Your browser is old and dusty. Try Google Chrome!

Details for slr0509

ORF slr0509
Accession NP_442514.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -165 -151 10.4227 0.0622
NP_441061.1_2 Forward -380 -366 3.8345 0.159
NP_441061.1_2 Reverse -345 -359 3.04785 0.168
NP_441061.1_2 Reverse -351 -365 2.2612 0.178
NP_441061.1_2 Reverse -180 -194 1.27789 0.192
NP_441061.1_2 Reverse -110 -124 0.491246 0.207
NP_441061.1_2 Reverse -51 -65 -0.197071 0.223
NP_440795.1_7 Forward -380 -373 14.6904 0.0123
NP_440795.1_7 Reverse -373 -380 14.6904 0.0123
NP_440795.1_7 Forward -165 -158 14.6904 0.0123
NP_440795.1_7 Reverse -158 -165 14.6904 0.0123
NP_440795.1_7 Reverse -51 -58 8.8889 0.188
NP_441418.1_6 Forward -381 -362 8.55425 0.00393
NP_441418.1_6 Reverse -356 -375 -20.8467 0.129
NP_441418.1_6 Forward -166 -147 -28.7132 0.208
NP_441418.1_6 Reverse -275 -294 -30.7781 0.296
NP_442291.1_5 Forward -382 -366 -1.80975 0.202
NP_442291.1_5 Forward -167 -151 -3.38305 0.239
NP_441453.1_1 Reverse -268 -286 5.52492 0.246
NP_441453.1_4 Reverse -372 -380 16.539 0.00633
NP_441453.1_4 Reverse -157 -165 16.539 0.00633
NP_441453.1_4 Forward -381 -373 16.539 0.00633
NP_441453.1_4 Forward -166 -158 16.539 0.00633
NP_441453.1_4 Forward -59 -51 11.5241 0.043
NP_441453.1_4 Reverse -179 -187 4.34598 0.257
NP_441453.1_4 Forward -353 -345 4.24765 0.259
NP_441453.1_4 Reverse -344 -352 4.24765 0.259
NP_441453.1_4 Forward -188 -180 4.24765 0.259
NP_441453.1_4 Reverse -356 -364 3.95266 0.275
NP_441453.1_7 Reverse -123 -130 12.9205 0.23
NP_441453.1_8 Forward -336 -319 6.43035 0.293
NP_442151.1_6 Reverse -157 -171 13.4709 0.0512
NP_442151.1_6 Reverse -344 -358 12.1926 0.0792
NP_442151.1_6 Reverse -115 -129 10.6193 0.119
NP_442151.1_6 Forward -381 -367 9.14437 0.157
NP_442151.1_6 Reverse -372 -386 8.06273 0.183
NP_442151.1_6 Forward -166 -152 7.76774 0.19
NP_440561.1_8 Reverse -81 -100 10.3242 0.268
NP_441818.1_1 Forward -165 -154 18.8393 0.00301
NP_441818.1_1 Reverse -158 -169 17.1677 0.00948
NP_441818.1_1 Reverse -110 -121 8.90795 0.271
NP_441818.1_1 Forward -380 -369 8.51463 0.288
NP_441818.1_9 Forward -284 -265 -10.227 0.292
NP_440226.1_1 Forward -166 -147 2.75272 0.253
NP_440226.1_1 Reverse -372 -391 2.3594 0.267
NP_442169.1_1 Reverse -82 -101 -1.27885 0.265
NP_443002.1_5 Reverse -180 -198 10.8348 0.256
NP_442173.1_1 Forward -380 -372 15.4574 0.00633
NP_442173.1_1 Forward -165 -157 15.4574 0.00633
NP_442173.1_1 Reverse -373 -381 15.4574 0.00633
NP_442173.1_1 Reverse -158 -166 15.4574 0.00633
NP_442752.1_4 Forward -381 -374 13.8055 0.0199
NP_442752.1_4 Reverse -372 -379 13.8055 0.0199
NP_442752.1_4 Forward -166 -159 13.8055 0.0199
NP_442752.1_4 Reverse -157 -164 13.8055 0.0199
NP_442752.1_4 Reverse -130 -137 8.20058 0.127
NP_443027.1_4 Reverse -155 -165 14.0414 0.0452
NP_443027.1_4 Reverse -354 -364 10.1081 0.144
NP_443027.1_4 Forward -168 -158 7.35486 0.24
NP_443027.1_4 Reverse -177 -187 7.25653 0.24
NP_443027.1_4 Reverse -342 -352 5.78156 0.298
NP_441812.1_3 Reverse -156 -170 11.406 0.21
NP_442975.1_10 Forward -170 -156 13.2736 0.0459
NP_442975.1_10 Reverse -197 -211 12.9786 0.0459
NP_442975.1_10 Reverse -368 -382 11.307 0.0508
NP_440784.1_7 Forward -380 -373 15.9687 0.0123
NP_440784.1_7 Reverse -373 -380 15.9687 0.0123
NP_440784.1_7 Forward -165 -158 15.9687 0.0123
NP_440784.1_7 Reverse -158 -165 15.9687 0.0123
NP_442909.1_7 Reverse -373 -387 12.0937 0.131
NP_442909.1_7 Forward -380 -366 6.19383 0.255
NP_441093.1_6 Forward -48 -29 21.629 0.0638
NP_440061.1_9 Forward -141 -127 10.3237 0.126
NP_440061.1_9 Forward -355 -341 6.48882 0.244
NP_441476.1_5 Reverse -367 -386 -5.01543 0.26
NP_439979.1_2 Reverse -356 -375 11.4058 0.192
NP_442062.1_8 Forward -381 -371 17.6796 0.00193
NP_442062.1_8 Reverse -157 -167 17.6796 0.00193
NP_442062.1_8 Reverse -372 -382 17.3846 0.00193
NP_442062.1_8 Forward -166 -156 17.3846 0.00193
NP_442062.1_8 Reverse -356 -366 11.1898 0.0493
NP_442062.1_8 Reverse -344 -354 4.79825 0.198
NP_442062.1_8 Forward -59 -49 4.50326 0.212
NP_441859.1_3 Forward -382 -363 11.405 0.109
NP_440304.1_4 Forward -168 -158 18.9579 0.00406
NP_440304.1_4 Reverse -155 -165 10.8948 0.051
NP_440304.1_4 Reverse -370 -380 9.91146 0.051
NP_440304.1_4 Forward -126 -116 4.3066 0.271
NP_440304.1_4 Forward -383 -373 1.84832 0.299
NP_442242.1_4 Forward -380 -373 14.3954 0.0124
NP_442242.1_4 Reverse -373 -380 14.3954 0.0124
NP_442242.1_4 Forward -165 -158 14.3954 0.0124
NP_442242.1_4 Reverse -158 -165 14.3954 0.0124
NP_440044.1_8 Forward -165 -146 15.3391 0.0256
NP_440044.1_8 Reverse -158 -177 -0.0988766 0.21
NP_441781.1_7 Forward -381 -362 9.73422 0.138
NP_442762.1_10 Reverse -118 -137 -10.9153 0.271
NP_439902.1_9 Forward -304 -286 16.0471 0.276
NP_441935.1_2 Forward -136 -117 -5.40875 0.29
NP_441619.1_8 Forward -387 -373 16.8135 0.076
NP_441619.1_8 Reverse -366 -380 7.07881 0.295
NP_441594.1_6 Reverse -363 -382 4.12936 0.222
NP_442276.1_2 Reverse -118 -137 2.85105 0.299
NP_440518.1_8 Reverse -349 -368 10.4217 0.288
NP_442110.1_7 Forward -284 -270 7.76774 0.108
NP_442110.1_7 Forward -166 -152 0.294584 0.264
NP_441082.1_10 Reverse -123 -136 7.98409 0.29
NP_440330.1_2 Forward -71 -52 14.2574 0.251
NP_441083.1_5 Reverse -372 -382 20.3345 0.00053
NP_441083.1_5 Forward -166 -156 20.3345 0.00053
NP_441083.1_5 Forward -381 -371 19.3512 0.000718
NP_441083.1_5 Reverse -157 -167 19.3512 0.000718
NP_441083.1_5 Reverse -344 -354 0.766681 0.218
NP_441434.1_7 Reverse -374 -388 4.71948 0.225
NP_441738.1_2 Forward -379 -372 15.28 0.0102
NP_441738.1_2 Reverse -374 -381 15.28 0.0102
NP_441738.1_2 Forward -164 -157 15.28 0.0102
NP_441738.1_2 Reverse -159 -166 15.28 0.0102
NP_441558.1_5 Reverse -342 -361 12.7825 0.0663
NP_441558.1_5 Forward -190 -171 9.83255 0.112
NP_441558.1_5 Reverse -370 -389 4.22769 0.286
NP_440209.1_1 Reverse -372 -380 18.1123 0.00295
NP_440209.1_1 Reverse -157 -165 18.1123 0.00295
NP_440209.1_1 Forward -381 -373 18.1123 0.00295
NP_440209.1_1 Forward -166 -158 18.1123 0.00295
NP_440209.1_1 Forward -365 -357 5.13263 0.17
NP_442765.1_6 Forward -167 -148 12.5858 0.287
NP_442889.1_8 Reverse -369 -383 19.7634 0.00619
NP_442889.1_8 Forward -169 -155 18.6818 0.0097
NP_440447.1_1 Reverse -351 -369 2.0841 0.285
NP_441770.1_10 Reverse -107 -126 8.16093 0.284
NP_440178.1_7 Reverse -371 -390 -1.96717 0.0334
NP_440178.1_7 Reverse -156 -175 -13.0786 0.129
NP_440178.1_7 Forward -360 -341 -23.2067 0.298
NP_440053.1_9 Forward -251 -232 15.3935 0.293
NP_442570.1_3 Forward -361 -342 4.81767 0.159
NP_442570.1_3 Forward -287 -268 -4.32711 0.23
NP_442445.1_1 Forward -277 -258 23.2056 0.0317
NP_441792.1_5 Reverse -339 -355 8.71166 0.258
NP_441716.1_1 Reverse -157 -171 11.0127 0.0936
NP_441716.1_1 Reverse -350 -364 10.521 0.0951
NP_441716.1_1 Forward -166 -152 4.22782 0.256
NP_441598.1_1 Forward -140 -121 7.57094 0.295
NP_442111.1_4 Forward -382 -368 11.3077 0.0514
NP_442111.1_4 Reverse -371 -385 6.88276 0.11
NP_442111.1_4 Reverse -156 -170 1.86788 0.293
NP_442111.1_4 Forward -354 -340 1.67122 0.296
NP_440906.1_5 Forward -380 -373 15.8704 0.0124
NP_440906.1_5 Reverse -373 -380 15.8704 0.0124
NP_440906.1_5 Forward -165 -158 15.8704 0.0124
NP_440906.1_5 Reverse -158 -165 15.8704 0.0124
NP_440747.1_10 Forward -384 -372 14.887 0.00223
NP_440747.1_10 Reverse -154 -166 7.51213 0.00286
NP_440747.1_10 Reverse -369 -381 5.54551 0.0128
NP_440747.1_10 Forward -169 -157 -1.92764 0.0192
NP_440747.1_10 Reverse -341 -353 -2.4193 0.0434
NP_440747.1_10 Forward -356 -344 -4.68091 0.115
NP_440747.1_10 Reverse -347 -359 -11.7607 0.142
NP_440747.1_10 Forward -68 -56 -11.8591 0.161
NP_440747.1_10 Forward -345 -333 -12.1541 0.227
NP_440747.1_10 Reverse -176 -188 -12.1541 0.227
NP_440747.1_10 Reverse -47 -59 -12.4491 0.282
NP_440747.1_10 Forward -191 -179 -12.5474 0.297
NP_441130.1_10 Reverse -155 -169 8.65272 0.133
NP_441130.1_10 Forward -168 -154 8.06273 0.141
NP_441486.1_1 Reverse -154 -168 21.2391 0.00239
NP_441486.1_1 Forward -384 -370 15.4376 0.00596
NP_441486.1_1 Reverse -369 -383 14.9459 0.00628
NP_441486.1_1 Forward -169 -155 11.996 0.0136
NP_441486.1_1 Forward -62 -48 1.86788 0.0969
NP_442634.1_4 Forward -190 -176 -2.55701 0.153
NP_442634.1_4 Forward -367 -353 -2.95034 0.157
NP_442634.1_4 Forward -168 -154 -3.54032 0.161
NP_441265.1_3 Forward -172 -158 1.96621 0.2
NP_440403.1_4 Reverse -363 -382 -6.09707 0.228
NP_440403.1_4 Reverse -148 -167 -9.83364 0.287
NP_440403.1_10 Reverse -363 -382 8.35759 0.205
NP_440842.1_10 Reverse -127 -141 3.53951 0.255
NP_440842.1_10 Forward -134 -120 2.65453 0.274
NP_441014.1_5 Reverse -328 -346 13.9821 0.2
NP_441014.1_8 Forward -138 -119 -3.63879 0.242
NP_441014.1_10 Reverse -156 -175 3.04693 0.215
NP_442848.1_1 Reverse -151 -165 6.48943 0.0791
NP_442848.1_1 Forward -387 -373 6.09611 0.0803
NP_442848.1_1 Reverse -366 -380 -2.36035 0.263
NP_442848.1_5 Reverse -349 -367 7.29564 0.232
NP_442848.1_9 Reverse -366 -385 2.3594 0.252
NP_441012.1_4 Reverse -52 -65 7.88576 0.272
NP_443018.1_3 Forward -380 -373 14.8871 0.0123
NP_443018.1_3 Reverse -373 -380 14.8871 0.0123
NP_443018.1_3 Forward -165 -158 14.8871 0.0123
NP_443018.1_3 Reverse -158 -165 14.8871 0.0123
NP_443018.1_3 Forward -352 -345 12.5271 0.0523
NP_443018.1_3 Forward -187 -180 12.5271 0.0523
NP_443018.1_3 Reverse -345 -352 12.5271 0.0523
NP_443018.1_3 Reverse -180 -187 12.5271 0.0523
NP_443018.1_3 Reverse -357 -364 11.3472 0.0846
NP_443018.1_3 Forward -14 -7 8.20058 0.153
NP_443018.1_3 Reverse -110 -117 7.6106 0.156
NP_443018.1_3 Forward -58 -51 4.56234 0.241
NP_443018.1_3 Reverse -51 -58 4.46401 0.244
NP_443018.1_3 Forward -364 -357 4.16902 0.278
NP_441316.1_7 Forward -168 -153 -2.47838 0.255
NP_441634.1_1 Reverse -360 -379 -2.95047 0.275
NP_441634.1_8 Reverse -155 -169 2.06454 0.173
NP_441634.1_8 Reverse -48 -62 -2.75368 0.295
NP_441634.1_8 Forward -383 -369 -4.62196 0.295
NP_441634.1_9 Forward -364 -345 10.0284 0.262
NP_440376.1_1 Forward -381 -372 19.4693 0.000692
NP_440376.1_1 Reverse -372 -381 19.4693 0.000692
NP_440376.1_1 Forward -166 -157 19.4693 0.000692
NP_440376.1_1 Reverse -157 -166 19.4693 0.000692
NP_440376.1_1 Forward -353 -344 6.39124 0.1
NP_440376.1_1 Reverse -344 -353 6.39124 0.1
NP_440376.1_1 Forward -359 -350 4.52295 0.156
NP_440376.1_1 Forward -65 -56 4.32629 0.163
NP_440376.1_1 Forward -284 -275 2.26134 0.228
NP_440376.1_1 Forward -342 -333 1.86802 0.238
NP_441588.1_4 Reverse -374 -384 15.9097 0.0369
NP_441588.1_4 Forward -379 -369 9.22315 0.14
NP_441588.1_4 Forward -164 -154 8.63316 0.14
NP_441588.1_4 Reverse -346 -356 5.09324 0.297
NP_442687.1_7 Reverse -371 -381 18.5646 0.0028
NP_442687.1_7 Forward -167 -157 18.5646 0.0028
NP_442687.1_7 Forward -60 -50 10.2065 0.0994
NP_442687.1_7 Forward -382 -372 8.92815 0.0994
NP_442687.1_7 Reverse -156 -166 8.92815 0.0994
NP_442687.1_7 Reverse -250 -260 4.50326 0.245
NP_442687.1_7 Forward -229 -219 3.61828 0.299
NP_442485.1_3 Reverse -361 -380 2.45773 0.209
NP_442946.1_7 Reverse -261 -276 11.9367 0.284
NP_441013.1_3 Forward -284 -265 5.40766 0.291
NP_441388.1_10 Reverse -279 -296 13.2064 0.266
NP_441950.1_7 Forward -365 -346 -1.47551 0.194
NP_442658.1_1 Reverse -370 -380 14.8275 0.0188
NP_442658.1_1 Forward -168 -158 14.8275 0.0188
NP_442658.1_1 Reverse -155 -165 6.76441 0.214
NP_442658.1_1 Forward -383 -373 6.76441 0.214
NP_442658.1_1 Forward -126 -116 5.48612 0.265
NP_442658.1_1 Forward -367 -357 5.38779 0.269
NP_440141.1_4 Forward -362 -343 -6.49039 0.296
NP_440141.1_8 Forward -133 -114 18.9773 0.115
NP_440141.1_8 Reverse -357 -376 8.55425 0.23
NP_442782.1_2 Forward -365 -351 9.63603 0.198
NP_442782.1_2 Forward -188 -174 8.25939 0.198
NP_442782.1_2 Forward -353 -339 0.786239 0.284
NP_442782.1_7 Reverse -149 -168 2.45773 0.193
NP_442205.1_2 Forward -168 -149 12.4199 0.26
NP_440656.1_8 Forward -177 -158 -6.39206 0.244
NP_442544.1_6 Reverse -150 -169 -4.91709 0.265
NP_441414.1_9 Reverse -372 -391 9.14423 0.0248
NP_441414.1_9 Forward -166 -147 -4.6221 0.158
NP_440607.1_3 Forward -317 -298 12.6833 0.253
NP_440607.1_4 Forward -223 -204 6.68596 0.217
NP_440607.1_5 Forward -337 -318 19.9606 0.037
NP_440607.1_8 Forward -280 -261 17.404 0.041
NP_440607.1_9 Forward -256 -237 17.6778 0.243
NP_442937.1_5 Forward -358 -339 9.43923 0.192
NP_442937.1_5 Forward -386 -367 8.75091 0.212
NP_442937.1_5 Reverse -51 -70 8.65258 0.216
NP_442937.1_5 Reverse -367 -386 7.47261 0.251
NP_442321.1_4 Reverse -106 -125 -8.55534 0.289
NP_441958.1_5 Reverse -371 -381 20.5312 0.000966
NP_441958.1_5 Forward -167 -157 20.5312 0.000966
NP_441958.1_5 Forward -382 -372 12.2714 0.00183
NP_441958.1_5 Reverse -156 -166 12.2714 0.00183
NP_441958.1_5 Reverse -343 -353 1.65166 0.0872
NP_441958.1_5 Reverse -129 -139 -2.18325 0.267
NP_442836.1_5 Reverse -366 -385 3.53937 0.23
NP_440443.2_2 Reverse -339 -357 17.0304 0.106
NP_440984.1_7 Reverse -339 -353 6.48943 0.214
NP_441162.1_3 Reverse -118 -137 8.75091 0.254
NP_439990.1_5 Reverse -152 -165 6.70579 0.223
NP_442690.1_1 Forward -46 -27 -16.0285 0.283
NP_442690.1_1 Reverse -25 -44 -16.1268 0.283
NP_442911.1_2 Forward -176 -157 -2.75381 0.102
NP_442911.1_2 Forward -391 -372 -2.95047 0.105
NP_442911.1_2 Reverse -147 -166 -4.91709 0.145
NP_442064.1_4 Forward -363 -344 7.37347 0.242
NP_442064.1_4 Forward -294 -275 4.81688 0.284
NP_443055.1_6 Forward -174 -156 -1.06322 0.271
NP_443055.1_6 Reverse -364 -382 -1.35821 0.277
NP_442210.1_5 Reverse -84 -103 13.2741 0.193
NP_442210.1_9 Reverse -11 -29 9.55725 0.259
NP_440138.1_1 Reverse -179 -197 5.62325 0.292
NP_440138.1_6 Forward -64 -45 6.09517 0.227
NP_441348.1_10 Forward -355 -336 22.9864 0.0378
NP_441099.1_5 Reverse -362 -381 5.60432 0.0469
NP_441099.1_5 Forward -176 -157 -1.67217 0.112
NP_441099.1_5 Forward -391 -372 -10.522 0.256
NP_441099.1_5 Reverse -147 -166 -11.3086 0.276
NP_441099.1_5 Reverse -277 -296 -12.2919 0.299
NP_442002.1_1 Forward -338 -320 -0.472507 0.192
NP_442002.1_9 Reverse -371 -378 14.1004 0.074
NP_442002.1_9 Forward -167 -160 14.1004 0.074
NP_441294.1_7 Reverse -368 -382 19.1375 0.00332
NP_441294.1_7 Forward -170 -156 16.1618 0.0171
NP_441646.1_1 Forward -360 -341 10.6192 0.115
NP_441646.1_1 Forward -388 -369 1.67108 0.23
NP_441646.1_1 Reverse -343 -362 -1.27885 0.281
NP_442438.1_10 Forward -386 -372 4.03116 0.152
NP_442438.1_10 Reverse -152 -166 -0.393733 0.259
NP_441000.1_5 Forward -307 -288 5.70185 0.251
NP_441000.1_6 Reverse -371 -385 -3.93365 0.225
NP_441000.1_6 Forward -167 -153 -3.93365 0.225
NP_441000.1_6 Reverse -156 -170 -4.81863 0.252
NP_440147.1_4 Reverse -370 -383 13.294 0.0326
NP_440147.1_4 Forward -383 -370 11.7207 0.0326
NP_440147.1_4 Forward -355 -342 6.4108 0.0939
NP_440147.1_4 Forward -168 -155 3.95252 0.175
NP_440147.1_4 Reverse -177 -190 3.85419 0.179
NP_440147.1_4 Reverse -155 -168 2.37923 0.208
NP_440147.1_4 Forward -190 -177 1.69091 0.222
NP_441175.1_7 Reverse -372 -391 12.6841 0.115
NP_441550.1_8 Reverse -370 -380 17.6791 0.00754
NP_441550.1_8 Forward -168 -158 15.4175 0.0132
NP_441550.1_8 Forward -383 -373 14.6309 0.0132
NP_441550.1_8 Reverse -155 -165 12.3692 0.0336
NP_441916.1_7 Reverse -157 -167 16.893 0.00407
NP_441916.1_7 Forward -381 -371 16.893 0.00407
NP_441916.1_7 Forward -365 -355 10.8948 0.0261
NP_441916.1_7 Reverse -372 -382 10.3048 0.0261
NP_441916.1_7 Forward -166 -156 10.3048 0.0261
NP_441916.1_7 Reverse -50 -60 6.56821 0.0919
NP_441916.1_7 Forward -353 -343 6.37155 0.0988
NP_441916.1_7 Forward -188 -178 4.3066 0.182
NP_441916.1_10 Reverse -127 -146 1.86774 0.259
NP_441916.1_10 Reverse -342 -361 0.491109 0.281
NP_440206.1_4 Reverse -340 -359 0.785326 0.289
NP_440206.1_4 Reverse -346 -365 -2.16459 0.293
NP_441041.1_4 Reverse -372 -391 -3.44213 0.122
NP_441041.1_4 Forward -365 -346 -4.91709 0.145
NP_441041.1_4 Forward -359 -340 -8.16202 0.197
NP_441041.1_4 Forward -284 -265 -9.83364 0.223
NP_441041.1_4 Reverse -344 -363 -12.2919 0.262
NP_441041.1_4 Reverse -157 -176 -12.5869 0.269
NP_441041.1_4 Forward -381 -362 -12.8819 0.276
NP_441041.1_4 Forward -272 -253 -12.8819 0.276
NP_441041.1_7 Reverse -369 -381 21.314 0.00104
NP_441041.1_7 Forward -169 -157 13.2483 0.049
NP_442396.1_5 Forward -385 -372 20.1771 0.00762
NP_442396.1_5 Reverse -153 -166 9.16406 0.13
NP_440569.1_6 Forward -377 -358 0.982764 0.3
NP_441547.1_2 Reverse -146 -164 7.00065 0.215
NP_441547.1_2 Forward -177 -159 3.3624 0.288
NP_442004.1_6 Reverse -372 -386 8.55439 0.14
NP_442004.1_6 Forward -365 -351 8.06273 0.149
NP_440703.1_9 Reverse -350 -363 4.93527 0.293
NP_441725.1_4 Reverse -282 -296 5.50552 0.278
NP_441725.1_5 Reverse -158 -168 21.0229 0.00533
NP_441725.1_5 Forward -380 -370 11.7798 0.0247
NP_441725.1_5 Forward -165 -155 11.2881 0.0247
NP_441725.1_5 Reverse -116 -126 4.79825 0.115
NP_441725.1_5 Reverse -373 -383 2.04498 0.115
NP_439966.1_7 Reverse -155 -165 15.8108 0.0124
NP_439966.1_7 Forward -168 -158 9.12434 0.119
NP_439966.1_7 Forward -383 -373 7.25606 0.15
NP_439966.1_7 Forward -61 -51 5.09279 0.243
NP_439966.1_7 Forward -17 -7 4.7978 0.258
NP_442941.1_3 Forward -165 -155 19.9412 0.00262
NP_442941.1_3 Reverse -158 -168 11.3864 0.0116
NP_442941.1_3 Reverse -373 -383 11.0914 0.0116
NP_442941.1_3 Forward -380 -370 2.53664 0.14
NP_442941.1_3 Forward -352 -342 -0.314959 0.256
NP_442941.1_3 Reverse -180 -190 -0.314959 0.256
NP_440289.1_2 Forward -169 -156 22.6354 0.00258
NP_440289.1_2 Reverse -154 -167 16.1456 0.00946
NP_440289.1_2 Reverse -369 -382 13.884 0.0123
NP_440289.1_2 Forward -384 -371 -2.144 0.251
NP_440983.1_5 Reverse -344 -363 -2.36049 0.231
NP_440260.1_8 Forward -362 -344 9.75391 0.151
NP_440260.1_8 Forward -390 -372 4.14905 0.154
NP_440260.1_8 Reverse -363 -381 -7.06068 0.295
NP_442281.1_1 Reverse -367 -381 21.6317 0.00192
NP_442281.1_1 Reverse -152 -166 16.9119 0.00698
NP_442281.1_1 Forward -171 -157 12.5853 0.0358
NP_442281.1_1 Reverse -174 -188 11.9953 0.0418
NP_442281.1_1 Reverse -351 -365 9.34041 0.0717
NP_442281.1_1 Forward -193 -179 7.17714 0.106
NP_442281.1_1 Reverse -339 -353 3.04726 0.246
NP_442281.1_1 Forward -358 -344 2.06395 0.278
NP_442281.1_1 Forward -20 -6 2.06395 0.278
NP_442847.1_3 Reverse -322 -341 3.44025 0.299
NP_440177.1_9 Forward -389 -370 17.2074 0.165
NP_442256.1_2 Forward -168 -150 -9.71562 0.288
NP_440437.1_1 Forward -172 -153 2.85105 0.127
NP_440437.1_1 Reverse -324 -343 -1.37718 0.201
NP_442012.1_1 Forward -387 -368 0.58944 0.235
NP_442012.1_5 Forward -360 -341 -0.295539 0.288
NP_441087.1_6 Reverse -218 -236 0.608397 0.258
NP_440723.1_4 Forward -282 -263 -2.36049 0.234
NP_440498.1_1 Forward -68 -50 -2.73412 0.245
NP_442982.1_5 Reverse -334 -353 -1.96717 0.28
NP_440375.1_8 Reverse -373 -392 -0.4922 0.266
NP_443030.1_4 Forward -366 -347 -7.86702 0.299
NP_441644.1_6 Reverse -372 -382 17.3841 0.00127
NP_441644.1_6 Forward -166 -156 17.3841 0.00127
NP_441644.1_6 Forward -381 -371 15.7125 0.0048
NP_441644.1_6 Reverse -157 -167 15.7125 0.0048
NP_441644.1_6 Forward -353 -343 15.6142 0.00525
NP_441644.1_6 Reverse -344 -354 13.9425 0.0156
NP_441644.1_6 Reverse -179 -189 11.5826 0.0463
NP_441644.1_6 Reverse -56 -66 9.71433 0.0705
NP_441644.1_6 Reverse -109 -119 9.02601 0.0872
NP_441644.1_6 Reverse -219 -229 8.92768 0.0895
NP_441644.1_6 Forward -188 -178 6.17443 0.165
NP_442215.1_2 Forward -383 -367 18.9381 0.0112
NP_442215.1_2 Forward -197 -181 -1.80975 0.189
NP_442215.1_2 Reverse -155 -171 -1.80975 0.189
NP_442215.1_2 Forward -355 -339 -3.18639 0.211
NP_442215.1_2 Reverse -370 -386 -3.77637 0.222
NP_442215.1_2 Reverse -113 -129 -4.36636 0.232
NP_442215.1_2 Reverse -335 -351 -5.54633 0.251
NP_442215.1_2 Forward -168 -152 -6.33298 0.268
NP_442177.1_5 Forward -281 -267 10.0294 0.234
NP_442177.1_5 Forward -362 -348 9.43936 0.239
NP_442029.1_6 Forward -358 -339 22.6156 0.0112
NP_442029.1_6 Forward -182 -163 4.42435 0.268
NP_440253.1_2 Reverse -157 -175 13.4905 0.0221
NP_440253.1_2 Forward -166 -148 6.70565 0.0778
NP_440929.1_8 Forward -381 -372 19.2726 0.000701
NP_440929.1_8 Reverse -372 -381 19.2726 0.000701
NP_440929.1_8 Forward -166 -157 19.2726 0.000701
NP_440929.1_8 Reverse -157 -166 19.2726 0.000701
NP_440929.1_8 Reverse -275 -284 2.06468 0.268
NP_442933.1_10 Forward -381 -372 17.601 0.00325
NP_442933.1_10 Reverse -372 -381 17.601 0.00325
NP_442933.1_10 Forward -166 -157 17.601 0.00325
NP_442933.1_10 Reverse -157 -166 17.601 0.00325
NP_442933.1_10 Forward -365 -356 11.7994 0.0339
NP_442933.1_10 Reverse -344 -353 4.42462 0.246
NP_442933.1_10 Reverse -179 -188 4.42462 0.246
NP_442933.1_10 Reverse -50 -59 4.42462 0.246
NP_442933.1_10 Forward -353 -344 4.42462 0.246
NP_442933.1_10 Forward -188 -179 4.42462 0.246
NP_441751.2_8 Forward -165 -151 12.8809 0.0186
NP_441751.2_8 Forward -380 -366 5.89945 0.0407
NP_441751.2_8 Reverse -158 -172 3.24451 0.0692
NP_441751.2_8 Reverse -180 -194 1.67122 0.101
NP_441751.2_8 Reverse -373 -387 -2.26202 0.132
NP_441751.2_8 Forward -364 -350 -5.50694 0.214
NP_442554.1_8 Forward -165 -155 15.9097 0.00747
NP_442554.1_8 Reverse -373 -383 15.3197 0.00882
NP_442554.1_8 Forward -352 -342 15.123 0.00944
NP_442554.1_8 Reverse -158 -168 14.828 0.0108
NP_442554.1_8 Forward -380 -370 14.238 0.0144
NP_442554.1_8 Reverse -180 -190 14.0414 0.0145
NP_442554.1_8 Reverse -345 -355 13.1564 0.0193
NP_442554.1_8 Reverse -366 -376 6.07655 0.126
NP_442554.1_8 Forward -187 -177 5.48657 0.146
NP_442554.1_8 Reverse -51 -61 3.51995 0.222
NP_442554.1_8 Reverse -357 -367 2.7333 0.259
NP_441762.1_7 Reverse -371 -383 8.9871 0.0142
NP_441762.1_7 Forward -167 -155 1.7106 0.0735
NP_441762.1_7 Forward -382 -370 0.333971 0.0747
NP_441762.1_7 Reverse -156 -168 -6.94252 0.284
NP_441762.1_7 Reverse -355 -367 -7.53251 0.293
NP_442142.1_4 Forward -169 -156 13.8833 0.0324
NP_442142.1_4 Reverse -341 -354 11.4251 0.0567
NP_442142.1_4 Reverse -369 -382 10.6384 0.0697
NP_442142.1_4 Forward -191 -178 9.75346 0.0873
NP_442142.1_4 Reverse -154 -167 7.49186 0.137
NP_442142.1_4 Reverse -353 -366 6.31189 0.169
NP_442142.1_4 Reverse -176 -189 4.54195 0.217
NP_442292.1_1 Forward -165 -156 18.486 0.00229
NP_442292.1_1 Reverse -373 -382 18.486 0.00229
NP_442292.1_1 Forward -380 -371 9.53783 0.0183
NP_442292.1_1 Reverse -158 -167 9.53783 0.0183
NP_442292.1_1 Reverse -345 -354 5.80125 0.129
NP_442292.1_1 Reverse -180 -189 5.80125 0.129
NP_442292.1_1 Forward -352 -343 4.81794 0.17
NP_440919.1_1 Reverse -125 -144 -8.26035 0.287
NP_442143.1_3 Reverse -51 -70 2.65439 0.244
NP_442476.1_6 Reverse -373 -387 6.98109 0.116
NP_442476.1_6 Forward -165 -151 3.24451 0.161
NP_443009.1_5 Reverse -156 -167 15.7911 0.0107
NP_443009.1_5 Forward -382 -371 15.7911 0.0107
NP_443009.1_5 Reverse -371 -382 11.1696 0.066
NP_443009.1_5 Forward -167 -156 11.1696 0.066
NP_443009.1_5 Reverse -355 -366 3.8931 0.274
NP_442408.2_1 Reverse -116 -135 -6.68705 0.285
NP_441715.1_4 Forward -165 -155 14.828 0.0268
NP_441715.1_4 Reverse -373 -383 7.94484 0.107
NP_441715.1_4 Reverse -158 -168 7.25653 0.108
NP_440183.1_1 Forward -380 -361 8.84924 0.244
NP_440183.1_9 Reverse -358 -377 -9.34199 0.226
NP_440183.1_9 Reverse -181 -200 -12.1936 0.256
NP_440183.1_9 Forward -379 -360 -14.6519 0.267
NP_441198.1_8 Forward -168 -158 13.076 0.108
NP_441198.1_8 Reverse -370 -380 12.5877 0.12
NP_440464.1_10 Reverse -373 -383 13.0082 0.169
NP_441468.1_1 Forward -380 -373 15.8704 0.0124
NP_441468.1_1 Reverse -373 -380 15.8704 0.0124
NP_441468.1_1 Forward -165 -158 15.8704 0.0124
NP_441468.1_1 Reverse -158 -165 15.8704 0.0124
NP_441468.1_1 Reverse -345 -352 3.97235 0.277
NP_441468.1_1 Reverse -180 -187 3.97235 0.277
NP_441468.1_1 Reverse -51 -58 3.97235 0.277
NP_441468.1_1 Forward -364 -357 3.97235 0.277
NP_441468.1_1 Forward -352 -345 3.97235 0.277
NP_441468.1_1 Forward -187 -180 3.97235 0.277
NP_441020.2_6 Reverse -370 -387 6.62702 0.26
NP_441020.2_6 Forward -383 -366 6.33202 0.267
NP_441015.1_10 Forward -358 -339 0.687771 0.165
NP_441015.1_10 Reverse -360 -379 -6.88371 0.258
NP_441673.1_1 Forward -381 -372 20.8459 0.000698
NP_441673.1_1 Reverse -372 -381 20.8459 0.000698
NP_441673.1_1 Forward -166 -157 20.8459 0.000698
NP_441673.1_1 Reverse -157 -166 20.8459 0.000698
NP_441673.1_1 Forward -353 -344 1.27803 0.155
NP_441673.1_1 Reverse -344 -353 1.27803 0.155
NP_441731.1_3 Forward -196 -177 -0.295539 0.283
NP_441826.1_2 Reverse -366 -380 12.4876 0.0272
NP_441826.1_2 Reverse -151 -165 3.14618 0.115
NP_441826.1_2 Reverse -109 -123 0.786239 0.172
NP_441826.1_2 Reverse -344 -358 -3.54032 0.286
NP_441826.1_2 Forward -172 -158 -4.32697 0.295
NP_441330.1_1 Reverse -339 -358 5.70265 0.0297
NP_441330.1_9 Reverse -80 -99 9.73422 0.289
NP_442490.1_9 Reverse -344 -363 -7.76869 0.278
NP_442868.1_6 Reverse -155 -165 9.91146 0.038
NP_442868.1_6 Forward -383 -373 9.81313 0.038
NP_442868.1_6 Forward -168 -158 9.22315 0.0527
NP_442868.1_6 Reverse -370 -380 9.12481 0.0539
NP_442868.1_6 Forward -190 -180 -0.118297 0.264
NP_441612.1_2 Reverse -350 -360 8.6461 0.21
NP_441612.1_2 Reverse -372 -382 8.54929 0.21
NP_441612.1_2 Forward -166 -156 8.54929 0.21
NP_442227.1_2 Reverse -111 -130 4.12936 0.208
NP_442427.1_8 Forward -175 -156 11.0125 0.155
NP_442808.1_1 Reverse -371 -381 8.73102 0.0481
NP_442808.1_1 Forward -167 -157 8.73102 0.0481
NP_442808.1_1 Reverse -156 -166 8.63269 0.0481
NP_442808.1_1 Forward -382 -372 8.63269 0.0481
NP_442808.1_1 Forward -60 -50 4.50281 0.197
NP_442808.1_1 Reverse -349 -359 3.22451 0.247
NP_440871.1_3 Forward -56 -42 16.002 0.166
NP_440145.1_3 Forward -391 -372 17.3057 0.00972
NP_440145.1_3 Forward -176 -157 -0.885524 0.144
NP_440145.1_3 Reverse -169 -188 -3.24547 0.192
NP_442542.1_2 Forward -168 -155 12.999 0.114
NP_442050.1_5 Reverse -155 -165 16.4991 0.00812
NP_442050.1_5 Forward -168 -158 15.8108 0.0091
NP_442050.1_5 Forward -383 -373 7.64939 0.243
NP_442050.1_5 Reverse -273 -283 7.25606 0.265
NP_442050.1_5 Reverse -370 -380 6.96107 0.27
NP_440558.1_2 Reverse -341 -360 6.88262 0.127
NP_440558.1_2 Reverse -347 -366 3.04771 0.162
NP_440558.1_2 Reverse -260 -279 0.786102 0.185
NP_440558.1_2 Reverse -182 -201 -4.32711 0.244
NP_440558.1_2 Forward -62 -43 -6.29373 0.273
NP_440558.1_2 Reverse -176 -195 -6.98204 0.284
NP_441878.1_6 Reverse -371 -381 20.2362 0.0046
NP_441878.1_6 Forward -167 -157 20.2362 0.0046
NP_441878.1_6 Reverse -343 -353 10.5014 0.0176
NP_441878.1_6 Forward -382 -372 10.4031 0.0176
NP_441878.1_6 Forward -354 -344 10.4031 0.0176
NP_441878.1_6 Reverse -156 -166 10.4031 0.0176
NP_441878.1_6 Reverse -178 -188 0.766681 0.134
NP_441878.1_6 Forward -189 -179 0.57002 0.14
NP_441878.1_6 Forward -360 -350 -6.8048 0.196
NP_441878.1_6 Forward -125 -115 -7.39479 0.222
NP_441878.1_6 Reverse -49 -59 -7.59145 0.245
NP_441878.1_6 Reverse -129 -139 -7.78811 0.266
NP_441878.1_6 Forward -66 -56 -7.98478 0.285
NP_441036.1_8 Reverse -371 -381 8.4365 0.174
NP_441036.1_8 Forward -167 -157 8.4365 0.174
NP_441036.1_8 Forward -382 -372 8.33817 0.174
NP_441036.1_8 Reverse -156 -166 8.33817 0.174
NP_441557.1_5 Forward -381 -372 19.9609 0.000699
NP_441557.1_5 Reverse -372 -381 19.9609 0.000699
NP_441557.1_5 Forward -166 -157 19.9609 0.000699
NP_441557.1_5 Reverse -157 -166 19.9609 0.000699
NP_441557.1_5 Forward -353 -344 0.393051 0.166
NP_441557.1_5 Reverse -344 -353 0.393051 0.166
NP_441557.1_5 Forward -365 -356 -0.885252 0.26
NP_441557.1_5 Forward -188 -179 -0.885252 0.26
NP_441557.1_5 Forward -59 -50 -0.885252 0.26
NP_441557.1_8 Forward -136 -126 14.0409 0.201
NP_441445.1_1 Forward -175 -156 11.0125 0.0895
NP_441445.1_1 Reverse -148 -167 1.27776 0.259
NP_441445.1_1 Forward -213 -194 1.27776 0.259
NP_441445.1_1 Reverse -363 -382 0.884433 0.266
NP_441445.1_1 Forward -368 -349 -0.0988766 0.286
NP_441590.1_4 Reverse -340 -359 9.53674 0.249
NP_441590.1_4 Reverse -352 -371 2.26028 0.296
NP_442066.2_4 Forward -381 -362 -4.72043 0.234
NP_442066.2_9 Reverse -153 -166 9.06573 0.181
NP_441433.1_2 Reverse -347 -366 16.3224 0.234
NP_441433.1_8 Reverse -124 -143 2.94938 0.208
NP_441433.1_8 Forward -138 -119 -0.590531 0.248
NP_440084.1_3 Forward -287 -268 12.8808 0.292
NP_440101.1_10 Forward -359 -340 5.30933 0.208
NP_441458.1_10 Reverse -47 -66 7.86593 0.192
NP_442183.1_1 Forward -166 -152 19.8624 0.0054
NP_442183.1_1 Forward -381 -367 11.3077 0.0724
NP_442183.1_1 Reverse -157 -171 9.14437 0.101
NP_442183.1_9 Reverse -9 -19 11.3864 0.206
NP_442397.1_9 Forward -381 -362 1.76941 0.283
NP_442397.1_9 Reverse -343 -362 1.17943 0.291
NP_441574.1_1 Forward -365 -346 16.8141 0.0511
NP_440058.1_7 Forward -386 -367 7.37428 0.247
NP_441549.1_9 Reverse -153 -171 -6.07737 0.198
NP_442632.1_1 Forward -137 -118 17.0099 0.221
NP_442347.1_2 Reverse -373 -382 12.4878 0.056
NP_442347.1_2 Forward -165 -156 12.4878 0.056
NP_442347.1_2 Forward -380 -371 3.34298 0.284
NP_442347.1_2 Reverse -158 -167 3.34298 0.284
NP_442645.1_2 Forward -389 -370 25.8605 0.000248
NP_441037.1_4 Reverse -370 -380 17.3558 0.0127
NP_441037.1_4 Forward -168 -158 9.65667 0.21
NP_441037.1_4 Forward -383 -373 7.9999 0.237
NP_442594.1_7 Reverse -146 -165 5.40686 0.243
NP_442594.1_8 Reverse -9 -28 3.93269 0.274
NP_441633.1_3 Forward -383 -370 10.639 0.0286
NP_441633.1_3 Reverse -155 -168 3.36254 0.0699
NP_441633.1_3 Reverse -370 -383 -5.97891 0.236
NP_440136.1_2 Forward -380 -373 15.9687 0.0123
NP_440136.1_2 Reverse -373 -380 15.9687 0.0123
NP_440136.1_2 Forward -165 -158 15.9687 0.0123
NP_440136.1_2 Reverse -158 -165 15.9687 0.0123
NP_442590.1_10 Forward -381 -362 7.86593 0.218
NP_442590.1_10 Forward -365 -346 4.32602 0.276
NP_442998.1_10 Forward -379 -372 15.5754 0.0102
NP_442998.1_10 Reverse -374 -381 15.5754 0.0102
NP_442998.1_10 Forward -164 -157 15.5754 0.0102
NP_442998.1_10 Reverse -159 -166 15.5754 0.0102
NP_442998.1_10 Reverse -52 -59 4.16902 0.259
NP_442998.1_10 Reverse -277 -284 4.07068 0.276
NP_440299.1_1 Forward -385 -372 18.9965 0.00298
NP_440299.1_1 Forward -357 -344 11.9167 0.0427
NP_440299.1_1 Reverse -368 -381 10.8351 0.0529
NP_440299.1_1 Reverse -346 -359 8.86849 0.0835
NP_440299.1_1 Reverse -111 -124 7.09854 0.121
NP_440299.1_1 Reverse -352 -365 4.64028 0.205
NP_440299.1_1 Reverse -153 -166 4.34528 0.209
NP_440299.1_1 Forward -63 -50 4.05029 0.221
NP_440299.1_1 Reverse -52 -65 2.47701 0.288
NP_441799.1_1 Forward -170 -156 11.012 0.0629
NP_441799.1_1 Forward -385 -371 8.25877 0.12
NP_441799.1_1 Reverse -368 -382 7.96378 0.128
NP_441799.1_1 Reverse -340 -354 6.0955 0.183
NP_441799.1_1 Reverse -153 -167 5.70218 0.197
NP_441799.1_1 Forward -63 -49 4.42388 0.25
NP_441799.1_1 Forward -192 -178 4.22722 0.261
NP_441799.1_1 Reverse -175 -189 3.93223 0.274
NP_441007.1_10 Reverse -152 -165 9.95071 0.0804
NP_441007.1_10 Forward -386 -373 1.10092 0.209
NP_441007.1_10 Reverse -367 -380 0.60927 0.221
NP_441007.1_10 Forward -193 -180 -0.964025 0.296
NP_442334.1_2 Reverse -362 -379 -12.7442 0.297
NP_441449.1_8 Forward -251 -232 13.5013 0.286
NP_442333.2_5 Reverse -361 -380 -13.7669 0.265
NP_440256.1_1 Reverse -154 -173 -4.32711 0.152
NP_440256.1_1 Forward -169 -150 -5.11376 0.174
NP_440256.1_1 Reverse -353 -372 -5.40875 0.182
NP_440256.1_1 Forward -191 -172 -5.50708 0.184
NP_440256.1_1 Forward -384 -365 -9.44032 0.28
NP_440256.1_1 Reverse -369 -388 -10.1286 0.295
NP_441229.1_10 Forward -391 -372 11.0125 0.147
NP_441512.1_4 Reverse -340 -359 11.8975 0.237
NP_441559.1_8 Reverse -339 -353 -1.18038 0.181
NP_441559.1_8 Forward -364 -350 -6.09693 0.274
NP_441270.1_5 Reverse -5 -24 14.1654 0.211
NP_440915.1_6 Forward -385 -371 8.45605 0.0543
NP_440915.1_6 Reverse -368 -382 6.29277 0.0828
NP_440915.1_6 Reverse -153 -167 2.65453 0.113
NP_440915.1_6 Forward -357 -343 1.96621 0.128
NP_440915.1_6 Reverse -340 -354 -2.65535 0.278
NP_440915.1_6 Forward -170 -156 -3.147 0.29
NP_441179.1_9 Forward -61 -51 13.9425 0.246
NP_442866.1_1 Forward -386 -367 -7.67036 0.268
NP_440748.1_5 Forward -378 -359 -1.37718 0.267
NP_440748.1_5 Reverse -266 -285 -3.3438 0.296
NP_441464.1_8 Reverse -157 -171 9.04604 0.192
NP_441464.1_8 Forward -381 -367 5.89945 0.248
NP_441464.1_8 Reverse -372 -386 4.52282 0.269
NP_440026.1_7 Reverse -339 -354 16.6962 0.159
NP_442993.1_1 Reverse -157 -173 1.33684 0.0555
NP_442993.1_1 Forward -166 -150 -9.18458 0.179
NP_442993.1_1 Forward -266 -250 -10.3645 0.217
NP_442993.1_1 Forward -365 -349 -11.1512 0.235
NP_442993.1_1 Forward -118 -102 -11.4462 0.247
NP_442993.1_1 Reverse -50 -66 -12.9212 0.282
NP_440677.1_1 Reverse -363 -382 13.9625 0.129
NP_440677.1_6 Reverse -70 -89 9.3409 0.27
NP_442386.1_9 Reverse -156 -165 13.8639 0.0289
NP_442386.1_9 Forward -382 -373 13.8639 0.0289
NP_442386.1_9 Forward -354 -345 10.324 0.132
NP_442386.1_9 Forward -189 -180 10.324 0.132
NP_442386.1_9 Reverse -371 -380 6.39082 0.219
NP_442386.1_9 Forward -167 -158 6.39082 0.219
NP_442386.1_9 Forward -60 -51 4.81753 0.282
NP_440570.1_5 Reverse -340 -359 1.47442 0.238
NP_440570.1_5 Forward -363 -344 0.687771 0.254
NP_441340.1_5 Forward -380 -373 15.6737 0.0124
NP_441340.1_5 Reverse -373 -380 15.6737 0.0124
NP_441340.1_5 Forward -165 -158 15.6737 0.0124
NP_441340.1_5 Reverse -158 -165 15.6737 0.0124
NP_441340.1_5 Forward -58 -51 11.0522 0.0749
NP_441340.1_5 Reverse -357 -364 4.07068 0.239
NP_441340.1_5 Reverse -345 -352 4.07068 0.239
NP_441340.1_5 Reverse -180 -187 4.07068 0.239
NP_441340.1_5 Forward -352 -345 4.07068 0.239
NP_441340.1_5 Forward -187 -180 4.07068 0.239
NP_441947.1_4 Forward -376 -357 17.0107 0.106
NP_442484.1_2 Forward -364 -345 7.27595 0.156
NP_440168.1_2 Reverse -255 -274 3.04771 0.276
NP_440327.1_6 Forward -284 -265 6.09597 0.249
NP_440327.1_6 Reverse -288 -307 3.83436 0.279
NP_440327.1_6 Reverse -112 -131 2.65439 0.292
NP_440194.1_3 Forward -391 -372 0.982764 0.277
NP_440161.1_3 Forward -168 -149 8.84924 0.264
NP_440586.1_1 Forward -369 -350 -5.31042 0.285
NP_440586.1_8 Forward -380 -373 13.2151 0.026
NP_440586.1_8 Forward -165 -158 13.2151 0.026
NP_440586.1_8 Reverse -373 -380 13.2151 0.026
NP_440586.1_8 Reverse -158 -165 13.2151 0.026
NP_440586.1_8 Reverse -357 -364 12.8218 0.0395
NP_440586.1_8 Forward -14 -7 9.08521 0.178
NP_440586.1_8 Forward -352 -345 7.61025 0.227
NP_440586.1_8 Forward -187 -180 7.61025 0.227
NP_440586.1_8 Reverse -345 -352 7.61025 0.227
NP_440586.1_8 Reverse -180 -187 7.61025 0.227
NP_442251.1_6 Forward -380 -373 15.2804 0.0124
NP_442251.1_6 Reverse -373 -380 15.2804 0.0124
NP_442251.1_6 Forward -165 -158 15.2804 0.0124
NP_442251.1_6 Reverse -158 -165 15.2804 0.0124
NP_440684.1_9 Reverse -366 -380 19.1741 0.0286
NP_440684.1_9 Reverse -151 -165 9.73436 0.216
NP_440684.1_9 Forward -387 -373 6.6861 0.294
NP_441262.1_3 Reverse -372 -379 14.7888 0.0223
NP_441262.1_3 Reverse -157 -164 14.7888 0.0223
NP_441262.1_3 Forward -381 -374 14.7888 0.0223
NP_441262.1_3 Forward -166 -159 14.7888 0.0223
NP_440027.1_3 Reverse -350 -368 3.95163 0.263
NP_443051.1_1 Reverse -371 -380 18.0926 0.00402
NP_443051.1_1 Forward -167 -158 18.0926 0.00402
NP_443051.1_1 Reverse -156 -165 10.4228 0.00754
NP_443051.1_1 Forward -382 -373 10.4228 0.00754
NP_443051.1_1 Reverse -343 -352 -0.000272808 0.245
NP_441232.1_10 Forward -392 -373 0.687771 0.296
NP_439937.1_4 Forward -359 -340 10.6192 0.274
NP_439937.1_8 Reverse -345 -364 1.37609 0.229
NP_439937.1_9 Forward -167 -150 -14.9081 0.287
NP_439937.1_9 Reverse -156 -173 -15.1047 0.287
NP_440408.1_7 Reverse -73 -92 9.3409 0.262
NP_440408.1_7 Reverse -344 -363 7.07928 0.292
NP_440439.1_1 Reverse -154 -167 2.08423 0.138
NP_440439.1_1 Forward -327 -314 0.117615 0.202
NP_439943.1_1 Forward -359 -340 -10.0303 0.29
NP_439943.1_7 Forward -358 -339 15.0441 0.0929
NP_440372.1_2 Forward -380 -373 16.3621 0.0124
NP_440372.1_2 Reverse -373 -380 16.3621 0.0124
NP_440372.1_2 Forward -165 -158 16.3621 0.0124
NP_440372.1_2 Reverse -158 -165 16.3621 0.0124
NP_440271.1_2 Forward -74 -55 1.17943 0.284
NP_440271.1_2 Reverse -291 -310 1.0811 0.284
NP_440819.1_5 Forward -237 -229 7.8859 0.266
NP_440316.1_10 Reverse -343 -353 6.27322 0.264
NP_441803.1_2 Reverse -110 -129 3.24438 0.194
NP_441803.1_2 Reverse -345 -364 1.67108 0.228
NP_441803.1_2 Reverse -180 -199 -0.983855 0.293
NP_439977.1_5 Forward -387 -368 2.55606 0.171
NP_440139.1_1 Forward -172 -153 10.0284 0.0938
NP_441572.1_7 Reverse -366 -385 -1.37718 0.188
NP_440267.1_2 Reverse -174 -188 11.7003 0.125
NP_440267.1_2 Reverse -339 -353 8.75042 0.162
NP_440267.1_2 Forward -171 -157 7.47213 0.196
NP_442887.1_5 Forward -367 -348 -14.4552 0.294
NP_442384.1_10 Reverse -372 -385 16.7355 0.00732
NP_442384.1_10 Forward -381 -368 10.639 0.0428
NP_442384.1_10 Forward -166 -153 8.18076 0.0685
NP_442384.1_10 Forward -353 -340 7.29578 0.0844
NP_442384.1_10 Reverse -344 -357 7.09911 0.0875
NP_442384.1_10 Forward -65 -52 6.4108 0.102
NP_442384.1_10 Reverse -50 -63 4.34585 0.16
NP_442384.1_10 Reverse -157 -170 1.69091 0.249
NP_442384.1_10 Reverse -315 -328 1.49425 0.257
NP_442384.1_10 Reverse -179 -192 0.510939 0.289
NP_440364.1_6 Forward -375 -362 13.8833 0.275
NP_441018.1_7 Forward -282 -263 11.8975 0.173
NP_441018.1_7 Forward -391 -372 10.3242 0.209
NP_441018.1_7 Forward -363 -344 9.93088 0.218
NP_441018.1_7 Forward -369 -350 8.25926 0.253
NP_441018.1_7 Forward -357 -338 7.47261 0.269
NP_442790.1_4 Reverse -363 -382 -5.80207 0.144
NP_442790.1_4 Forward -197 -178 -9.44032 0.184
NP_442262.1_10 Forward -380 -373 14.1988 0.0123
NP_442262.1_10 Reverse -373 -380 14.1988 0.0123
NP_442262.1_10 Forward -165 -158 14.1988 0.0123
NP_442262.1_10 Reverse -158 -165 14.1988 0.0123
NP_442262.1_10 Forward -352 -345 10.4622 0.145
NP_442262.1_10 Forward -187 -180 10.4622 0.145
NP_442262.1_10 Reverse -345 -352 10.4622 0.145
NP_442262.1_10 Reverse -180 -187 10.4622 0.145
NP_442262.1_10 Reverse -357 -364 10.3639 0.153
NP_442262.1_10 Forward -14 -7 9.38056 0.202
NP_442262.1_10 Reverse -110 -117 8.8889 0.219
NP_442262.1_10 Forward -58 -51 7.90559 0.266
NP_441689.1_5 Reverse -155 -165 15.3192 0.0403
NP_441689.1_5 Forward -168 -158 8.63269 0.132
NP_441689.1_5 Forward -383 -373 5.78111 0.197
NP_440163.1_10 Reverse -154 -164 11.3864 0.169
NP_440344.1_10 Reverse -365 -382 15.6735 0.00443
NP_440344.1_10 Forward -173 -156 10.2653 0.00725
NP_440344.1_10 Reverse -150 -167 1.61214 0.0304
NP_440282.1_3 Reverse -345 -364 -4.81876 0.298
NP_440282.1_10 Reverse -346 -365 8.94757 0.11
NP_440282.1_10 Forward -69 -50 3.93269 0.125
NP_440282.1_10 Forward -363 -344 -6.98204 0.251
NP_440282.1_10 Reverse -362 -381 -7.08038 0.251
NP_440531.1_6 Reverse -364 -383 0.687771 0.19
NP_440531.1_8 Reverse -81 -100 1.96607 0.298
NP_442910.1_1 Reverse -365 -384 11.7008 0.0484
NP_442910.1_1 Reverse -150 -169 -7.27704 0.254
NP_441965.1_10 Forward -169 -153 6.64671 0.167
NP_441965.1_10 Reverse -353 -369 2.61514 0.285
NP_441640.1_8 Forward -165 -146 5.89931 0.111
NP_442529.1_4 Reverse -363 -382 12.8808 0.175
NP_442693.1_7 Forward -66 -47 12.8808 0.202
NP_442693.1_7 Reverse -343 -362 10.3242 0.227
NP_442693.1_7 Forward -360 -341 7.7676 0.282
NP_440297.1_9 Reverse -158 -168 19.0562 0.0359
NP_440297.1_9 Forward -380 -370 9.61647 0.0917
NP_440297.1_9 Forward -165 -155 9.32148 0.0917
NP_440297.1_9 Reverse -51 -61 6.76487 0.17
NP_440297.1_9 Reverse -373 -383 -0.118297 0.282
NP_440297.1_9 Reverse -345 -355 -0.118297 0.282
NP_440297.1_9 Reverse -180 -190 -0.118297 0.282
NP_440297.1_9 Forward -352 -342 -0.216628 0.282
NP_440350.1_2 Reverse -5 -24 6.4893 0.248
NP_441592.1_4 Reverse -372 -391 7.47261 0.124
NP_441896.1_5 Forward -183 -176 12.2322 0.273
NP_440937.1_5 Forward -89 -70 10.4225 0.275
NP_440999.1_9 Reverse -368 -382 4.32615 0.116
NP_440999.1_9 Reverse -153 -167 -0.983719 0.223
NP_440888.1_2 Forward -166 -152 14.4536 0.0176
NP_440888.1_2 Reverse -372 -386 10.8154 0.0842
NP_440888.1_2 Reverse -109 -123 9.73373 0.116
NP_440888.1_2 Reverse -157 -171 7.66879 0.186
NP_440888.1_2 Forward -353 -339 5.21053 0.288
NP_440600.1_4 Reverse -364 -382 -8.14232 0.297
NP_440179.1_6 Reverse -373 -392 14.9458 0.0985
NP_440179.1_6 Reverse -345 -364 5.50599 0.238
NP_440179.1_6 Reverse -357 -376 2.85105 0.29
NP_441543.1_2 Forward -165 -156 16.9127 0.00359
NP_441543.1_2 Reverse -373 -382 16.9127 0.00359
NP_441543.1_2 Reverse -357 -366 14.356 0.0138
NP_441543.1_2 Forward -380 -371 9.34117 0.0818
NP_441543.1_2 Reverse -158 -167 9.34117 0.0818
NP_441543.1_2 Forward -58 -49 8.55452 0.0988
NP_441543.1_2 Reverse -51 -60 7.37455 0.127
NP_441543.1_2 Reverse -345 -354 5.11294 0.209
NP_441543.1_2 Reverse -180 -189 5.11294 0.209
NP_441543.1_2 Forward -352 -343 4.12963 0.279
NP_442845.1_2 Forward -359 -345 16.0275 0.0663
NP_442845.1_2 Reverse -151 -165 13.3726 0.0955
NP_442845.1_2 Forward -387 -373 8.94771 0.183
NP_442845.1_2 Reverse -350 -364 7.76774 0.195
NP_442845.1_2 Forward -124 -110 7.27608 0.195
NP_442845.1_2 Forward -194 -180 5.40779 0.233
NP_442845.1_2 Reverse -338 -352 4.12949 0.267
NP_442845.1_2 Reverse -366 -380 3.63784 0.282
NP_441551.1_5 Forward -369 -353 10.1859 0.196
NP_441178.1_6 Forward -141 -122 3.04693 0.269
NP_441469.1_8 Reverse -371 -380 13.3727 0.073
NP_441469.1_8 Forward -167 -158 13.3727 0.073
NP_441469.1_8 Forward -125 -116 7.76787 0.227
NP_441469.1_8 Forward -382 -373 6.48957 0.227
NP_441469.1_8 Reverse -156 -165 6.48957 0.227
NP_441469.1_8 Forward -60 -51 5.60459 0.258
NP_441469.1_8 Forward -366 -357 5.11294 0.289
NP_443064.1_5 Reverse -351 -370 18.7069 0.198
NP_443064.1_6 Forward -381 -371 13.8273 0.0796
NP_443064.1_6 Reverse -157 -167 13.8273 0.0796
NP_443064.1_6 Reverse -372 -382 12.5669 0.0796
NP_443064.1_6 Forward -166 -156 12.5669 0.0796
NP_442578.1_7 Forward -380 -373 14.5921 0.026
NP_442578.1_7 Forward -165 -158 14.5921 0.026
NP_442578.1_7 Reverse -373 -380 14.5921 0.026
NP_442578.1_7 Reverse -158 -165 14.5921 0.026
NP_440710.1_1 Forward -389 -371 -1.35749 0.179
NP_440710.1_1 Reverse -336 -354 -7.94566 0.249
NP_440071.1_6 Forward -334 -320 15.4531 0.235
NP_441462.1_2 Forward -381 -371 20.1379 0.000967
NP_441462.1_2 Reverse -157 -167 20.1379 0.000967
NP_441462.1_2 Reverse -372 -382 11.5831 0.00406
NP_441462.1_2 Forward -166 -156 11.5831 0.00406
NP_441462.1_2 Forward -353 -343 0.668351 0.135
NP_441462.1_2 Forward -365 -355 -0.314959 0.206
NP_441462.1_2 Forward -188 -178 -0.314959 0.206
NP_443062.1_1 Forward -365 -347 12.1537 0.0851
NP_443062.1_1 Reverse -179 -197 8.44842 0.153
NP_443062.1_1 Reverse -6 -24 6.98581 0.188
NP_443062.1_1 Forward -166 -148 5.13317 0.238
NP_443062.1_1 Reverse -157 -175 3.37804 0.3
NP_443062.1_6 Reverse -149 -168 18.4857 0.0448
NP_443062.1_6 Reverse -364 -383 1.67108 0.271
NP_440349.1_3 Forward -97 -78 10.2251 0.283
NP_440519.1_8 Forward -278 -262 3.50012 0.244
NP_440519.1_8 Reverse -360 -376 1.82849 0.274
NP_442204.1_1 Reverse -283 -294 9.49844 0.0759
NP_442204.1_1 Reverse -340 -351 2.51695 0.266
NP_442204.1_1 Reverse -352 -363 -0.334653 0.295
NP_442204.1_5 Forward -276 -257 10.3242 0.0912
NP_441560.1_10 Forward -174 -155 9.14423 0.235
NP_442487.1_6 Forward -387 -368 11.8967 0.213
NP_440516.1_2 Reverse -366 -384 0.805796 0.215
NP_440516.1_6 Forward -374 -360 8.75042 0.246
NP_440516.1_8 Forward -381 -372 16.9127 0.00442
NP_440516.1_8 Reverse -372 -381 16.9127 0.00442
NP_440516.1_8 Forward -166 -157 16.9127 0.00442
NP_440516.1_8 Reverse -157 -166 16.9127 0.00442
NP_441785.1_1 Reverse -257 -271 11.4779 0.299
NP_442428.1_4 Forward -366 -347 2.85105 0.247
NP_442428.1_5 Forward -380 -373 15.8704 0.0124
NP_442428.1_5 Reverse -373 -380 15.8704 0.0124
NP_442428.1_5 Forward -165 -158 15.8704 0.0124
NP_442428.1_5 Reverse -158 -165 15.8704 0.0124
NP_442428.1_5 Forward -364 -357 4.36568 0.271
NP_442428.1_5 Forward -352 -345 4.36568 0.271
NP_442428.1_5 Reverse -345 -352 4.36568 0.271
NP_442428.1_5 Forward -187 -180 4.36568 0.271
NP_442428.1_5 Reverse -180 -187 4.36568 0.271
NP_442428.1_5 Reverse -51 -58 4.36568 0.271
NP_440818.1_1 Forward -135 -116 -2.55715 0.276
NP_441267.1_1 Forward -387 -368 0.491109 0.281
NP_442120.1_10 Forward -365 -346 5.50599 0.141
NP_442120.1_10 Forward -118 -99 -10.227 0.256
NP_440673.1_2 Forward -391 -372 16.0476 0.0784
NP_440673.1_2 Reverse -362 -381 13.8039 0.105
NP_440673.1_2 Forward -363 -344 9.12141 0.257
NP_440673.1_2 Forward -176 -157 8.63366 0.264
NP_440673.1_2 Forward -375 -356 8.04834 0.284
NP_440673.1_3 Forward -379 -372 12.4288 0.0426
NP_440673.1_3 Forward -164 -157 12.4288 0.0426
NP_440673.1_3 Reverse -374 -381 12.4288 0.0426
NP_440673.1_3 Reverse -159 -166 12.4288 0.0426
NP_440673.1_3 Reverse -111 -118 8.98723 0.203
NP_441052.1_2 Reverse -372 -382 19.9412 0.00106
NP_441052.1_2 Forward -166 -156 19.9412 0.00106
NP_441052.1_2 Reverse -344 -354 13.7464 0.0275
NP_441052.1_2 Forward -381 -371 10.4031 0.0285
NP_441052.1_2 Reverse -157 -167 10.4031 0.0285
NP_441052.1_2 Reverse -179 -189 5.28991 0.124
NP_441052.1_2 Forward -65 -55 4.99491 0.135
NP_441052.1_2 Reverse -56 -66 4.40493 0.159
NP_441052.1_2 Forward -353 -343 4.20827 0.163
NP_441052.1_2 Forward -359 -349 4.0116 0.168
NP_442219.1_8 Forward -363 -344 9.32671 0.233
NP_442219.1_8 Forward -391 -372 6.62097 0.292
NP_442219.1_9 Forward -165 -156 17.7976 0.00718
NP_442219.1_9 Reverse -373 -382 17.7976 0.00718
NP_442219.1_9 Forward -380 -371 8.25953 0.0681
NP_442219.1_9 Reverse -158 -167 8.25953 0.0681
NP_440436.1_4 Forward -165 -156 17.2072 0.00233
NP_440436.1_4 Reverse -373 -382 17.2072 0.00233
NP_440436.1_4 Forward -380 -371 15.9289 0.00508
NP_440436.1_4 Reverse -158 -167 15.9289 0.00508
NP_440436.1_4 Reverse -357 -366 5.70251 0.186
NP_440436.1_4 Reverse -345 -354 4.7192 0.244
NP_440436.1_4 Reverse -180 -189 4.7192 0.244
NP_441884.1_9 Forward -169 -150 -17.2085 0.138
NP_441884.1_9 Forward -377 -358 -24.19 0.284
NP_442086.1_3 Reverse -373 -392 6.19431 0.288
NP_442086.1_6 Reverse -344 -363 10.6192 0.255
NP_442412.1_5 Reverse -234 -253 1.57275 0.295
NP_440314.1_9 Reverse -158 -177 0.392778 0.0952
NP_440314.1_9 Forward -380 -361 -7.4737 0.24
NP_442907.1_9 Reverse -367 -386 -0.885524 0.23
NP_441719.1_4 Forward -380 -373 16.3621 0.0124
NP_441719.1_4 Reverse -373 -380 16.3621 0.0124
NP_441719.1_4 Forward -165 -158 16.3621 0.0124
NP_441719.1_4 Reverse -158 -165 16.3621 0.0124
NP_441733.1_10 Reverse -154 -167 8.18076 0.14
NP_441733.1_10 Forward -384 -371 5.32916 0.218
NP_441004.1_1 Forward -359 -340 -4.42544 0.171
NP_441004.1_1 Forward -130 -111 -7.57203 0.199
NP_441004.1_1 Forward -346 -327 -10.227 0.219
NP_441004.1_1 Forward -284 -265 -14.6519 0.269
NP_441004.1_2 Forward -135 -116 11.2092 0.145
NP_442813.1_4 Reverse -232 -251 -2.0655 0.262
NP_442366.1_3 Forward -167 -149 4.6407 0.094
NP_442366.1_3 Forward -366 -348 -0.472507 0.191
NP_442366.1_5 Forward -384 -374 15.4175 0.0374
NP_442366.1_5 Reverse -369 -379 14.8275 0.0375
NP_440129.1_10 Forward -291 -277 6.88276 0.177
NP_442206.1_10 Forward -166 -151 6.46974 0.178
NP_442854.1_4 Reverse -339 -358 13.8633 0.224
NP_442854.1_6 Forward -335 -316 7.07928 0.229
NP_443054.1_2 Reverse -155 -169 10.226 0.0761
NP_443054.1_2 Forward -383 -369 8.94771 0.104
NP_443054.1_2 Forward -168 -154 4.91614 0.24
NP_441851.1_10 Reverse -371 -381 17.4829 0.0027
NP_441851.1_10 Forward -167 -157 17.4829 0.0027
NP_441851.1_10 Forward -382 -372 15.8113 0.00552
NP_441851.1_10 Reverse -156 -166 15.8113 0.00552
NP_441851.1_10 Forward -366 -356 5.87989 0.196
NP_441851.1_10 Forward -189 -179 5.68323 0.203
NP_441851.1_10 Forward -354 -344 4.50326 0.266
NP_442622.1_8 Forward -381 -363 -18.8604 0.285
NP_442515.1_1 Reverse -156 -170 12.291 0.0339
NP_442515.1_1 Forward -167 -153 10.6193 0.0485
NP_442515.1_1 Reverse -371 -385 4.22782 0.108
NP_442515.1_1 Forward -382 -368 -2.06536 0.268
NP_441396.1_5 Reverse -7 -16 17.2076 0.141
NP_440593.1_3 Forward -144 -125 -0.0988766 0.199
NP_440593.1_3 Reverse -367 -386 -3.63879 0.238
NP_440593.1_3 Forward -386 -367 -3.83545 0.242
NP_440593.1_3 Forward -199 -180 -7.27704 0.291
NP_441349.1_10 Reverse -147 -166 9.93088 0.0234
NP_441349.1_10 Forward -176 -157 -0.197208 0.0936
NP_441349.1_10 Forward -75 -56 -2.75381 0.125
NP_441349.1_10 Reverse -334 -353 -4.22878 0.164
NP_441349.1_10 Forward -391 -372 -8.26035 0.272
NP_441409.1_6 Forward -172 -153 2.45773 0.0584
NP_441409.1_6 Reverse -151 -170 2.0644 0.0584
NP_441394.1_10 Forward -318 -300 10.3431 0.263
NP_440432.1_9 Reverse -158 -173 6.37141 0.0477
NP_440432.1_9 Forward -380 -365 0.176559 0.159
NP_440432.1_9 Forward -187 -172 -2.47838 0.172
NP_440432.1_9 Forward -138 -123 -3.16669 0.179
NP_440432.1_9 Reverse -116 -131 -3.75668 0.19
NP_442843.1_1 Forward -380 -361 -6.88371 0.245
NP_442843.1_1 Reverse -180 -199 -7.76869 0.252
NP_439960.1_6 Reverse -338 -357 8.16093 0.268
NP_440474.1_8 Reverse -51 -65 5.40719 0.25
NP_440474.1_8 Reverse -158 -172 4.03056 0.294
NP_440396.1_1 Forward -203 -184 -4.13045 0.256
NP_440431.1_3 Reverse -343 -362 0.196116 0.132
NP_442450.1_5 Forward -168 -158 19.1546 0.0103
NP_442450.1_5 Reverse -370 -380 17.3846 0.0267
NP_442450.1_5 Reverse -155 -165 9.32148 0.115
NP_442450.1_5 Forward -383 -373 7.55152 0.13
NP_440588.1_2 Reverse -148 -167 13.2741 0.0211
NP_440588.1_2 Reverse -335 -354 5.01433 0.0729
NP_440588.1_2 Reverse -347 -366 -6.1954 0.273
NP_440943.1_4 Forward -253 -241 16.6569 0.114
NP_442006.1_2 Forward -133 -116 -0.452814 0.13
NP_442006.1_2 Forward -374 -357 -16.9724 0.267
NP_442006.1_2 Forward -132 -115 -17.4641 0.276
NP_441003.1_9 Reverse -341 -360 2.94938 0.3
NP_443047.1_7 Reverse -158 -177 9.24257 0.188
NP_442243.1_1 Reverse -338 -356 10.7364 0.122
NP_441570.1_1 Forward -381 -363 -8.92897 0.124
NP_441570.1_1 Forward -166 -148 -16.0088 0.237
NP_441570.1_1 Reverse -372 -390 -16.0088 0.237
NP_441078.1_4 Forward -381 -372 19.6659 0.0007
NP_441078.1_4 Reverse -372 -381 19.6659 0.0007
NP_441078.1_4 Forward -166 -157 19.6659 0.0007
NP_441078.1_4 Reverse -157 -166 19.6659 0.0007
NP_441078.1_4 Reverse -344 -353 8.06287 0.0392
NP_441078.1_4 Forward -353 -344 8.06287 0.0392
NP_441078.1_4 Forward -359 -350 6.29291 0.079
NP_441078.1_4 Reverse -50 -59 6.09625 0.0863
NP_441078.1_4 Reverse -350 -359 -1.6719 0.266
NP_441078.1_4 Reverse -179 -188 -1.6719 0.266
NP_441078.1_4 Forward -188 -179 -1.77023 0.266
NP_441078.1_4 Forward -65 -56 -1.96689 0.282
NP_441078.1_4 Forward -59 -50 -2.06522 0.295
NP_442729.1_8 Reverse -153 -166 9.75405 0.125
NP_442480.1_7 Reverse -355 -374 14.5524 0.284
NP_441091.1_5 Reverse -340 -359 3.24438 0.286
NP_440526.1_3 Forward -380 -369 10.9729 0.0646
NP_440526.1_3 Reverse -158 -169 10.8746 0.0646
NP_440526.1_3 Forward -165 -154 10.1862 0.0646
NP_440526.1_3 Reverse -271 -282 2.71313 0.267
NP_440526.1_3 Reverse -116 -127 1.82816 0.267
NP_440526.1_3 Reverse -373 -384 1.04151 0.267
NP_440526.1_3 Reverse -180 -191 0.54986 0.275
NP_441432.1_8 Reverse -156 -165 16.8143 0.00595
NP_441432.1_8 Forward -382 -373 16.8143 0.00595
NP_441432.1_8 Forward -119 -110 12.2911 0.0444
NP_441432.1_8 Forward -360 -351 10.0295 0.0681
NP_441432.1_8 Reverse -371 -380 8.35786 0.0755
NP_441432.1_8 Forward -167 -158 8.35786 0.0755
NP_441432.1_8 Reverse -343 -352 6.19458 0.118
NP_441432.1_8 Forward -354 -345 6.19458 0.118
NP_441432.1_8 Forward -189 -180 6.19458 0.118
NP_441432.1_8 Reverse -49 -58 3.04799 0.268
NP_442320.1_8 Reverse -151 -165 12.586 0.0175
NP_442320.1_8 Forward -172 -158 6.29277 0.029
NP_442320.1_8 Forward -387 -373 -2.45868 0.0894
NP_442320.1_8 Reverse -366 -380 -3.83532 0.134
NP_442344.1_7 Reverse -373 -392 -5.50708 0.168
NP_441732.1_2 Reverse -368 -384 -6.62797 0.0495
NP_441732.1_2 Reverse -346 -362 -7.90627 0.0983
NP_441732.1_2 Forward -170 -154 -16.5594 0.174
NP_441732.1_2 Reverse -352 -368 -17.4444 0.258
NP_441030.1_6 Forward -355 -336 17.4724 0.155
NP_440760.1_1 Reverse -372 -391 6.39097 0.0115
NP_440760.1_1 Forward -381 -362 -13.8652 0.115
NP_442797.1_6 Forward -363 -344 9.29156 0.246
NP_440199.1_10 Reverse -154 -164 16.7946 0.0381
NP_440199.1_10 Forward -169 -159 7.74818 0.231
NP_440199.1_10 Forward -121 -111 7.25653 0.231
NP_442353.1_4 Reverse -366 -385 4.42355 0.205
NP_440913.1_1 Forward -190 -172 5.62401 0.237
NP_440281.1_1 Forward -79 -60 14.3475 0.214
NP_440713.1_4 Forward -369 -350 10.2259 0.13
NP_440713.1_4 Forward -289 -270 5.99764 0.198
NP_442489.1_2 Forward -70 -51 15.2408 0.126
NP_442489.1_2 Reverse -146 -165 5.211 0.201
NP_442489.1_2 Forward -199 -180 2.65439 0.261
NP_442489.1_7 Forward -381 -372 20.1576 0.000695
NP_442489.1_7 Reverse -372 -381 20.1576 0.000695
NP_442489.1_7 Forward -166 -157 20.1576 0.000695
NP_442489.1_7 Reverse -157 -166 20.1576 0.000695
NP_442489.1_7 Forward -353 -344 8.06287 0.0371
NP_442489.1_7 Reverse -344 -353 8.06287 0.0371
NP_442489.1_7 Forward -365 -356 5.21127 0.077
NP_442489.1_7 Forward -359 -350 -1.47524 0.203
NP_442489.1_7 Forward -65 -56 -1.47524 0.203
NP_442489.1_7 Reverse -179 -188 -1.6719 0.235
NP_442489.1_7 Reverse -50 -59 -1.6719 0.235
NP_442489.1_7 Forward -188 -179 -1.77023 0.247
NP_441830.1_2 Reverse -357 -376 -0.4922 0.241
NP_440565.1_7 Forward -289 -270 1.57275 0.246
NP_440386.1_3 Reverse -26 -45 -7.08038 0.274
NP_442079.1_7 Reverse -158 -177 5.89931 0.168
NP_442079.1_7 Forward -364 -345 2.94938 0.22
NP_442079.1_7 Reverse -7 -26 -0.000545616 0.287
NP_440559.1_1 Forward -165 -156 17.4043 0.00658
NP_440559.1_1 Reverse -373 -382 17.4043 0.00658
NP_440559.1_1 Forward -380 -371 17.306 0.00658
NP_440559.1_1 Reverse -158 -167 17.306 0.00658
NP_441659.2_8 Forward -381 -371 19.3512 0.000966
NP_441659.2_8 Reverse -157 -167 19.3512 0.000966
NP_441659.2_8 Reverse -372 -382 18.1713 0.00133
NP_441659.2_8 Forward -166 -156 18.1713 0.00133
NP_441659.2_8 Forward -353 -343 9.12481 0.0355
NP_441659.2_8 Reverse -344 -354 6.37155 0.0774
NP_441659.2_8 Reverse -179 -189 4.10993 0.144
NP_441659.2_8 Forward -139 -129 2.33998 0.205
NP_441659.2_8 Reverse -109 -119 0.865012 0.256
NP_441040.1_2 Reverse -335 -354 -15.6352 0.286
NP_441040.1_5 Reverse -339 -358 6.98095 0.229
NP_440708.1_6 Reverse -323 -342 -5.31042 0.232
NP_440708.1_6 Reverse -322 -341 -7.37537 0.248
NP_442776.1_1 Reverse -345 -364 18.1907 0.0502
NP_440779.1_5 Forward -139 -122 -5.36936 0.149
NP_441185.1_2 Forward -355 -336 8.65258 0.239
NP_441185.1_6 Forward -277 -258 3.34271 0.208
NP_442346.1_5 Reverse -371 -381 17.9746 0.00128
NP_442346.1_5 Forward -167 -157 17.9746 0.00128
NP_442346.1_5 Forward -382 -372 16.6963 0.00248
NP_442346.1_5 Reverse -156 -166 16.6963 0.00248
NP_442346.1_5 Forward -354 -344 14.7297 0.0103
NP_442346.1_5 Reverse -343 -353 14.3364 0.0136
NP_442346.1_5 Forward -189 -179 14.238 0.0146
NP_442346.1_5 Reverse -178 -188 12.1731 0.0475
NP_442346.1_5 Reverse -49 -59 10.0098 0.11
NP_442346.1_5 Forward -66 -56 7.64985 0.162
NP_442346.1_10 Reverse -113 -132 -0.39387 0.269
NP_440545.1_3 Forward -357 -340 5.44704 0.0616
NP_440545.1_3 Forward -288 -271 -0.0594896 0.147
NP_440545.1_3 Forward -385 -368 -2.12444 0.179
NP_441856.1_3 Forward -224 -205 2.55606 0.195
NP_441856.1_3 Forward -191 -172 -1.86883 0.245
NP_441856.1_3 Reverse -154 -173 -2.16383 0.255
NP_441629.1_1 Forward -174 -155 11.7008 0.154
NP_441786.1_10 Reverse -41 -60 7.47261 0.264
NP_440555.1_4 Reverse -79 -98 5.99764 0.255
NP_440555.1_7 Reverse -172 -191 15.0441 0.267
NP_441923.1_6 Forward -277 -263 8.16106 0.28
NP_440459.1_2 Reverse -342 -359 7.80699 0.278
NP_440459.1_2 Forward -337 -320 7.512 0.288
NP_441653.1_2 Reverse -361 -380 13.8694 0.0959
NP_441653.1_4 Forward -392 -380 16.4603 0.272
NP_440010.1_4 Reverse -340 -359 -2.75457 0.289
NP_442900.1_2 Forward -203 -184 5.80098 0.179
NP_442603.1_7 Forward -166 -152 7.57046 0.202
NP_441888.1_7 Reverse -367 -381 2.2612 0.225
NP_440449.1_6 Forward -361 -343 8.3531 0.201
NP_439970.1_4 Reverse -291 -310 -4.42544 0.293
NP_441833.1_4 Forward -380 -373 15.9687 0.0124
NP_441833.1_4 Reverse -373 -380 15.9687 0.0124
NP_441833.1_4 Forward -165 -158 15.9687 0.0124
NP_441833.1_4 Reverse -158 -165 15.9687 0.0124
NP_441895.1_2 Forward -340 -321 -26.5499 0.24
NP_441895.1_3 Reverse -362 -381 -17.2085 0.298
NP_442162.1_9 Forward -380 -373 16.2637 0.0124
NP_442162.1_9 Reverse -373 -380 16.2637 0.0124
NP_442162.1_9 Forward -165 -158 16.2637 0.0124
NP_442162.1_9 Reverse -158 -165 16.2637 0.0124
NP_440671.1_4 Forward -172 -158 12.7826 0.101
NP_440671.1_4 Reverse -366 -380 9.04604 0.187
NP_440671.1_4 Reverse -151 -165 8.06273 0.204
NP_440671.1_4 Reverse -350 -364 6.3911 0.248
NP_440671.1_4 Forward -124 -110 5.80112 0.271
NP_440224.1_1 Reverse -333 -352 -0.983855 0.156
NP_441973.1_1 Reverse -324 -339 0.176559 0.236
NP_440772.1_8 Reverse -366 -385 10.2259 0.253
NP_442199.1_5 Reverse -171 -190 -2.0655 0.185
NP_442199.1_5 Reverse -348 -367 -3.04881 0.2
NP_442140.1_3 Forward -380 -370 13.5497 0.0542
NP_442140.1_3 Reverse -373 -383 12.2714 0.0632
NP_442140.1_3 Reverse -345 -355 7.45319 0.14
NP_442140.1_3 Reverse -158 -168 5.68323 0.198
NP_442140.1_3 Reverse -180 -190 5.48657 0.207
NP_442140.1_3 Forward -165 -155 4.40493 0.243
NP_442723.1_1 Reverse -266 -285 3.14526 0.278
NP_442021.1_3 Forward -359 -340 -4.91709 0.251
NP_441671.1_10 Forward -252 -233 -0.0988766 0.288
NP_440875.1_2 Forward -358 -339 7.37428 0.212
NP_440875.1_9 Forward -351 -341 12.6548 0.106
NP_440875.1_9 Forward -186 -176 9.05339 0.233
NP_442547.1_7 Forward -363 -344 15.1865 0.168
NP_442547.1_7 Reverse -362 -381 11.7797 0.243
NP_441813.1_5 Forward -168 -158 16.1063 0.01
NP_441813.1_5 Reverse -155 -165 15.9097 0.01
NP_441813.1_5 Reverse -370 -380 8.82982 0.0367
NP_441813.1_5 Forward -383 -373 8.63316 0.0367
NP_440590.1_4 Reverse -373 -386 7.78743 0.0494
NP_440590.1_4 Forward -278 -265 6.70579 0.0568
NP_440590.1_4 Forward -380 -367 3.75586 0.0686
NP_440590.1_4 Reverse -345 -358 -1.94734 0.233
NP_440590.1_4 Reverse -158 -171 -3.81562 0.255
NP_440590.1_4 Forward -165 -152 -4.40561 0.261
NP_440567.1_1 Forward -165 -151 12.3893 0.0236
NP_440567.1_1 Forward -380 -366 10.226 0.0385
NP_440567.1_1 Reverse -373 -387 8.45605 0.0577
NP_440567.1_1 Forward -364 -350 0.294584 0.25
NP_440567.1_1 Reverse -158 -172 0.0979218 0.256
NP_442497.1_10 Forward -380 -371 19.8626 0.00532
NP_442497.1_10 Reverse -158 -167 19.8626 0.00532
NP_442497.1_10 Forward -165 -156 10.4228 0.0087
NP_442497.1_10 Reverse -373 -382 10.4228 0.0087
NP_440821.1_4 Forward -168 -158 19.8429 0.00399
NP_440821.1_4 Reverse -155 -165 18.2696 0.00448
NP_440821.1_4 Reverse -370 -380 10.9931 0.0146
NP_440821.1_4 Forward -383 -373 9.41981 0.0286
NP_440821.1_4 Forward -61 -51 -0.511621 0.269
NP_441239.1_9 Reverse -342 -354 13.117 0.0389
NP_441239.1_9 Forward -168 -156 11.7404 0.0551
NP_441239.1_9 Reverse -177 -189 11.5437 0.0589
NP_441239.1_9 Reverse -370 -382 10.7571 0.0723
NP_441239.1_9 Reverse -155 -167 7.90546 0.147
NP_441239.1_9 Forward -383 -371 6.92215 0.173
NP_441239.1_9 Reverse -318 -330 4.8572 0.239
NP_441239.1_9 Reverse -354 -366 3.97222 0.269
NP_441239.1_9 Forward -126 -114 3.87389 0.272
NP_441239.1_9 Forward -141 -129 3.67722 0.279
NP_441239.1_9 Forward -355 -343 3.48056 0.285
NP_441239.1_9 Reverse -363 -375 3.38223 0.285
NP_441892.1_1 Reverse -363 -380 15.7718 0.029
NP_441892.1_1 Reverse -347 -364 4.46374 0.11
NP_441892.1_1 Forward -362 -345 -4.77938 0.268
NP_441892.1_4 Forward -336 -317 1.27776 0.266
NP_440604.1_6 Forward -249 -230 -6.49039 0.298
NP_442193.1_1 Reverse -115 -133 11.0322 0.228
NP_442193.1_8 Forward -362 -343 12.4867 0.234
NP_442270.1_9 Reverse -361 -380 -9.047 0.226
NP_442270.1_9 Forward -289 -270 -9.34199 0.23
NP_441508.1_4 Forward -37 -23 13.094 0.297
NP_442643.1_1 Forward -387 -368 -11.8986 0.235
NP_441017.1_6 Forward -170 -156 12.487 0.217
NP_441874.1_1 Reverse -147 -161 11.111 0.249
NP_443035.1_10 Forward -372 -355 8.29864 0.273
NP_440354.1_5 Forward -368 -349 9.93088 0.174
NP_440354.1_5 Reverse -18 -37 3.73603 0.237
NP_442138.1_10 Forward -381 -362 1.86774 0.12
NP_440391.1_7 Forward -201 -182 6.58682 0.273
NP_442052.1_6 Reverse -183 -201 16.9313 0.248
NP_442052.1_8 Reverse -370 -380 12.7631 0.253
NP_440546.1_4 Forward -188 -178 12.9547 0.0572
NP_440546.1_4 Forward -381 -371 12.8578 0.0572
NP_440546.1_4 Reverse -157 -167 12.8578 0.0572
NP_440546.1_4 Forward -353 -343 11.3065 0.0872
NP_440546.1_4 Reverse -372 -382 10.046 0.109
NP_440546.1_4 Forward -166 -156 10.046 0.109
NP_440546.1_4 Reverse -50 -60 8.88251 0.166
NP_440546.1_4 Reverse -179 -189 8.59164 0.181
NP_440546.1_4 Reverse -344 -354 7.81598 0.22
NP_440546.1_4 Forward -59 -49 7.23423 0.252
NP_440675.1_1 Forward -384 -365 3.83436 0.246
NP_440462.1_6 Forward -168 -158 7.84651 0.0699
NP_440462.1_6 Reverse -155 -165 7.74818 0.0699
NP_440462.1_6 Reverse -354 -364 3.12662 0.26
NP_440462.1_6 Reverse -370 -380 1.455 0.294
NP_440462.1_6 Forward -383 -373 1.35667 0.294
NP_440868.1_4 Forward -369 -357 8.9871 0.0582
NP_440868.1_4 Reverse -153 -165 8.20045 0.0602
NP_440868.1_4 Forward -385 -373 6.1355 0.0878
NP_440868.1_4 Forward -63 -51 0.727295 0.201
NP_440868.1_4 Forward -170 -158 -0.74767 0.282
NP_442499.1_3 Forward -318 -300 7.68896 0.282
NP_441084.1_6 Reverse -342 -356 19.6216 0.0294
NP_441084.1_6 Reverse -177 -191 15.7433 0.0775
NP_441084.1_6 Reverse -354 -368 14.095 0.11
NP_441084.1_6 Reverse -128 -142 9.15021 0.292
NP_440653.1_10 Reverse -345 -364 20.649 0.0358
NP_440653.1_10 Forward -380 -361 10.4225 0.151
NP_440696.1_3 Forward -369 -351 10.3439 0.144
NP_440696.1_6 Reverse -339 -358 4.12936 0.288
NP_442039.1_4 Forward -380 -373 15.1821 0.0124
NP_442039.1_4 Reverse -373 -380 15.1821 0.0124
NP_442039.1_4 Forward -165 -158 15.1821 0.0124
NP_442039.1_4 Reverse -158 -165 15.1821 0.0124
NP_441811.1_8 Forward -387 -373 12.4876 0.207
NP_441926.1_3 Forward -118 -102 9.20332 0.17
NP_441926.1_3 Reverse -157 -173 6.25339 0.17
NP_440825.1_7 Reverse -373 -383 12.9096 0.152
NP_440825.1_7 Forward -380 -370 11.8361 0.2
NP_442837.1_3 Forward -380 -373 15.7721 0.0124
NP_442837.1_3 Reverse -373 -380 15.7721 0.0124
NP_442837.1_3 Forward -165 -158 15.7721 0.0124
NP_442837.1_3 Reverse -158 -165 15.7721 0.0124
NP_440160.1_2 Forward -144 -125 -0.983855 0.232
NP_440160.1_2 Reverse -338 -357 -4.72043 0.267
NP_440160.1_2 Forward -348 -329 -5.80207 0.277
NP_440160.1_2 Forward -341 -322 -7.17871 0.283
NP_442053.1_1 Forward -381 -372 18.3876 0.0007
NP_442053.1_1 Reverse -372 -381 18.3876 0.0007
NP_442053.1_1 Forward -166 -157 18.3876 0.0007
NP_442053.1_1 Reverse -157 -166 18.3876 0.0007
NP_440505.1_3 Reverse -155 -165 16.303 0.00696
NP_440505.1_3 Forward -383 -373 9.22315 0.122
NP_440505.1_3 Forward -168 -158 7.55152 0.151
NP_440505.1_7 Reverse -326 -345 -1.37718 0.273
NP_441701.1_3 Reverse -8 -25 14.2968 0.191
NP_441102.1_1 Forward -165 -146 3.93269 0.282
NP_441203.1_1 Reverse -158 -177 -19.2734 0.297
NP_440013.1_2 Forward -388 -374 12.586 0.294
NP_441408.2_7 Reverse -342 -361 13.1758 0.0657
NP_440009.1_4 Reverse -93 -112 7.17762 0.299
NP_440914.1_1 Reverse -372 -382 17.5935 0.000537
NP_440914.1_1 Forward -166 -156 17.5935 0.000537
NP_440914.1_1 Forward -381 -371 8.51751 0.186
NP_440914.1_1 Reverse -157 -167 8.51751 0.186
NP_440914.1_1 Reverse -344 -354 6.95605 0.257
NP_441011.1_8 Forward -380 -371 14.356 0.0249
NP_441011.1_8 Reverse -158 -167 14.356 0.0249
NP_441011.1_8 Reverse -51 -60 10.6195 0.101
NP_441011.1_8 Reverse -373 -382 8.25953 0.144
NP_441011.1_8 Forward -165 -156 8.25953 0.144
NP_442101.1_10 Forward -174 -155 -8.85033 0.242
NP_442533.1_6 Forward -381 -372 17.2076 0.00137
NP_442533.1_6 Reverse -372 -381 17.2076 0.00137
NP_442533.1_6 Forward -166 -157 17.2076 0.00137
NP_442533.1_6 Reverse -157 -166 17.2076 0.00137
NP_442533.1_6 Forward -353 -344 16.5193 0.00338
NP_442533.1_6 Reverse -344 -353 16.5193 0.00338
NP_442533.1_6 Forward -188 -179 14.4544 0.013
NP_442533.1_6 Reverse -56 -65 12.2911 0.0304
NP_442533.1_6 Reverse -179 -188 6.78456 0.103
NP_442533.1_6 Forward -59 -50 6.29291 0.113
NP_442533.1_6 Forward -365 -356 4.52295 0.179
NP_442533.1_6 Reverse -130 -139 1.76968 0.289
NP_442541.1_10 Forward -353 -339 3.04726 0.254
NP_442322.1_9 Forward -29 -11 10.8348 0.251
NP_442229.1_1 Forward -383 -369 16.5185 0.0828
NP_441482.1_7 Reverse -366 -380 -0.787057 0.0612
NP_441482.1_7 Forward -387 -373 -1.18038 0.0637
NP_441482.1_7 Forward -172 -158 -9.04686 0.193
NP_441482.1_7 Reverse -151 -165 -11.0135 0.229
NP_441482.1_7 Reverse -50 -64 -11.3085 0.254
NP_441482.1_7 Reverse -350 -364 -11.6035 0.275
NP_439944.1_9 Forward -165 -155 19.0562 0.00329
NP_439944.1_9 Reverse -158 -168 17.3846 0.00516
NP_439944.1_9 Forward -358 -348 11.3864 0.0887
NP_439944.1_9 Reverse -373 -383 10.5014 0.0887
NP_439944.1_9 Forward -380 -370 8.82982 0.101
NP_439944.1_9 Reverse -51 -61 5.09324 0.277
NP_441028.1_6 Reverse -119 -129 3.51951 0.292
NP_440116.1_5 Forward -384 -367 3.87375 0.223
NP_440116.1_8 Forward -165 -146 -9.53865 0.281
NP_440007.1_9 Reverse -368 -382 3.63784 0.268
NP_440007.1_9 Forward -170 -156 3.44117 0.269
NP_439965.1_1 Reverse -148 -167 -7.37537 0.224
NP_441347.1_5 Forward -354 -340 9.34041 0.274
NP_441602.1_3 Forward -386 -367 -5.40875 0.285
NP_441972.1_5 Forward -380 -361 -2.85214 0.192
NP_441972.1_5 Reverse -345 -364 -7.86702 0.254
NP_441972.1_5 Reverse -169 -188 -10.0303 0.296
NP_441106.1_1 Reverse -371 -380 9.73449 0.0311
NP_441106.1_1 Forward -167 -158 9.73449 0.0311
NP_441106.1_1 Forward -382 -373 9.63616 0.0311
NP_441106.1_1 Reverse -156 -165 9.63616 0.0311
NP_441106.1_1 Reverse -343 -352 5.50626 0.145
NP_441106.1_1 Forward -366 -357 5.40793 0.151
NP_441106.1_1 Reverse -178 -187 4.62128 0.213
NP_440429.1_2 Reverse -345 -364 10.0292 0.272
NP_440429.1_2 Reverse -110 -129 7.17762 0.29
NP_439903.1_6 Reverse -341 -360 10.4217 0.106
NP_439903.1_6 Reverse -106 -125 6.68515 0.167
NP_439903.1_6 Forward -384 -365 1.6703 0.241
NP_439903.1_6 Forward -169 -150 -0.984623 0.289
NP_442306.1_10 Reverse -339 -358 -20.7484 0.226
NP_441286.1_1 Reverse -156 -168 23.9334 0.000767
NP_441286.1_1 Forward -382 -370 15.4769 0.00418
NP_441286.1_1 Forward -167 -155 11.937 0.0108
NP_441286.1_1 Reverse -371 -383 3.48056 0.0467
NP_441286.1_1 Reverse -114 -126 -6.5492 0.267
NP_442674.1_3 Reverse -364 -383 9.24175 0.177
NP_442674.1_3 Forward -132 -113 4.03023 0.294
NP_440670.1_8 Forward -381 -372 18.3876 0.000699
NP_440670.1_8 Reverse -372 -381 18.3876 0.000699
NP_440670.1_8 Forward -166 -157 18.3876 0.000699
NP_440670.1_8 Reverse -157 -166 18.3876 0.000699
NP_441930.1_2 Forward -125 -115 11.5831 0.285
NP_440886.1_7 Reverse -371 -381 8.04271 0.0805
NP_440886.1_7 Forward -167 -157 8.04271 0.0805
NP_440886.1_7 Forward -382 -372 7.94438 0.0805
NP_440886.1_7 Reverse -156 -166 7.94438 0.0805
NP_440886.1_7 Forward -375 -365 3.32285 0.287
NP_442614.1_2 Reverse -157 -171 6.98109 0.276
NP_442614.1_2 Forward -166 -152 6.6861 0.287
NP_442614.1_2 Forward -59 -45 6.19444 0.291
NP_439995.1_5 Reverse -147 -166 8.75091 0.235
NP_442072.1_9 Reverse -371 -389 -12.6655 0.0877
NP_442072.1_9 Forward -382 -364 -12.7639 0.091
NP_441808.1_8 Forward -365 -346 6.09597 0.294
NP_442022.1_4 Forward -200 -181 9.93088 0.242
NP_440907.2_8 Forward -380 -370 16.2041 0.0161
NP_440907.2_8 Reverse -158 -168 9.81266 0.103
NP_440907.2_8 Reverse -373 -383 7.64939 0.117
NP_442264.1_2 Reverse -153 -170 5.64371 0.274
NP_439967.1_1 Forward -138 -120 11.2289 0.236
NP_441021.1_1 Forward -380 -361 4.42435 0.076
NP_441021.1_1 Reverse -345 -364 -8.16202 0.194
NP_441021.1_1 Reverse -180 -199 -9.44032 0.216
NP_441021.1_8 Forward -171 -153 3.26407 0.23
NP_440841.1_4 Forward -168 -149 -4.42544 0.187
NP_441463.1_3 Reverse -147 -166 -0.983855 0.135
NP_441463.1_3 Forward -69 -50 -2.85214 0.162
NP_441463.1_3 Forward -25 -6 -3.63879 0.181
NP_441463.1_6 Reverse -155 -169 6.6092 0.267
NP_441626.1_2 Forward -380 -373 15.7721 0.0124
NP_441626.1_2 Reverse -373 -380 15.7721 0.0124
NP_441626.1_2 Forward -165 -158 15.7721 0.0124
NP_441626.1_2 Reverse -158 -165 15.7721 0.0124
NP_441626.1_6 Reverse -368 -386 11.2281 0.198
NP_442211.1_3 Reverse -360 -379 9.80632 0.257
NP_441988.1_5 Reverse -359 -378 14.2574 0.274
NP_441901.1_1 Forward -362 -343 2.85105 0.218
NP_442209.1_6 Forward -352 -333 20.8456 0.182
NP_442209.1_6 Reverse -327 -346 13.2741 0.263
NP_442794.1_1 Forward -385 -373 9.38042 0.0795
NP_442794.1_1 Reverse -147 -159 9.18376 0.0821
NP_442794.1_1 Forward -357 -345 7.21714 0.144
NP_442794.1_1 Reverse -329 -341 5.74217 0.209
NP_442794.1_1 Reverse -368 -380 2.98891 0.286
NP_442615.1_1 Forward -390 -372 7.29564 0.0322
NP_442615.1_1 Reverse -148 -166 3.3624 0.0549
NP_442615.1_1 Reverse -363 -381 -0.570838 0.118
NP_442615.1_1 Forward -362 -344 -0.7675 0.121
NP_442615.1_1 Reverse -335 -353 -5.09406 0.204
NP_442615.1_1 Forward -175 -157 -7.06068 0.273
NP_441962.1_4 Forward -386 -367 -4.03212 0.156
NP_441962.1_4 Reverse -187 -206 -5.50708 0.169
NP_441962.1_4 Reverse -84 -103 -11.8986 0.248
NP_441962.1_4 Reverse -51 -70 -12.4886 0.259
NP_441962.1_4 Forward -171 -152 -13.0786 0.268
NP_441962.1_4 Forward -283 -264 -14.1602 0.284
NP_441962.1_5 Forward -358 -339 13.7658 0.124
NP_440387.1_1 Reverse -372 -388 21.003 0.00265
NP_440387.1_1 Forward -381 -365 0.451859 0.126
NP_440387.1_1 Forward -166 -150 -3.57971 0.162
NP_440387.1_1 Reverse -344 -360 -4.07137 0.174
NP_440855.1_5 Forward -361 -342 1.86696 0.295
NP_441431.1_2 Reverse -341 -355 13.2736 0.0947
NP_441431.1_2 Reverse -369 -383 12.782 0.107
NP_441836.1_1 Forward -392 -373 13.5447 0.223
NP_441836.1_2 Reverse -338 -357 -3.3438 0.237
NP_441993.1_1 Forward -359 -340 24.5568 0.00283
NP_441993.1_1 Forward -194 -175 1.26449 0.282
NP_441993.1_1 Forward -124 -105 1.06957 0.285
NP_440358.1_2 Forward -29 -12 9.77286 0.294
NP_440814.1_4 Reverse -363 -382 -4.03212 0.16
NP_440467.1_3 Forward -364 -345 11.0609 0.284
NP_440114.1_10 Reverse -157 -171 16.1259 0.02
NP_440114.1_10 Reverse -50 -64 11.2093 0.121
NP_440114.1_10 Forward -118 -104 9.83269 0.16
NP_440114.1_10 Forward -166 -152 9.5377 0.169
NP_440114.1_10 Forward -381 -367 8.65272 0.198
NP_440114.1_10 Reverse -372 -386 6.6861 0.26
NP_442323.1_7 Reverse -110 -129 13.2733 0.09
NP_440287.1_6 Reverse -363 -382 0.294447 0.294
NP_441552.1_3 Reverse -150 -169 14.7483 0.227
NP_440293.1_3 Forward -361 -342 8.06259 0.184
NP_440766.1_4 Reverse -153 -167 5.40779 0.112
NP_440766.1_5 Reverse -31 -43 7.46481 0.29
NP_441237.1_9 Forward -380 -370 17.188 0.00445
NP_441237.1_9 Reverse -373 -383 14.828 0.0242
NP_439910.1_2 Forward -174 -157 6.43035 0.00988
NP_439910.1_2 Reverse -149 -166 -22.2823 0.22
NP_440457.1_1 Forward -170 -158 9.87208 0.092
NP_440457.1_1 Reverse -368 -380 8.10212 0.101
NP_440457.1_1 Reverse -126 -138 5.44718 0.141
NP_440457.1_1 Forward -385 -373 0.825626 0.25
NP_440457.1_1 Reverse -153 -165 -0.0593532 0.25
NP_442940.1_2 Reverse -50 -69 -0.983855 0.296
NP_441984.1_3 Forward -143 -125 6.41066 0.269
NP_441436.1_8 Forward -119 -100 11.0125 0.262
NP_441436.1_8 Forward -330 -311 7.57094 0.293
NP_440473.1_1 Reverse -353 -372 13.764 0.185
NP_440473.1_9 Forward -376 -357 -7.96535 0.241
NP_442509.1_9 Forward -381 -371 17.3841 0.00128
NP_442509.1_9 Reverse -157 -167 17.3841 0.00128
NP_442509.1_9 Reverse -372 -382 8.14104 0.192
NP_442509.1_9 Forward -166 -156 8.14104 0.192
NP_441253.1_8 Reverse -367 -381 17.1423 0.119
NP_442514.1_5 Forward -139 -120 20.8447 0.0153
NP_442514.1_5 Forward -361 -342 -4.52452 0.242
NP_442514.1_8 Forward -367 -348 22.4189 0.0248
NP_440554.1_4 Forward -187 -177 7.35486 0.103
NP_440554.1_4 Forward -165 -155 7.05986 0.106
NP_440554.1_4 Reverse -158 -168 6.96153 0.107
NP_440554.1_4 Forward -352 -342 5.28991 0.153
NP_442862.1_3 Forward -370 -353 13.7068 0.173
NP_442862.1_3 Forward -397 -380 5.9387 0.267
NP_442862.1_3 Forward -193 -176 5.74204 0.268
NP_441885.1_5 Reverse -372 -382 20.9245 0.000538
NP_441885.1_5 Forward -166 -156 20.9245 0.000538
NP_441885.1_5 Forward -381 -371 11.3864 0.00668
NP_441885.1_5 Reverse -157 -167 11.3864 0.00668
NP_441885.1_5 Reverse -344 -354 1.94665 0.0935
NP_441885.1_5 Forward -59 -49 0.668351 0.133
NP_441885.1_5 Forward -359 -349 0.373358 0.164
NP_441885.1_5 Reverse -130 -140 -1.78992 0.284
NP_441275.1_5 Forward -102 -83 12.88 0.276
NP_442341.1_7 Forward -382 -368 16.8142 0.0155
NP_442341.1_7 Forward -167 -153 12.0943 0.0478
NP_442341.1_7 Reverse -156 -170 7.07942 0.111
NP_442341.1_7 Reverse -371 -385 5.40779 0.157
NP_442341.1_7 Reverse -349 -363 4.22782 0.198
NP_442341.1_7 Reverse -55 -69 1.76955 0.281
NP_442341.1_9 Forward -383 -369 9.6354 0.147
NP_442341.1_9 Reverse -155 -169 7.86545 0.185
NP_442341.1_9 Forward -168 -154 7.17714 0.204
NP_442395.2_4 Reverse -269 -288 7.27514 0.14
NP_440423.1_6 Reverse -364 -383 -11.8986 0.184
NP_440423.1_6 Forward -174 -155 -14.8485 0.229
NP_443000.1_7 Reverse -155 -165 17.0896 0.00865
NP_443000.1_7 Forward -383 -373 10.3048 0.0345
NP_443000.1_7 Forward -168 -158 8.82982 0.0437
NP_443000.1_7 Reverse -285 -295 4.89658 0.158
NP_443000.1_7 Reverse -370 -380 2.04498 0.226
NP_443000.1_7 Reverse -342 -352 0.766681 0.29
NP_440507.2_3 Reverse -47 -66 11.8967 0.169
NP_442513.1_4 Reverse -125 -144 17.0099 0.28
NP_441842.1_10 Reverse -150 -164 11.701 0.123
NP_441842.1_10 Reverse -365 -379 6.19444 0.297
NP_441842.1_10 Forward -131 -117 6.09611 0.299
NP_440275.1_3 Forward -168 -158 10.0098 0.0454
NP_440275.1_3 Reverse -370 -380 9.91146 0.046
NP_440275.1_3 Reverse -155 -165 8.1415 0.0602
NP_440275.1_3 Forward -383 -373 8.04317 0.0602
NP_440091.1_1 Forward -170 -158 8.9871 0.0567
NP_440091.1_1 Reverse -153 -165 8.88877 0.0567
NP_440091.1_1 Forward -385 -373 1.41561 0.197
NP_443010.1_10 Forward -169 -152 11.5645 0.105
NP_443010.1_10 Reverse -154 -171 6.73278 0.179
NP_441122.1_1 Forward -385 -370 4.69978 0.28
NP_442753.1_6 Reverse -176 -195 7.27514 0.239
NP_439962.1_6 Forward -276 -258 10.6389 0.216
NP_440175.1_7 Forward -192 -174 10.339 0.257
NP_442495.1_4 Forward -292 -282 12.3697 0.229
NP_442495.1_9 Reverse -186 -205 18.6815 0.167
NP_440149.1_8 Forward -65 -46 6.78429 0.064
NP_440149.1_8 Forward -124 -105 -7.76869 0.292
NP_440149.1_10 Forward -118 -99 -11.8003 0.285
NP_441875.1_4 Reverse -339 -358 13.8633 0.197
NP_441105.1_3 Forward -364 -345 5.99764 0.0638
NP_441105.1_3 Reverse -39 -58 -0.197208 0.132
NP_441105.1_3 Forward -70 -51 -0.590531 0.138
NP_441105.1_3 Reverse -345 -364 -2.95047 0.171
NP_441105.1_3 Reverse -339 -358 -3.04881 0.172
NP_441105.1_3 Reverse -361 -380 -9.44032 0.289
NP_441105.1_3 Reverse -146 -165 -9.44032 0.289
NP_440216.1_1 Forward -353 -339 6.6861 0.0139
NP_440216.1_1 Reverse -157 -171 6.3911 0.0156
NP_440216.1_1 Forward -381 -367 -1.47537 0.0328
NP_440216.1_1 Reverse -372 -386 -1.47537 0.0328
NP_440216.1_1 Forward -188 -174 -4.4253 0.111
NP_440216.1_1 Forward -166 -152 -9.73518 0.145
NP_440216.1_9 Reverse -346 -355 7.37455 0.286
NP_440216.1_9 Forward -129 -120 5.99792 0.289
NP_440216.1_9 Reverse -181 -190 5.89959 0.289
NP_440172.1_1 Forward -381 -371 16.303 0.00854
NP_440172.1_1 Reverse -157 -167 16.303 0.00854
NP_440172.1_1 Reverse -372 -382 15.0247 0.00945
NP_440172.1_1 Forward -166 -156 15.0247 0.00945
NP_440172.1_1 Forward -365 -355 7.45319 0.0789
NP_440172.1_1 Forward -188 -178 7.45319 0.0789
NP_440172.1_1 Forward -353 -343 5.19158 0.149
NP_440172.1_1 Forward -118 -108 4.10993 0.205
NP_440172.1_1 Reverse -344 -354 2.63497 0.274
NP_442015.1_10 Reverse -368 -381 12.2123 0.0372
NP_442015.1_10 Forward -385 -372 1.49425 0.204
NP_442015.1_10 Forward -170 -157 1.49425 0.204
NP_442015.1_10 Reverse -153 -166 0.510939 0.224
NP_442015.1_10 Forward -357 -344 -1.16069 0.297
NP_441226.1_7 Forward -380 -373 14.4934 0.0123
NP_441226.1_7 Reverse -373 -380 14.4934 0.0123
NP_441226.1_7 Forward -165 -158 14.4934 0.0123
NP_441226.1_7 Reverse -158 -165 14.4934 0.0123
NP_440198.1_3 Forward -351 -332 14.0599 0.277
NP_442834.1_9 Forward -377 -358 6.88262 0.24
NP_441111.1_7 Forward -380 -372 18.7023 0.00294
NP_441111.1_7 Forward -165 -157 18.7023 0.00294
NP_441111.1_7 Reverse -373 -381 18.7023 0.00294
NP_441111.1_7 Reverse -158 -166 18.7023 0.00294
NP_442379.1_10 Forward -388 -371 1.51381 0.223
NP_442379.1_10 Reverse -150 -167 -3.5994 0.264
NP_441766.1_2 Forward -381 -372 17.5026 0.00297
NP_441766.1_2 Reverse -372 -381 17.5026 0.00297
NP_441766.1_2 Forward -166 -157 17.5026 0.00297
NP_441766.1_2 Reverse -157 -166 17.5026 0.00297
NP_440416.1_1 Reverse -219 -238 -13.0786 0.28
NP_440416.1_9 Forward -376 -357 -7.17871 0.0972
NP_440416.1_9 Forward -360 -341 -9.53865 0.133
NP_440416.1_9 Reverse -349 -368 -13.8652 0.171
NP_440416.1_9 Reverse -262 -281 -16.2252 0.21
NP_440416.1_9 Forward -388 -369 -17.4051 0.239
NP_443052.1_8 Forward -176 -157 2.55606 0.0545
NP_442403.1_9 Forward -200 -181 5.211 0.213
NP_440591.1_9 Forward -360 -342 12.5072 0.0935
NP_440591.1_9 Forward -195 -177 4.6407 0.273
NP_440261.1_5 Reverse -158 -171 -2.73398 0.0924
NP_440261.1_5 Forward -352 -339 -4.79893 0.17
NP_440261.1_5 Forward -380 -367 -10.1088 0.201
NP_440261.1_5 Forward -165 -152 -10.5021 0.201
NP_440988.1_10 Reverse -274 -288 5.86695 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGTATCCTTTGAAGGTTTGGCGATCGCCCATGTCGTCGATGGCTTTGGCCATGGCCTGGCGACAAGCAAGGGGCAGGGGTTCCGTTACATCTCCAATACCAAGTTTGATCACCTGGGCGTTAGGATTGGCAGTGGTGAAAGCATTTACCCGCCGAGCAATTTCGGGAAACAGGTAACCGGCTTTCAGTTTGAGATAGTTGTCGTTGATACTGGCCATGGCTTGGTGATTAAAGGGCGATCGCCATTATAAAAGGTGAGTTACCCCTCGCCCCAGGGGAAATGGCAATGGGTTTATGCTCGCTCCAATCAATACTGCTCCCGTTGGTTTAATCATGGTGACGGCCATAGCTAGTCCAAATTTCTGCTAAAACCTATCCTTAACACCCCCATCGAACATTT

CDS

ATGTCCCAGTGGATCACAGAATGGATTCCCCAAGTAATGAATCAATTGGGCTATGGGGGAATTAGCCTTTTAATGTTTTTGGAAAACTTATTTCCTCCCATTCCGTCTGAGTTGATCATGCCCTTAGCTGGTTTTGCCGTTGCCCAGGGAAAATTGGAATTATTCCCGGCGATCGTTGCAGGTATTATCGGTACAATTCTGGGAGCTTATCCCTGGTACTACATCGGTAAATGGGTCAGCGAAGAAAGGCTAGAACAACTGGCTGACCGTTATGGTAAATGGATTGGCCTAGACGCCAAAGATATCCATAAATCGAACGTTTGGTTTGGTCGCTATGGCCATCAATCCGTCTTTTTTGGACGCCTAGTGCCTGGTATTCGTACCATTGTTTCCTTGCCCGCAGGCGTCAATGCCATGGGTTTGATTTCCTTTACTCTCTACAGTTTGGGGGGCATATCTCTCTGGGTAACTTTTTTAGCTAGCGCAGGTTACAAACTGGGTGATCATTACGAACTGGTGGAGCAATATTTGGGGCCAGTGTCAAAAATTGTCCTAGTTAGTATAGTCGCTATTCTTGTGCTGTTAATTGTTCGCAAACAGCTACGTCGAAGGGCTTAA

Protein

MSQWITEWIPQVMNQLGYGGISLLMFLENLFPPIPSELIMPLAGFAVAQGKLELFPAIVAGIIGTILGAYPWYYIGKWVSEERLEQLADRYGKWIGLDAKDIHKSNVWFGRYGHQSVFFGRLVPGIRTIVSLPAGVNAMGLISFTLYSLGGISLWVTFLASAGYKLGDHYELVEQYLGPVSKIVLVSIVAILVLLIVRKQLRRRA