -262 6.78456 0.103
NP_442533.1_6 Reverse -270 -279 4.0313 0.194
NP_442541.1_10 Reverse -269 -283 5.80051 0.248
NP_442322.1_4 Reverse -55 -72 1.02145 0.21
NP_442229.1_9 Forward -59 -40 19.0748 0.0901
NP_441219.1_6 Forward -377 -359 13.0972 0.18
NP_441028.1_6 Forward -29 -19 3.51951 0.292
NP_441527.1_5 Reverse -180 -199 11.6293 0.297
NP_441602.1_4 Forward -221 -202 8.94757 0.279
NP_442306.1_10 Reverse -257 -276 -1.96717 0.0617
NP_441286.1_1 Reverse -261 -273 -5.17256 0.192
NP_440886.1_7 Reverse -269 -279 3.8145 0.265
NP_442382.1_9 Forward -38 -19 9.83173 0.281
NP_440907.2_8 Reverse -271 -281 7.0594 0.132
NP_441021.1_1 Reverse -368 -387 -1.57384 0.12
NP_441021.1_1 Reverse -271 -290 -8.94866 0.204
NP_441463.1_6 Reverse -260 -274 7.4789 0.261
NP_442061.1_6 Reverse -102 -112 16.598 0.232
NP_441962.1_4 Forward -381 -362 -3.54046 0.149
NP_441962.1_4 Forward -276 -257 -13.9635 0.28
NP_441431.1_3 Reverse -205 -224 2.55606 0.283
NP_441836.1_2 Forward -277 -258 -6.09707 0.291
NP_441836.1_2 Reverse -256 -275 -6.39206 0.297
NP_440634.1_8 Forward -332 -313 2.55527 0.285
NP_441993.1_1 Forward -277 -258 1.84923 0.269
NP_441993.1_3 Reverse -264 -283 17.4032 0.2
NP_442084.1_2 Forward -79 -60 15.6341 0.252
NP_440358.1_8 Reverse -212 -231 -0.688862 0.272
NP_442805.1_5 Reverse -293 -312 -7.08111 0.297
NP_440114.1_10 Forward -279 -265 6.88276 0.253
NP_442698.1_10 Forward -275 -256 1.47442 0.297
NP_442323.1_7 Forward -25 -6 4.03023 0.224
NP_440766.1_4 Forward -283 -269 0.589577 0.276
NP_439988.1_3 Forward -102 -88 4.52282 0.295
NP_441246.1_2 Reverse -188 -207 5.211 0.195
NP_441246.1_7 Forward -72 -53 1.17943 0.286
NP_440457.1_1 Forward -283 -271 12.3303 0.092
NP_440457.1_1 Reverse -7 -19 4.26721 0.168
NP_441981.1_3 Forward -265 -251 16.0613 0.268
NP_440142.1_7 Forward -376 -357 7.27595 0.256
NP_441332.1_6 Reverse -269 -279 16.0033 0.0994
NP_441489.1_3 Forward -248 -234 9.46532 0.232
NP_442395.2_4 Forward -383 -364 0.0970122 0.279
NP_440423.1_6 Forward -279 -260 -13.7669 0.224
NP_441105.1_3 Reverse -362 -381 -4.81876 0.207
NP_441226.1_7 Reverse -271 -278 8.29857 0.205
NP_440305.1_1 Forward -368 -354 12.712 0.287
NP_440244.1_1 Forward -281 -262 -6.78538 0.287
NP_440416.1_9 Reverse -372 -391 -21.83 0.297
NP_442116.1_6 Forward -234 -217 6.64108 0.273
NP_442116.1_6 Reverse -195 -212 5.39969 0.299
NP_442403.1_8 Reverse -127 -146 0.58944 0.241
NP_440591.1_9 Forward -278 -260 8.67227 0.179
NP_440988.1_10 Forward -378 -364 3.54345 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACCAACCTCGTTCGAAGGCAGTGGTAAGGGCAAGGATGGACAGCAGTAACAAAGGAAACATCACTACCCCTCCCTTAAGAAACTCATCGAGTAGCCGCGGAGTTTGAGTCAAAAACAGGGGGGATGGGGCCATGGACAGAAAACAGGGAAATTTTCTAAATAATAATCTCTTGCAATTATCCAGCACAAGTGCTTCAATAATTTATGGATTATTGCACTTTATTTGCAATAAAGTTGACTATCCGAGGTTGACCCACTCCAGATGCCCATTAAGCTATCTATCACTAGCCAAACAAGCCCAGACATGGGGCCTAGTTCGGATTAAGGGGACTGGGTTGAGCCTGCACTATTGATTACTTTCATTTTAAATTGCCCACTATCCATTGCCCTAGACTTCG

CDS

ATGACAACTAAGATTTCCCGGCGGACTTTTTTTGTGGGCGGCACCGCCCTCACTGCCCTAGTGGTAGCTAATTTGCCCCGGCGGGCCTCTGCCCAGTCCCGCACGATCAACCTCTATTCTTCACGGCATTACAACACCGATGATGCCCTCTACGATGCTTTTGGCGAGGTTAACCTCATTGAGGCCAGTGCCGAAGAACTGATTGAGCGTATCCAAAGTGAAGGGGCTAATAGTCCAGGGGATATTTTATTCACCGTAGATGCCGGTATGTTATGGCGGGCGGAACAGGCGGGACTTTTCCAACCGGTGCGCAGCGGCAAGCTGAATGAGCGCATTCCCGAAAATTTGCGCCACCCTGATGGGCTATGGTATGGCTTCACCCAGAGAGCCCGGGTGTTGTATTACAGTCGCGACCGGGTCAATCCAGCGGATCTCTCCACCTACGAAGCCCTGGCGGATCCCCAATGGCGAGGAAAAATTCTGGTGCGCCCTTCCAGTAATGTATATAACCTTTCCCTAACTGCTTCCCGCATTGCCATCCATGGAGAGCCAGAAACCCGCCGCTGGTTACAAGGCTTGGTGGGTAACTTTGCCCGGCAACCGGAGGGTAATGACACGGCACAAATTCGTGCTATTGCCGCCGGCATCGGAGATGTGGCGATCGCCAATAGCTACTACTATATCCGCCTGCAAAAGTCCACCGATCCCGCCGATCAAGAAGTGGTGGAAAAAGTCAGCCTTTTCTTTCCAAACACTGGCTCCGGAGAGCGGGGAACCCATGTCAATGTCAGTGGGGCTGGGGTGCTGAAAAATGCCCCCAATCGAGACGCGGCGATCGCCTTCCTGGAATATCTAGCCAGTGATGACGCCCAACGTTATTTTGCTGAGGGCAACAATGAGTATCCGGTAATTCCAGGGGTACCCATTGATCCTGTGCTAGCCGCCCATGGCCAACTAAAAGGAGACCCCCTCAATGTTTCTAACTTGGGACGTTACCAACCCGATTCAGCTCGTTTAATGAATGAAGTTGGCTGGCAGTAA

Protein

MTTKISRRTFFVGGTALTALVVANLPRRASAQSRTINLYSSRHYNTDDALYDAFGEVNLIEASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPADLSTYEALADPQWRGKILVRPSSNVYNLSLTASRIAIHGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQEVVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPDSARLMNEVGWQ