Your browser is old and dusty. Try Google Chrome!

Details for slr0493

ORF slr0493
Accession NP_442253.1
Symbol
Category Sugars
Definition similar to mannose-1-phosphate guanylyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -112 -98 11.3077 0.249
NP_441061.1_2 Reverse -262 -276 6.98109 0.11
NP_441061.1_2 Forward -269 -255 1.86788 0.181
NP_440557.1_1 Forward -269 -250 0.58944 0.265
NP_440795.1_7 Forward -269 -262 14.6904 0.0123
NP_440795.1_7 Reverse -262 -269 14.6904 0.0123
NP_441418.1_6 Reverse -261 -280 -19.3717 0.0876
NP_441418.1_6 Forward -270 -251 -20.3551 0.111
NP_442291.1_5 Reverse -199 -215 -1.90808 0.204
NP_440897.1_6 Reverse -261 -280 18.5831 0.0216
NP_440897.1_6 Forward -270 -251 9.63507 0.0705
NP_440897.1_9 Forward -85 -67 12.4081 0.223
NP_441453.1_4 Reverse -261 -269 16.539 0.00633
NP_441453.1_4 Forward -270 -262 16.539 0.00633
NP_441453.1_7 Forward -262 -255 11.6422 0.298
NP_442151.1_6 Forward -270 -256 17.6008 0.00997
NP_442151.1_6 Reverse -261 -275 11.111 0.108
NP_443043.1_10 Forward -113 -94 6.58763 0.161
NP_441818.1_1 Forward -269 -258 17.1677 0.00948
NP_441465.1_8 Forward -281 -263 6.01734 0.279
NP_441630.1_3 Reverse -253 -272 -0.983855 0.29
NP_442623.1_3 Reverse -262 -281 -18.4868 0.263
NP_442173.1_1 Forward -269 -261 15.4574 0.00633
NP_442173.1_1 Reverse -262 -270 15.4574 0.00633
NP_442752.1_4 Forward -270 -263 13.8055 0.0199
NP_442752.1_4 Reverse -261 -268 13.8055 0.0199
NP_443027.1_4 Forward -272 -262 14.828 0.0437
NP_443027.1_4 Reverse -259 -269 7.35486 0.24
NP_442975.1_10 Forward -274 -260 13.077 0.0459
NP_442975.1_10 Reverse -257 -271 5.1122 0.233
NP_440784.1_7 Forward -269 -262 15.9687 0.0123
NP_440784.1_7 Reverse -262 -269 15.9687 0.0123
NP_442861.1_1 Forward -238 -219 18.1907 0.19
NP_441250.1_5 Reverse -28 -47 14.0599 0.291
NP_442000.2_3 Forward -102 -83 18.1907 0.232
NP_440110.1_8 Reverse -259 -278 0.786102 0.211
NP_442062.1_3 Forward -331 -312 3.04771 0.212
NP_442062.1_8 Reverse -261 -271 19.4496 0.000558
NP_442062.1_8 Forward -270 -260 17.6796 0.00193
NP_440761.1_4 Reverse -256 -275 -13.2752 0.257
NP_440735.1_2 Forward -101 -82 18.0187 0.275
NP_440304.1_4 Reverse -259 -269 18.9579 0.00406
NP_440304.1_4 Forward -272 -262 10.8948 0.051
NP_442242.1_4 Forward -269 -262 14.3954 0.0124
NP_442242.1_4 Reverse -262 -269 14.3954 0.0124
NP_441594.1_6 Reverse -252 -271 -0.39387 0.299
NP_442196.1_10 Reverse -259 -278 13.3725 0.201
NP_442110.1_7 Forward -270 -256 11.6026 0.0595
NP_442110.1_7 Reverse -261 -275 3.8345 0.21
NP_441083.1_5 Forward -270 -260 19.3512 0.000718
NP_441083.1_5 Reverse -261 -271 11.3864 0.0159
NP_439957.1_10 Forward -14 -4 17.188 0.277
NP_442827.1_8 Forward -278 -259 7.4718 0.0962
NP_442827.1_8 Reverse -253 -272 0.588665 0.203
NP_441738.1_2 Forward -268 -261 15.28 0.0102
NP_441738.1_2 Reverse -263 -270 15.28 0.0102
NP_441738.1_2 Reverse -355 -362 6.72528 0.236
NP_441558.1_5 Reverse -259 -278 5.89931 0.236
NP_440209.1_1 Reverse -261 -269 18.1123 0.00295
NP_440209.1_1 Forward -270 -262 18.1123 0.00295
NP_442889.1_8 Forward -273 -259 10.2254 0.0882
NP_442889.1_8 Reverse -258 -272 9.24208 0.101
NP_440178.1_7 Reverse -260 -279 -2.55715 0.038
NP_440178.1_7 Reverse -184 -203 -20.945 0.204
NP_442570.1_3 Forward -272 -253 -6.09707 0.255
NP_441716.1_1 Forward -270 -256 3.63784 0.259
NP_442111.1_4 Reverse -260 -274 16.2242 0.0166
NP_442111.1_4 Forward -271 -257 2.16287 0.286
NP_440906.1_5 Forward -269 -262 15.8704 0.0124
NP_440906.1_5 Reverse -262 -269 15.8704 0.0124
NP_442596.1_10 Reverse -64 -83 7.57094 0.292
NP_440747.1_10 Reverse -258 -270 -1.92764 0.0192
NP_440747.1_10 Forward -273 -261 -2.1243 0.0225
NP_441130.1_10 Forward -272 -258 11.701 0.106
NP_441486.1_1 Forward -273 -259 11.5043 0.016
NP_441486.1_1 Reverse -258 -272 10.7177 0.0189
NP_442634.1_4 Reverse -259 -273 -3.44199 0.161
NP_441265.1_3 Reverse -255 -269 3.04785 0.181
NP_440842.1_10 Forward -265 -251 3.53951 0.255
NP_440842.1_10 Reverse -90 -104 0.786239 0.299
NP_441014.1_10 Reverse -260 -279 0.981987 0.236
NP_442848.1_1 Reverse -255 -269 -2.45868 0.263
NP_443018.1_3 Forward -269 -262 14.8871 0.0123
NP_443018.1_3 Reverse -262 -269 14.8871 0.0123
NP_440376.1_1 Forward -270 -261 19.4693 0.000692
NP_440376.1_1 Reverse -261 -270 19.4693 0.000692
NP_440376.1_1 Reverse -91 -100 3.04799 0.21
NP_442687.1_7 Reverse -260 -270 18.5646 0.0028
NP_442687.1_7 Forward -271 -261 15.8113 0.0125
NP_441846.1_10 Forward -209 -190 -23.6 0.294
NP_441422.1_7 Reverse -51 -68 -8.51595 0.273
NP_442658.1_1 Forward -272 -262 15.9091 0.00966
NP_442658.1_1 Reverse -259 -269 14.8275 0.0188
NP_442658.1_1 Reverse -329 -339 5.68278 0.258
NP_441414.1_9 Reverse -261 -280 17.109 0.00979
NP_440720.1_1 Reverse -250 -269 11.9958 0.124
NP_442321.1_1 Reverse -329 -348 0.294447 0.158
NP_441958.1_5 Reverse -260 -270 20.5312 0.000966
NP_441958.1_5 Forward -271 -261 12.2714 0.00183
NP_441127.1_1 Reverse -147 -161 12.1926 0.215
NP_442836.1_3 Reverse -227 -246 17.7819 0.199
NP_442685.1_2 Reverse -113 -123 17.0896 0.11
NP_439990.1_5 Reverse -172 -185 6.31247 0.244
NP_442690.1_1 Reverse -380 -399 -15.8318 0.28
NP_442911.1_2 Forward -280 -261 15.0441 0.0111
NP_442911.1_2 Forward -72 -53 -5.80207 0.167
NP_441580.1_6 Forward -281 -262 -7.4737 0.242
NP_440153.1_5 Reverse -262 -276 1.76955 0.245
NP_440993.1_2 Forward -275 -259 2.02515 0.272
NP_440993.1_2 Reverse -256 -272 1.5335 0.279
NP_440602.1_8 Forward -270 -256 9.5377 0.298
NP_440138.1_1 Reverse -18 -36 7.58986 0.227
NP_441099.1_5 Forward -280 -261 -9.44032 0.223
NP_442002.1_1 Forward -211 -193 -9.51896 0.281
NP_442002.1_9 Reverse -260 -267 14.1004 0.074
NP_442002.1_9 Forward -257 -250 11.1505 0.185
NP_442002.1_9 Forward -271 -264 10.7572 0.185
NP_442438.1_10 Forward -275 -261 10.1277 0.0579
NP_442438.1_10 Reverse -256 -270 7.17775 0.0987
NP_441000.1_5 Reverse -217 -236 9.7334 0.214
NP_441000.1_6 Reverse -260 -274 -3.04867 0.221
NP_441000.1_6 Forward -271 -257 -5.01529 0.257
NP_442771.1_1 Reverse -259 -277 8.47561 0.0397
NP_442771.1_1 Forward -272 -254 2.47742 0.0703
NP_440147.1_4 Forward -272 -259 3.65753 0.183
NP_440147.1_4 Reverse -259 -272 2.67422 0.203
NP_441550.1_8 Reverse -259 -269 15.4175 0.0132
NP_441550.1_8 Forward -272 -262 6.0761 0.214
NP_441916.1_7 Reverse -261 -271 18.4663 0.00144
NP_441916.1_7 Forward -270 -260 16.893 0.00407
NP_440465.1_4 Forward -271 -252 13.7658 0.184
NP_441041.1_4 Reverse -261 -280 12.7825 0.0234
NP_441041.1_4 Reverse -282 -301 -12.8819 0.276
NP_441041.1_4 Forward -220 -201 -13.6686 0.293
NP_441041.1_7 Reverse -258 -270 13.2483 0.049
NP_442396.1_5 Forward -274 -261 7.29578 0.208
NP_442004.1_6 Forward -270 -256 2.16287 0.273
NP_441725.1_5 Forward -269 -259 21.0229 0.00533
NP_441725.1_5 Reverse -262 -272 11.2881 0.0247
NP_439966.1_7 Forward -272 -262 18.4657 0.00473
NP_439966.1_7 Reverse -259 -269 9.12434 0.119
NP_439966.1_9 Forward -272 -263 0.983037 0.253
NP_442941.1_3 Reverse -262 -272 11.4848 0.0116
NP_442941.1_3 Forward -269 -259 11.3864 0.0116
NP_440289.1_2 Reverse -258 -271 15.9489 0.00946
NP_440289.1_2 Forward -273 -260 14.6706 0.0107
NP_442281.1_1 Reverse -256 -270 20.2551 0.00194
NP_442281.1_1 Forward -275 -261 11.012 0.0511
NP_440177.1_1 Reverse -86 -104 3.65739 0.291
NP_442256.1_2 Reverse -259 -277 -5.19239 0.214
NP_440437.1_1 Reverse -255 -274 4.916 0.094
NP_440437.1_1 Forward -276 -257 4.03102 0.112
NP_440498.1_1 Forward -279 -261 0.117479 0.218
NP_442982.1_5 Reverse -251 -270 5.40766 0.158
NP_440375.1_8 Reverse -262 -281 8.84924 0.148
NP_441644.1_6 Forward -270 -260 15.7125 0.0048
NP_441644.1_6 Reverse -261 -271 10.1076 0.0628
NP_440867.1_10 Forward -271 -252 3.93269 0.283
NP_442215.1_2 Forward -272 -256 17.7581 0.0139
NP_442029.1_6 Forward -214 -195 3.24438 0.282
NP_440253.1_2 Reverse -261 -279 4.73903 0.1
NP_440253.1_2 Reverse -360 -378 -1.16082 0.234
NP_440253.1_2 Forward -270 -252 -2.24246 0.262
NP_440929.1_8 Forward -270 -261 19.2726 0.000701
NP_440929.1_8 Reverse -261 -270 19.2726 0.000701
NP_440566.1_6 Reverse -259 -278 10.4225 0.258
NP_442933.1_10 Forward -270 -261 17.601 0.00325
NP_442933.1_10 Reverse -261 -270 17.601 0.00325
NP_441310.1_10 Forward -132 -122 15.2073 0.204
NP_441751.2_8 Forward -269 -255 -3.83532 0.156
NP_442926.1_5 Forward -275 -256 9.78484 0.267
NP_440096.1_5 Forward -292 -273 7.07928 0.271
NP_442554.1_8 Forward -269 -259 14.828 0.0108
NP_442554.1_8 Reverse -262 -272 13.8447 0.0145
NP_441762.1_7 Reverse -260 -272 11.4454 0.0142
NP_441762.1_7 Forward -271 -259 2.20226 0.0676
NP_442142.1_4 Reverse -258 -271 16.4399 0.0264
NP_442292.1_1 Reverse -262 -271 9.63616 0.0183
NP_442292.1_1 Forward -269 -260 9.53783 0.0183
NP_443009.1_5 Reverse -260 -271 20.6093 0.001
NP_443009.1_5 Forward -271 -260 9.10461 0.0965
NP_442408.2_1 Forward -270 -251 0.294447 0.202
NP_441715.1_4 Reverse -262 -272 16.303 0.0117
NP_441715.1_4 Forward -269 -259 7.25653 0.108
NP_441448.1_1 Forward -242 -223 3.34271 0.297
NP_440777.1_8 Forward -45 -26 20.8456 0.104
NP_442076.1_5 Forward -322 -303 5.11266 0.293
NP_441198.1_8 Reverse -259 -269 13.076 0.108
NP_441468.1_1 Forward -269 -262 15.8704 0.0124
NP_441468.1_1 Reverse -262 -269 15.8704 0.0124
NP_441020.2_6 Reverse -259 -276 18.0334 0.0147
NP_441020.2_6 Forward -272 -255 17.7384 0.0169
NP_441673.1_1 Forward -270 -261 20.8459 0.000698
NP_441673.1_1 Reverse -261 -270 20.8459 0.000698
NP_442253.1_8 Forward -203 -185 25.1919 0.014
NP_441826.1_2 Reverse -255 -269 14.6509 0.0196
NP_441826.1_2 Forward -276 -262 5.1128 0.0978
NP_442811.1_2 Forward -114 -95 -0.787193 0.252
NP_442868.1_6 Reverse -259 -269 9.22315 0.0527
NP_442868.1_6 Forward -272 -262 0.963343 0.205
NP_440806.1_1 Forward -125 -107 7.19731 0.273
NP_442361.1_3 Reverse -255 -268 11.6223 0.243
NP_442361.1_3 Forward -276 -263 10.639 0.272
NP_442808.1_1 Forward -271 -261 18.4657 0.00201
NP_442808.1_1 Reverse -260 -270 8.73102 0.0481
NP_442775.1_6 Forward -275 -256 12.3892 0.277
NP_442630.1_5 Forward -123 -104 12.8808 0.263
NP_442542.1_2 Forward -272 -259 11.229 0.114
NP_442542.1_9 Reverse -254 -268 8.06211 0.173
NP_442050.1_5 Reverse -259 -269 15.8108 0.0091
NP_442050.1_5 Forward -272 -262 9.12434 0.193
NP_442342.1_9 Forward -272 -256 2.8118 0.282
NP_440558.1_2 Reverse -285 -304 -2.0655 0.222
NP_440558.1_2 Forward -291 -272 -5.21209 0.254
NP_442789.1_4 Reverse -259 -278 -2.95047 0.246
NP_441878.1_6 Reverse -260 -270 20.2362 0.0046
NP_441878.1_6 Forward -271 -261 10.4031 0.0176
NP_441036.1_8 Forward -271 -261 17.7779 0.000554
NP_441036.1_8 Reverse -260 -270 8.4365 0.174
NP_441557.1_5 Forward -270 -261 19.9609 0.000699
NP_441557.1_5 Reverse -261 -270 19.9609 0.000699
NP_441445.1_1 Reverse -76 -95 4.22769 0.197
NP_441445.1_1 Forward -296 -277 -0.688862 0.3
NP_442066.2_4 Forward -270 -251 -9.24366 0.296
NP_441308.1_8 Forward -272 -262 10.1081 0.22
NP_442183.1_1 Reverse -261 -275 12.4876 0.0579
NP_442183.1_1 Forward -270 -256 10.9143 0.078
NP_442347.1_2 Reverse -262 -271 11.1111 0.056
NP_442347.1_2 Forward -269 -260 3.34298 0.284
NP_441037.1_4 Reverse -259 -269 9.65667 0.21
NP_441037.1_4 Forward -272 -262 7.02532 0.237
NP_441633.1_3 Forward -272 -259 5.62415 0.0481
NP_441633.1_3 Reverse -259 -272 -5.88057 0.236
NP_440136.1_2 Forward -269 -262 15.9687 0.0123
NP_440136.1_2 Reverse -262 -269 15.9687 0.0123
NP_442590.1_10 Forward -276 -257 7.7676 0.219
NP_442998.1_5 Forward -258 -248 7.25653 0.298
NP_442998.1_10 Forward -268 -261 15.5754 0.0102
NP_442998.1_10 Reverse -263 -270 15.5754 0.0102
NP_440899.1_8 Reverse -238 -257 -10.227 0.277
NP_440299.1_1 Forward -274 -261 20.5698 0.00128
NP_440299.1_1 Reverse -257 -270 10.8351 0.0529
NP_441799.1_1 Reverse -257 -271 6.98048 0.155
NP_441799.1_9 Reverse -260 -279 -0.39387 0.213
NP_441007.1_10 Reverse -256 -269 1.00259 0.209
NP_442201.1_10 Forward -281 -262 -13.9635 0.28
NP_440256.1_1 Reverse -258 -277 8.35759 0.0236
NP_440256.1_1 Forward -273 -254 -8.94866 0.27
NP_441559.1_8 Forward -275 -261 -6.39192 0.277
NP_440915.1_6 Forward -274 -260 13.1759 0.0194
NP_440915.1_6 Reverse -257 -271 6.3911 0.0826
NP_441296.1_4 Forward -67 -48 15.5357 0.267
NP_440717.1_3 Forward -267 -253 10.6187 0.231
NP_441704.1_8 Forward -281 -262 5.40686 0.294
NP_442866.1_1 Forward -275 -256 4.52268 0.151
NP_440026.1_4 Reverse -258 -277 9.43923 0.253
NP_440695.1_5 Reverse -261 -280 5.89931 0.17
NP_441939.1_3 Forward -269 -250 11.9958 0.104
NP_442993.1_1 Forward -270 -254 -6.92296 0.146
NP_442993.1_1 Reverse -177 -193 -10.1679 0.21
NP_442386.1_9 Forward -271 -262 15.7322 0.0144
NP_442386.1_9 Reverse -260 -269 6.39082 0.219
NP_441750.1_4 Forward -274 -255 5.40766 0.186
NP_441340.1_5 Forward -269 -262 15.6737 0.0124
NP_441340.1_5 Reverse -262 -269 15.6737 0.0124
NP_441340.1_9 Forward -47 -37 16.0642 0.194
NP_440137.1_10 Reverse -277 -295 17.0296 0.271
NP_441947.1_4 Reverse -250 -269 11.4058 0.259
NP_440059.1_3 Reverse -205 -224 5.01354 0.299
NP_442240.1_1 Forward -289 -270 5.30853 0.264
NP_442714.1_5 Reverse -148 -167 -0.0988766 0.263
NP_441027.1_1 Reverse -244 -258 11.4053 0.277
NP_440586.1_8 Forward -269 -262 13.2151 0.026
NP_440586.1_8 Reverse -262 -269 13.2151 0.026
NP_442251.1_6 Forward -269 -262 15.2804 0.0124
NP_442251.1_6 Reverse -262 -269 15.2804 0.0124
NP_441262.1_3 Reverse -261 -268 14.7888 0.0223
NP_441262.1_3 Forward -270 -263 14.7888 0.0223
NP_443051.1_1 Reverse -260 -269 18.0926 0.00402
NP_443051.1_1 Forward -271 -262 10.4228 0.00754
NP_442294.1_5 Reverse -179 -189 18.3679 0.232
NP_440439.1_1 Forward -273 -260 10.2457 0.0372
NP_440439.1_1 Reverse -258 -271 0.215946 0.199
NP_440372.1_2 Forward -269 -262 16.3621 0.0124
NP_440372.1_2 Reverse -262 -269 16.3621 0.0124
NP_441803.1_2 Forward -275 -256 8.65258 0.112
NP_439977.1_5 Forward -276 -257 6.68596 0.128
NP_440139.1_1 Forward -276 -257 17.1082 0.0474
NP_440139.1_1 Reverse -255 -274 12.9783 0.0697
NP_441572.1_7 Reverse -255 -274 -2.36049 0.193
NP_440267.1_2 Reverse -256 -270 6.48882 0.228
NP_442384.1_10 Reverse -261 -274 16.0472 0.00946
NP_442384.1_10 Forward -270 -257 10.639 0.0428
NP_441877.1_5 Reverse -222 -241 0.58944 0.276
NP_441877.1_7 Reverse -48 -67 3.24359 0.218
NP_441018.1_7 Forward -116 -97 7.07928 0.277
NP_442262.1_10 Forward -269 -262 14.1988 0.0123
NP_442262.1_10 Reverse -262 -269 14.1988 0.0123
NP_441689.1_5 Reverse -259 -269 8.63269 0.132
NP_441689.1_5 Forward -272 -262 8.53436 0.132
NP_442244.1_3 Forward -267 -248 5.80098 0.238
NP_440163.1_10 Forward -273 -263 14.238 0.102
NP_440344.1_10 Reverse -254 -271 8.20031 0.0113
NP_440344.1_10 Forward -277 -260 -6.746 0.114
NP_441060.1_3 Reverse -143 -162 11.0125 0.204
NP_440562.1_3 Forward -269 -252 9.67528 0.15
NP_440297.1_9 Forward -269 -259 19.0562 0.0359
NP_440297.1_9 Reverse -262 -272 9.32148 0.0917
NP_442280.1_1 Reverse -261 -280 3.24438 0.287
NP_441592.1_4 Forward -270 -251 -1.27885 0.253
NP_441896.1_3 Reverse -252 -271 -2.75381 0.289
NP_440894.1_10 Forward -275 -256 13.9625 0.104
NP_440894.1_10 Reverse -256 -275 5.89931 0.227
NP_440999.1_9 Forward -274 -260 3.04785 0.137
NP_440888.1_2 Reverse -261 -275 20.2551 0.000855
NP_440888.1_2 Forward -270 -256 11.9953 0.0539
NP_440491.1_1 Reverse -258 -277 19.2941 0.0298
NP_440052.1_5 Forward -281 -262 6.19431 0.107
NP_439969.1_3 Forward -275 -256 -0.885524 0.271
NP_442277.1_4 Reverse -252 -271 1.27698 0.285
NP_441123.1_6 Reverse -253 -271 13.6872 0.133
NP_441543.1_2 Reverse -262 -271 18.486 0.00236
NP_441543.1_2 Forward -269 -260 9.34117 0.0818
NP_442845.1_2 Forward -270 -256 4.52282 0.258
NP_441319.1_8 Forward -276 -258 5.82068 0.277
NP_441469.1_8 Forward -271 -262 16.126 0.00797
NP_441469.1_8 Reverse -260 -269 13.3727 0.073
NP_443064.1_6 Forward -270 -260 13.8273 0.0796
NP_442578.1_7 Forward -269 -262 14.5921 0.026
NP_442578.1_7 Reverse -262 -269 14.5921 0.026
NP_440710.1_1 Forward -278 -260 -0.7675 0.176
NP_440220.1_4 Reverse -287 -306 -3.34455 0.286
NP_441462.1_2 Forward -270 -260 20.1379 0.000967
NP_441462.1_2 Reverse -261 -271 11.5831 0.00406
NP_441621.1_7 Reverse -259 -273 -5.21195 0.248
NP_441929.1_3 Reverse -110 -129 5.40766 0.266
NP_443062.1_1 Reverse -261 -279 16.3465 0.031
NP_443062.1_1 Reverse -200 -218 3.47554 0.297
NP_443062.1_6 Reverse -253 -272 1.96607 0.264
NP_442204.1_1 Reverse -257 -268 0.451995 0.281
NP_442204.1_1 Forward -274 -263 0.255333 0.282
NP_442204.1_5 Reverse -251 -270 18.0924 0.0308
NP_440516.1_8 Forward -270 -261 16.9127 0.00442
NP_440516.1_8 Reverse -261 -270 16.9127 0.00442
NP_442428.1_4 Forward -271 -252 8.75091 0.17
NP_442428.1_4 Reverse -260 -279 1.47442 0.296
NP_442428.1_5 Forward -269 -262 15.8704 0.0124
NP_442428.1_5 Reverse -262 -269 15.8704 0.0124
NP_441790.1_3 Reverse -262 -281 14.2574 0.033
NP_440673.1_3 Forward -268 -261 12.4288 0.0426
NP_440673.1_3 Reverse -263 -270 12.4288 0.0426
NP_440673.1_7 Forward -281 -262 8.84924 0.122
NP_441052.1_2 Reverse -261 -271 10.5014 0.0285
NP_441052.1_2 Forward -270 -260 10.4031 0.0285
NP_442219.1_9 Reverse -262 -271 8.35786 0.0681
NP_442219.1_9 Forward -269 -260 8.25953 0.0681
NP_440436.1_4 Reverse -262 -271 18.1905 0.00233
NP_440436.1_4 Forward -269 -260 15.9289 0.00508
NP_441884.1_9 Reverse -258 -277 -14.3569 0.138
NP_441884.1_9 Forward -273 -254 -23.1083 0.284
NP_442412.1_6 Forward -104 -85 20.3531 0.0338
NP_440648.1_1 Reverse -261 -280 13.6675 0.0817
NP_441086.1_3 Forward -134 -115 11.807 0.146
NP_441086.1_3 Forward -57 -38 11.6148 0.154
NP_441719.1_4 Forward -269 -262 16.3621 0.0124
NP_441719.1_4 Reverse -262 -269 16.3621 0.0124
NP_441733.1_10 Reverse -258 -271 9.65572 0.112
NP_441733.1_10 Forward -273 -260 5.72248 0.208
NP_441004.1_1 Reverse -255 -274 -17.7001 0.294
NP_441004.1_4 Forward -227 -217 11.2881 0.254
NP_442366.1_3 Forward -271 -253 14.4738 0.0228
NP_442366.1_3 Reverse -260 -278 3.55906 0.108
NP_440129.1_10 Reverse -254 -268 4.03116 0.185
NP_442873.1_3 Forward -280 -261 17.2065 0.0822
NP_441115.1_4 Forward -271 -253 16.1446 0.0314
NP_440328.1_4 Forward -296 -277 -0.000545616 0.265
NP_443054.1_2 Forward -272 -258 10.521 0.0761
NP_443054.1_2 Reverse -259 -273 4.91614 0.24
NP_441851.1_10 Reverse -260 -270 17.4829 0.0027
NP_441851.1_10 Forward -271 -261 16.008 0.00552
NP_441851.1_10 Forward -363 -353 7.74818 0.132
NP_441542.1_4 Forward -238 -224 4.81781 0.264
NP_441668.1_4 Reverse -245 -264 6.58763 0.162
NP_442515.1_1 Reverse -90 -104 13.3726 0.0278
NP_442515.1_1 Reverse -260 -274 4.32615 0.107
NP_442515.1_1 Forward -271 -257 -4.13031 0.298
NP_442515.1_1 Forward -193 -179 -4.81863 0.298
NP_442689.1_8 Reverse -226 -243 -8.51595 0.294
NP_440389.1_5 Forward -238 -219 11.3548 0.287
NP_440432.1_9 Forward -269 -254 -0.610089 0.166
NP_440432.1_9 Reverse -262 -277 -1.79006 0.167
NP_440474.1_8 Reverse -262 -276 6.39049 0.227
NP_442450.1_5 Reverse -259 -269 19.1546 0.0103
NP_442450.1_5 Forward -272 -262 9.32148 0.115
NP_440588.1_2 Reverse -252 -271 8.55425 0.0455
NP_441570.1_1 Reverse -261 -279 -7.94566 0.0989
NP_441570.1_1 Forward -270 -252 -9.81395 0.15
NP_441078.1_4 Forward -270 -261 19.6659 0.0007
NP_441078.1_4 Reverse -261 -270 19.6659 0.0007
NP_442729.1_8 Forward -274 -261 17.6205 0.0375
NP_442729.1_8 Reverse -87 -100 10.934 0.125
NP_442729.1_8 Reverse -257 -270 8.77074 0.125
NP_442906.1_3 Reverse -196 -215 4.916 0.2
NP_440526.1_3 Forward -269 -258 10.8746 0.0646
NP_441432.1_8 Reverse -260 -269 8.35786 0.0755
NP_441432.1_8 Forward -271 -262 8.25953 0.0755
NP_441432.1_8 Reverse -52 -61 3.04799 0.268
NP_442320.1_8 Forward -276 -262 13.4709 0.0144
NP_442320.1_8 Reverse -255 -269 4.32615 0.0511
NP_442344.1_7 Reverse -262 -281 2.26107 0.0638
NP_441732.1_2 Reverse -257 -273 -16.1661 0.165
NP_441732.1_2 Forward -274 -258 -16.5594 0.174
NP_440290.1_1 Reverse -231 -240 15.65 0.292
NP_442003.1_9 Reverse -262 -281 5.70265 0.235
NP_440760.1_1 Reverse -261 -280 -9.24366 0.083
NP_440760.1_1 Reverse -53 -72 -17.1101 0.192
NP_442797.1_7 Reverse -254 -272 1.19912 0.262
NP_440199.1_10 Reverse -258 -268 7.74818 0.231
NP_442489.1_7 Forward -270 -261 20.1576 0.000695
NP_442489.1_7 Reverse -261 -270 20.1576 0.000695
NP_440559.1_1 Forward -269 -260 17.306 0.00658
NP_440559.1_1 Reverse -262 -271 8.75118 0.0586
NP_441659.2_8 Forward -270 -260 19.3512 0.000966
NP_441659.2_8 Reverse -261 -271 11.9764 0.0147
NP_441022.1_1 Reverse -112 -121 13.7524 0.188
NP_442913.1_10 Reverse -252 -271 1.17943 0.146
NP_442913.1_10 Forward -279 -260 -3.73712 0.216
NP_440118.1_5 Forward -172 -153 -2.0655 0.242
NP_440779.1_5 Forward -270 -253 -4.68105 0.116
NP_442346.1_5 Reverse -260 -270 17.9746 0.00128
NP_442346.1_5 Forward -271 -261 9.02648 0.118
NP_440545.1_3 Forward -66 -49 -1.0428 0.162
NP_440545.1_3 Reverse -257 -274 -2.61609 0.189
NP_441856.1_3 Reverse -258 -277 -2.16383 0.255
NP_440831.1_3 Forward -279 -260 12.6001 0.139
NP_441923.1_8 Forward -75 -61 13.7659 0.286
NP_440459.1_2 Forward -279 -262 8.69197 0.253
NP_442603.1_7 Reverse -261 -275 12.5853 0.0979
NP_442603.1_7 Forward -270 -256 11.9953 0.107
NP_441888.1_7 Forward -275 -261 3.14618 0.225
NP_443022.1_2 Forward -295 -276 11.7983 0.263
NP_440449.1_6 Reverse -253 -271 8.74215 0.194
NP_441948.1_4 Reverse -254 -272 -2.3408 0.163
NP_441833.1_4 Forward -269 -262 15.9687 0.0124
NP_441833.1_4 Reverse -262 -269 15.9687 0.0124
NP_441112.1_6 Reverse -251 -270 -4.6221 0.297
NP_442162.1_9 Forward -269 -262 16.2637 0.0124
NP_442162.1_9 Reverse -262 -269 16.2637 0.0124
NP_440671.1_4 Reverse -255 -269 8.45605 0.198
NP_442140.1_3 Reverse -262 -272 8.33817 0.119
NP_442140.1_3 Forward -269 -259 5.68323 0.198
NP_441813.1_5 Forward -272 -262 17.188 0.00979
NP_441813.1_5 Reverse -259 -269 16.1063 0.01
NP_440590.1_4 Reverse -262 -275 11.524 0.0197
NP_440590.1_4 Forward -269 -256 4.05085 0.0642
NP_440567.1_1 Reverse -262 -276 13.0776 0.0213
NP_440567.1_1 Forward -269 -255 12.9793 0.0213
NP_440567.1_6 Reverse -178 -197 4.916 0.266
NP_442497.1_10 Forward -269 -260 19.8626 0.00532
NP_442497.1_10 Reverse -262 -271 10.4228 0.0087
NP_440821.1_4 Reverse -259 -269 19.8429 0.00399
NP_440821.1_4 Forward -272 -262 19.0562 0.00399
NP_441239.1_9 Forward -272 -260 16.8536 0.0155
NP_441239.1_9 Reverse -259 -271 14.297 0.0288
NP_441951.1_4 Reverse -255 -274 11.9958 0.208
NP_441892.1_1 Reverse -252 -269 -5.07437 0.273
NP_440604.1_6 Forward -270 -251 0.884433 0.166
NP_440604.1_6 Reverse -261 -280 -4.72043 0.257
NP_442044.1_1 Reverse -85 -104 -13.7669 0.279
NP_442044.1_9 Forward -270 -251 6.88262 0.2
NP_441017.1_6 Forward -274 -260 15.9285 0.0851
NP_441017.1_6 Reverse -257 -271 14.0603 0.157
NP_442216.1_4 Reverse -354 -362 15.3586 0.255
NP_440354.1_7 Forward -276 -258 16.1454 0.167
NP_440354.1_7 Reverse -255 -273 9.55725 0.224
NP_440546.1_4 Forward -270 -260 12.8578 0.0572
NP_440546.1_4 Reverse -261 -271 11.8882 0.0679
NP_440462.1_1 Reverse -141 -154 17.483 0.3
NP_440462.1_6 Forward -272 -262 15.418 0.0142
NP_440462.1_6 Reverse -259 -269 7.84651 0.0699
NP_442611.1_1 Reverse -261 -280 6.98095 0.153
NP_442611.1_1 Forward -270 -251 -2.55715 0.292
NP_440868.1_4 Forward -274 -262 1.61227 0.177
NP_442499.1_1 Reverse -262 -281 2.45773 0.289
NP_442479.1_9 Reverse -223 -242 -0.688862 0.21
NP_442479.1_9 Forward -243 -224 -2.95047 0.228
NP_441672.1_6 Reverse -188 -207 9.14342 0.294
NP_442402.1_4 Reverse -219 -238 -7.57277 0.276
NP_441848.1_4 Forward -51 -35 7.45517 0.288
NP_441848.1_7 Reverse -112 -131 -2.16459 0.262
NP_441848.1_7 Forward -123 -104 -2.8529 0.271
NP_441084.1_6 Reverse -259 -273 9.63499 0.273
NP_439942.1_2 Reverse -21 -40 15.0261 0.228
NP_442039.1_4 Forward -269 -262 15.1821 0.0124
NP_442039.1_4 Reverse -262 -269 15.1821 0.0124
NP_442837.1_3 Forward -269 -262 15.7721 0.0124
NP_442837.1_3 Reverse -262 -269 15.7721 0.0124
NP_439994.1_3 Forward -271 -252 13.9015 0.118
NP_442053.1_1 Forward -270 -261 18.3876 0.0007
NP_442053.1_1 Reverse -261 -270 18.3876 0.0007
NP_440505.1_3 Forward -272 -262 13.8447 0.0247
NP_440505.1_3 Reverse -259 -269 7.55152 0.151
NP_440505.1_3 Reverse -89 -99 4.50326 0.284
NP_441959.1_10 Reverse -260 -278 16.0557 0.178
NP_441252.1_6 Forward -259 -252 14.3954 0.168
NP_441203.1_1 Forward -269 -250 -0.688862 0.0636
NP_442009.1_9 Reverse -223 -242 8.35759 0.265
NP_440914.1_1 Reverse -261 -271 8.6151 0.186
NP_440914.1_1 Forward -270 -260 8.51751 0.186
NP_441011.1_8 Reverse -262 -271 16.9127 0.00602
NP_441011.1_8 Forward -269 -260 14.356 0.0249
NP_442101.1_10 Forward -278 -259 16.7157 0.0136
NP_442101.1_10 Reverse -253 -272 -6.29373 0.186
NP_442533.1_1 Reverse -258 -277 -15.6352 0.257
NP_442533.1_6 Forward -270 -261 17.2076 0.00137
NP_442533.1_6 Reverse -261 -270 17.2076 0.00137
NP_442533.1_6 Reverse -93 -102 2.55633 0.25
NP_442541.1_4 Reverse -7 -25 11.9164 0.262
NP_442229.1_3 Reverse -89 -106 13.7068 0.283
NP_441482.1_7 Reverse -255 -269 0.687908 0.0554
NP_441482.1_7 Forward -276 -262 -1.27871 0.0666
NP_441482.1_7 Reverse -47 -61 -5.01529 0.168
NP_439944.1_9 Forward -269 -259 17.3846 0.00516
NP_439944.1_9 Reverse -262 -272 10.3048 0.0887
NP_442269.1_10 Forward -67 -48 2.45773 0.276
NP_440116.1_8 Reverse -262 -281 -10.0303 0.297
NP_440007.1_9 Reverse -257 -271 4.71948 0.267
NP_441059.1_2 Forward -216 -197 -7.57203 0.291
NP_441602.1_3 Forward -275 -256 -4.13045 0.261
NP_441106.1_1 Forward -271 -262 18.191 0.0028
NP_441106.1_1 Reverse -260 -269 9.73449 0.0311
NP_439903.1_6 Forward -273 -254 1.6703 0.241
NP_439903.1_7 Forward -371 -352 4.916 0.281
NP_001035870.1_10 Forward -205 -186 17.3158 0.12
NP_441286.1_1 Forward -271 -259 14.3953 0.00424
NP_441286.1_1 Reverse -260 -272 5.05386 0.0259
NP_442674.1_2 Reverse -229 -248 6.88262 0.295
NP_440670.1_8 Forward -270 -261 18.3876 0.000699
NP_440670.1_8 Reverse -261 -270 18.3876 0.000699
NP_441479.1_9 Forward -270 -252 12.6055 0.293
NP_440886.1_7 Forward -271 -261 17.7774 0.0011
NP_440886.1_7 Reverse -260 -270 8.04271 0.0805
NP_442614.1_2 Forward -270 -256 6.98109 0.276
NP_439995.1_5 Forward -280 -261 4.62101 0.285
NP_442072.1_9 Reverse -260 -278 -3.6191 0.0368
NP_442072.1_9 Forward -271 -253 -21.712 0.212
NP_442401.1_2 Reverse -84 -103 10.3234 0.178
NP_441753.1_10 Forward -279 -260 1.96607 0.25
NP_440907.2_8 Forward -269 -259 9.81266 0.103
NP_440907.2_8 Reverse -262 -272 7.84605 0.117
NP_441021.1_1 Forward -269 -250 -7.57203 0.184
NP_441021.1_8 Reverse -256 -274 3.06741 0.237
NP_441463.1_3 Forward -280 -261 -6.68705 0.247
NP_441626.1_2 Forward -269 -262 15.7721 0.0124
NP_441626.1_2 Reverse -262 -269 15.7721 0.0124
NP_442794.1_1 Forward -274 -262 7.31547 0.142
NP_442615.1_1 Reverse -252 -270 3.75572 0.0518
NP_441962.1_4 Reverse -256 -275 -11.1119 0.238
NP_440387.1_1 Reverse -261 -277 15.5948 0.00527
NP_440387.1_1 Forward -270 -254 -0.531451 0.139
NP_441836.1_2 Forward -236 -217 -3.83545 0.244
NP_440114.1_10 Forward -270 -256 9.5377 0.169
NP_442323.1_7 Forward -275 -256 5.70185 0.202
NP_440766.1_4 Reverse -257 -271 18.0925 0.0255
NP_440766.1_4 Forward -274 -260 7.17775 0.0967
NP_441979.1_5 Forward -276 -257 -2.55715 0.147
NP_441979.1_5 Reverse -255 -274 -11.8003 0.228
NP_442930.1_1 Reverse -35 -45 9.91099 0.28
NP_439910.1_2 Forward -278 -261 -21.3973 0.183
NP_439910.1_2 Forward -317 -300 -22.3806 0.232
NP_440457.1_1 Reverse -257 -269 16.8536 0.0455
NP_440457.1_1 Forward -274 -262 7.02048 0.105
NP_440457.1_1 Reverse -268 -280 2.30059 0.214
NP_442680.1_5 Forward -50 -31 1.73297 0.237
NP_442680.1_5 Forward -257 -238 0.560681 0.263
NP_441436.1_8 Reverse -260 -279 8.16093 0.283
NP_442509.1_9 Forward -270 -260 17.3841 0.00128
NP_442509.1_9 Reverse -261 -271 16.2041 0.00739
NP_442936.1_10 Reverse -111 -125 8.88105 0.269
NP_440554.1_4 Reverse -262 -272 14.6313 0.02
NP_440554.1_4 Forward -269 -259 6.96153 0.107
NP_442862.1_3 Forward -166 -149 7.70866 0.253
NP_441885.1_5 Reverse -261 -271 11.4848 0.00668
NP_441885.1_5 Forward -270 -260 11.3864 0.00668
NP_442341.1_7 Forward -271 -257 16.8142 0.0155
NP_442341.1_7 Reverse -260 -274 16.8142 0.0155
NP_442341.1_9 Forward -272 -258 15.0436 0.0564
NP_443000.1_7 Reverse -259 -269 8.82982 0.0437
NP_443000.1_7 Forward -272 -262 8.73149 0.0437
NP_440507.2_3 Reverse -252 -271 8.4551 0.253
NP_441842.1_10 Reverse -254 -268 16.3225 0.0311
NP_441842.1_10 Forward -277 -263 8.45605 0.221
NP_440275.1_3 Reverse -259 -269 10.0098 0.0454
NP_440275.1_3 Forward -272 -262 8.4365 0.0602
NP_440091.1_1 Forward -274 -262 1.41561 0.197
NP_440091.1_1 Reverse -257 -269 1.41561 0.197
NP_441902.1_3 Forward -16 -6 13.3704 0.23
NP_442451.1_2 Forward -278 -259 -7.67036 0.237
NP_440149.1_8 Reverse -261 -280 3.83436 0.0895
NP_440216.1_1 Forward -270 -256 8.25939 0.0061
NP_440216.1_1 Reverse -261 -275 7.27608 0.00942
NP_440216.1_9 Reverse -143 -152 7.17789 0.286
NP_440172.1_1 Forward -270 -260 16.303 0.00854
NP_440172.1_1 Reverse -261 -271 8.73149 0.0586
NP_442015.1_10 Reverse -257 -270 11.229 0.0372
NP_442015.1_10 Forward -274 -261 10.5407 0.0391
NP_441226.1_7 Forward -269 -262 14.4934 0.0123
NP_441226.1_7 Reverse -262 -269 14.4934 0.0123
NP_441111.1_7 Forward -269 -261 18.7023 0.00294
NP_441111.1_7 Reverse -262 -270 18.7023 0.00294
NP_442379.1_10 Forward -277 -260 -0.846137 0.223
NP_441766.1_2 Forward -270 -261 17.5026 0.00297
NP_441766.1_2 Reverse -261 -270 17.5026 0.00297
NP_442417.1_5 Reverse -261 -275 20.5508 0.0158
NP_440416.1_1 Forward -173 -154 -7.96535 0.23
NP_440416.1_9 Forward -277 -258 -4.91709 0.0783
NP_440416.1_9 Reverse -254 -273 -15.6352 0.196
NP_443052.1_8 Reverse -251 -270 4.03102 0.0452
NP_443052.1_8 Forward -280 -261 1.96607 0.0587
NP_443052.1_8 Forward -304 -285 -10.9153 0.218
NP_442116.1_2 Reverse -102 -121 12.585 0.289
NP_442116.1_6 Forward -120 -103 10.2698 0.223
NP_440845.1_1 Forward -271 -252 -4.6221 0.233
NP_440261.1_5 Forward -269 -256 -0.767364 0.0655
NP_440261.1_5 Reverse -262 -275 -10.4038 0.201
NP_440988.1_10 Forward -96 -82 10.6108 0.187
NP_440988.1_10 Reverse -276 -290 3.9307 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAATGTTAGTAGCAGTCTATGTACCTAACCCGGGTCCGGGGAATGATGTTTCCACCCTGAGCCAGTGTGTCAAAGCTCAGTTAAGTAAACCGAAATGTCCGAAGCATTGGTTGCCCGTTTCGACCCTACGGCGATCGCCCTTGGGCAAATTAAACTACCAATTTTGGCAAACTTGGGCTACGGAGCAACTAGGGGTCGAAGAGGAGGAGTAACAGCAATAACCTGTGAGTATGGTTTATTTACCGACTTTGCCTAGGATTCAAGTAAGTCGGGGTAAACAAATTTTTGACGTTGATTGGTGCTGTCCCCATAGGAACCTAAACCCTAACTAAGCCGTTGTGTTAGCCTGGGTTAGAAAAAATTGTCGATGCGGTTAATTGTTGTTGAGGAAAAAGATTA

CDS

ATGATTGCCACTCCCCTTGCCCAAGCTGCCACCACCCCCAGTCATTTACCCACGGAAACCAGACCTTGGGGTTCTTTTACCACCCTGGAGGAGGGCAACGGTTACAAAATCAAACGCATCGAGGTCAACCCCGGCCATCGTCTCAGCCTACAAATGCACCATCATCGCAGTGAGCATTGGATTGTAGTCTCCGGCACCGCCCGCATCGTTTGTGGAGATAAAGAAGAACTTTTGGAACCAAATCAGTCCACCTATGTGCCCCAATGCACTGCCCATCGTCTGGAAAACCCTGGGGTAATTAAATTAGTTTTAATTGAAGTGCAGAATGGGGAATATCTGGGGGAAGACGATATTATCCGTTTTCAGGATGACTACGCCCGCGGCTAA

Protein

MIATPLAQAATTPSHLPTETRPWGSFTTLEEGNGYKIKRIEVNPGHRLSLQMHHHRSEHWIVVSGTARIVCGDKEELLEPNQSTYVPQCTAHRLENPGVIKLVLIEVQNGEYLGEDDIIRFQDDYARG