Your browser is old and dusty. Try Google Chrome!

Details for slr0477

ORF slr0477
Accession NP_442242.1
Symbol purN
Category Purine ribonucleotide biosynthesis
Definition phosphoribosylglycinamide formyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -348 -334 5.60446 0.132
NP_441061.1_2 Reverse -341 -355 -0.885388 0.242
NP_440795.1_7 Forward -348 -341 14.6904 0.0123
NP_440795.1_7 Reverse -341 -348 14.6904 0.0123
NP_441418.1_6 Reverse -340 -359 -8.94866 0.0273
NP_441418.1_6 Forward -349 -330 -18.6834 0.0837
NP_441418.1_6 Reverse -173 -192 -22.8133 0.186
NP_442291.1_5 Forward -350 -334 0.0585348 0.174
NP_441453.1_1 Forward -356 -338 6.1149 0.241
NP_441453.1_4 Reverse -340 -348 16.539 0.00633
NP_441453.1_4 Forward -349 -341 16.539 0.00633
NP_441453.1_4 Reverse -69 -77 4.73931 0.252
NP_441453.1_4 Forward -93 -85 3.95266 0.275
NP_441453.1_7 Reverse -242 -249 11.9372 0.298
NP_442151.1_6 Forward -349 -335 12.291 0.0771
NP_442151.1_6 Reverse -63 -77 6.78443 0.221
NP_442151.1_6 Reverse -340 -354 6.19444 0.244
NP_441818.1_1 Forward -348 -337 9.79292 0.232
NP_441818.1_6 Forward -356 -342 8.35772 0.274
NP_440226.1_1 Reverse -340 -359 3.6377 0.218
NP_441465.1_2 Reverse -206 -225 16.4509 0.256
NP_442623.1_3 Forward -348 -329 -18.2901 0.263
NP_440150.1_6 Reverse -337 -356 3.44104 0.248
NP_442173.1_1 Forward -348 -340 15.4574 0.00633
NP_442173.1_1 Reverse -341 -349 15.4574 0.00633
NP_442752.1_4 Forward -349 -342 13.8055 0.0199
NP_442752.1_4 Reverse -340 -347 13.8055 0.0199
NP_442752.1_4 Reverse -80 -87 12.4288 0.0388
NP_442752.1_4 Forward -182 -175 5.54565 0.194
NP_442752.1_4 Reverse -69 -76 4.26735 0.293
NP_443027.1_4 Reverse -338 -348 11.0914 0.107
NP_443027.1_4 Forward -351 -341 7.25653 0.24
NP_441812.1_3 Reverse -339 -353 9.83269 0.228
NP_442975.1_10 Forward -353 -339 1.96562 0.288
NP_440784.1_7 Forward -348 -341 15.9687 0.0123
NP_440784.1_7 Reverse -341 -348 15.9687 0.0123
NP_440061.1_9 Forward -351 -337 18.4851 0.00917
NP_442062.1_8 Forward -349 -339 17.3846 0.00193
NP_442062.1_8 Reverse -340 -350 10.3048 0.0493
NP_442062.1_8 Reverse -80 -90 3.91327 0.243
NP_440761.1_4 Forward -354 -335 -13.5702 0.257
NP_440304.1_4 Forward -351 -341 10.8948 0.051
NP_440304.1_4 Reverse -82 -92 4.3066 0.271
NP_440304.1_4 Reverse -338 -348 1.84832 0.299
NP_442242.1_1 Forward -51 -32 16.6052 0.28
NP_442242.1_4 Forward -348 -341 14.3954 0.0124
NP_442242.1_4 Reverse -341 -348 14.3954 0.0124
NP_442242.1_6 Forward -376 -360 21.1997 0.204
NP_440044.1_8 Forward -172 -153 -2.36049 0.262
NP_440908.1_7 Reverse -178 -188 17.8763 0.285
NP_441208.1_9 Forward -352 -338 7.76774 0.219
NP_441208.1_9 Reverse -233 -247 4.52282 0.299
NP_441594.1_6 Forward -188 -169 6.68596 0.187
NP_441594.1_6 Forward -191 -172 3.04771 0.238
NP_441594.1_6 Reverse -331 -350 2.65439 0.247
NP_442196.1_9 Reverse -265 -278 16.3422 0.297
NP_440370.1_10 Reverse -75 -94 9.73422 0.217
NP_440132.1_1 Reverse -338 -356 19.882 0.027
NP_442375.1_8 Reverse -143 -161 19.3903 0.11
NP_442110.1_7 Forward -349 -335 10.6193 0.0644
NP_441083.1_5 Forward -349 -339 20.3345 0.00053
NP_441083.1_5 Reverse -340 -350 11.2881 0.0159
NP_441083.1_5 Forward -182 -172 5.68323 0.11
NP_442827.1_8 Forward -190 -171 7.07848 0.0988
NP_441738.1_2 Forward -347 -340 15.28 0.0102
NP_441738.1_2 Reverse -342 -349 15.28 0.0102
NP_441558.1_5 Forward -351 -332 5.211 0.257
NP_440209.1_1 Reverse -340 -348 18.1123 0.00295
NP_440209.1_1 Forward -349 -341 18.1123 0.00295
NP_442889.1_1 Reverse -229 -248 -15.0452 0.286
NP_440447.1_1 Reverse -364 -382 4.44404 0.226
NP_441713.1_1 Reverse -334 -353 -16.1268 0.277
NP_442570.1_3 Reverse -338 -357 -7.17871 0.268
NP_441716.1_1 Forward -349 -335 10.7177 0.0936
NP_441327.1_5 Reverse -377 -386 14.651 0.192
NP_442111.1_4 Reverse -68 -82 17.2075 0.0109
NP_442111.1_4 Forward -350 -336 11.6026 0.0488
NP_442111.1_4 Reverse -339 -353 11.0127 0.0518
NP_441163.1_1 Forward -31 -14 6.72462 0.254
NP_440851.1_6 Reverse -12 -29 -0.354483 0.296
NP_440906.1_5 Forward -348 -341 15.8704 0.0124
NP_440906.1_5 Reverse -341 -348 15.8704 0.0124
NP_440747.1_10 Reverse -337 -349 26.5883 0.000317
NP_440747.1_10 Forward -352 -340 15.2803 0.0019
NP_440747.1_10 Forward -81 -69 -12.3507 0.27
NP_442973.1_5 Forward -358 -339 10.9142 0.259
NP_441486.1_1 Reverse -337 -351 -1.96703 0.175
NP_441486.1_1 Forward -352 -338 -3.04867 0.175
NP_441880.2_10 Forward -92 -74 8.86894 0.264
NP_442634.1_4 Reverse -338 -352 8.16106 0.0479
NP_442634.1_4 Reverse -82 -96 1.27789 0.149
NP_442634.1_4 Forward -351 -337 -1.5737 0.149
NP_441012.1_4 Forward -171 -158 13.9823 0.208
NP_443018.1_3 Forward -348 -341 14.8871 0.0123
NP_443018.1_3 Reverse -341 -348 14.8871 0.0123
NP_443018.1_3 Reverse -64 -71 10.6589 0.0967
NP_443018.1_3 Forward -71 -64 4.16902 0.278
NP_441316.1_7 Reverse -338 -353 5.19144 0.121
NP_441634.1_8 Reverse -338 -352 -3.24533 0.295
NP_440376.1_1 Forward -349 -340 19.4693 0.000692
NP_440376.1_1 Reverse -340 -349 19.4693 0.000692
NP_440376.1_1 Forward -182 -173 3.44131 0.203
NP_441857.1_5 Reverse -77 -95 3.46073 0.244
NP_441588.1_4 Reverse -342 -352 7.05986 0.178
NP_442687.1_7 Forward -350 -340 9.02648 0.0994
NP_442687.1_7 Reverse -339 -349 8.92815 0.0994
NP_442687.1_7 Reverse -276 -286 8.63316 0.104
NP_442687.1_7 Reverse -181 -191 7.64985 0.127
NP_442485.1_3 Forward -184 -165 -0.197208 0.252
NP_442485.1_3 Forward -348 -329 -4.22878 0.278
NP_442485.1_3 Reverse -36 -55 -5.99873 0.297
NP_441846.1_10 Reverse -355 -374 -14.2585 0.218
NP_442958.1_3 Reverse -329 -348 7.37428 0.156
NP_440642.1_10 Forward -384 -370 6.58715 0.225
NP_441013.1_2 Reverse -335 -353 -2.43913 0.282
NP_440042.1_1 Reverse -192 -211 7.96426 0.238
NP_440667.1_8 Forward -23 -4 13.8633 0.222
NP_441950.1_7 Reverse -10 -29 -5.70374 0.233
NP_442658.1_1 Forward -351 -341 13.0576 0.04
NP_442658.1_1 Reverse -338 -348 7.94438 0.199
NP_442658.1_1 Forward -175 -165 6.86274 0.214
NP_442658.1_1 Reverse -82 -92 6.17443 0.235
NP_442496.1_5 Reverse -7 -25 9.65558 0.217
NP_442205.1_9 Forward -188 -172 4.97508 0.143
NP_441478.1_6 Forward -346 -327 11.8967 0.229
NP_442937.1_5 Forward -190 -171 8.45592 0.22
NP_441317.1_4 Forward -388 -374 10.2279 0.29
NP_441958.1_5 Forward -350 -340 21.2195 0.000805
NP_441958.1_5 Reverse -339 -349 12.2714 0.00183
NP_442836.1_5 Reverse -334 -353 4.71934 0.204
NP_440950.1_8 Forward -248 -229 9.43522 0.298
NP_440203.1_5 Reverse -343 -353 11.091 0.205
NP_440984.1_7 Reverse -335 -349 9.63603 0.127
NP_440984.1_7 Forward -354 -340 9.43936 0.127
NP_439990.1_5 Reverse -335 -348 13.7856 0.0889
NP_442376.1_6 Forward -40 -21 5.30933 0.18
NP_442911.1_2 Reverse -330 -349 -2.65548 0.1
NP_440153.1_5 Forward -348 -334 11.3077 0.0763
NP_440153.1_8 Forward -93 -80 2.87088 0.21
NP_443055.1_6 Reverse -165 -183 1.49337 0.23
NP_440602.1_2 Reverse -335 -354 0.491109 0.294
NP_441129.1_3 Reverse -178 -197 -7.86702 0.162
NP_441129.1_3 Reverse -34 -53 -17.7985 0.29
NP_441099.1_5 Reverse -330 -349 9.24257 0.0328
NP_441099.1_5 Forward -359 -340 -4.91709 0.148
NP_441099.1_5 Reverse -163 -182 -5.70374 0.153
NP_441099.1_5 Forward -82 -63 -9.53865 0.226
NP_442002.1_9 Reverse -29 -36 9.97054 0.246
NP_440809.1_2 Forward -60 -41 -3.24547 0.283
NP_441424.1_6 Forward -353 -334 11.807 0.296
NP_442438.1_10 Reverse -335 -349 9.04604 0.0692
NP_440879.1_6 Forward -44 -25 -4.72043 0.29
NP_442771.1_1 Reverse -14 -32 -6.66736 0.168
NP_440484.1_3 Reverse -338 -352 9.14437 0.27
NP_440147.1_4 Forward -351 -338 20.5705 0.00219
NP_440147.1_4 Reverse -338 -351 8.18076 0.0546
NP_441550.1_8 Forward -351 -341 15.3192 0.0132
NP_441550.1_8 Reverse -338 -348 15.1225 0.0132
NP_441916.1_5 Reverse -325 -344 15.0441 0.273
NP_441916.1_7 Reverse -340 -350 18.9579 0.00144
NP_441916.1_7 Forward -349 -339 10.3048 0.0261
NP_441916.1_7 Reverse -84 -94 4.99491 0.15
NP_441916.1_10 Forward -175 -156 2.75272 0.241
NP_440345.1_3 Forward -140 -126 12.2346 0.247
NP_440465.1_10 Reverse -170 -189 0.884433 0.284
NP_441041.1_4 Reverse -63 -82 5.30933 0.0518
NP_441041.1_4 Reverse -340 -359 -11.8986 0.254
NP_441041.1_7 Forward -352 -340 14.4144 0.0348
NP_441041.1_7 Reverse -337 -349 7.51478 0.162
NP_441041.1_7 Reverse -378 -390 5.08534 0.278
NP_442396.1_5 Reverse -76 -89 5.52582 0.28
NP_440569.1_10 Reverse -123 -142 3.48503 0.278
NP_442004.1_6 Reverse -340 -354 2.45787 0.264
NP_441725.1_4 Reverse -335 -349 4.42388 0.278
NP_441725.1_4 Forward -83 -69 3.93223 0.278
NP_441725.1_4 Forward -354 -340 3.04726 0.279
NP_441725.1_5 Reverse -165 -175 5.09324 0.115
NP_441725.1_5 Forward -348 -338 2.04498 0.115
NP_441725.1_5 Reverse -341 -351 1.94665 0.115
NP_439966.1_7 Reverse -338 -348 15.3192 0.0152
NP_439966.1_7 Forward -351 -341 6.27276 0.185
NP_439966.1_9 Reverse -162 -171 6.29291 0.253
NP_442941.1_3 Forward -348 -338 19.2529 0.00262
NP_442941.1_3 Reverse -341 -351 11.0914 0.0116
NP_442941.1_3 Forward -77 -67 0.275027 0.222
NP_440289.1_2 Reverse -337 -350 -3.71729 0.267
NP_440289.1_2 Forward -352 -339 -4.89726 0.294
NP_440983.1_5 Forward -179 -160 3.24438 0.194
NP_440983.1_9 Reverse -143 -162 1.76941 0.292
NP_440260.1_7 Forward -395 -376 -4.13045 0.247
NP_440260.1_8 Forward -41 -23 4.14905 0.154
NP_440260.1_8 Forward -358 -340 -5.09406 0.273
NP_441678.1_9 Forward -245 -226 6.39097 0.175
NP_442281.1_1 Forward -354 -340 17.6985 0.00542
NP_442281.1_1 Reverse -335 -349 16.5185 0.00772
NP_441334.1_7 Reverse -338 -357 -19.0768 0.275
NP_442256.1_2 Reverse -338 -356 0.707465 0.115
NP_440437.1_1 Forward -84 -65 -5.21209 0.276
NP_442012.1_1 Forward -355 -336 4.32602 0.17
NP_441556.1_10 Reverse -335 -349 13.0446 0.182
NP_440498.1_1 Forward -358 -340 -3.12744 0.256
NP_440453.1_5 Reverse -381 -399 8.7706 0.246
NP_441644.1_6 Reverse -340 -350 19.0557 0.000803
NP_441644.1_6 Forward -349 -339 17.3841 0.00127
NP_442215.1_2 Forward -351 -335 7.92501 0.0666
NP_442215.1_2 Reverse -338 -354 -4.26803 0.23
NP_440253.1_2 Forward -349 -331 -3.22577 0.287
NP_440929.1_8 Forward -349 -340 19.2726 0.000701
NP_440929.1_8 Reverse -340 -349 19.2726 0.000701
NP_442933.1_10 Forward -349 -340 17.601 0.00325
NP_442933.1_10 Reverse -340 -349 17.601 0.00325
NP_442933.1_10 Reverse -84 -93 4.42462 0.246
NP_440891.1_8 Forward -257 -238 15.0348 0.233
NP_441751.2_8 Forward -348 -334 7.57108 0.0339
NP_441751.2_8 Reverse -341 -355 6.3911 0.0354
NP_441751.2_8 Forward -88 -74 -6.49025 0.269
NP_442554.1_8 Reverse -341 -351 16.4013 0.0065
NP_442554.1_8 Forward -348 -338 16.2046 0.0065
NP_442554.1_8 Forward -71 -61 10.5014 0.0454
NP_442554.1_8 Forward -92 -82 3.61828 0.218
NP_442554.1_8 Forward -342 -332 1.94665 0.288
NP_441762.1_7 Reverse -339 -351 0.333971 0.0747
NP_441762.1_7 Forward -350 -338 -6.64753 0.284
NP_442142.1_4 Reverse -337 -350 14.08 0.0317
NP_442142.1_4 Forward -352 -339 11.6217 0.054
NP_442142.1_4 Forward -194 -181 4.05029 0.234
NP_442292.1_1 Forward -348 -339 18.486 0.00229
NP_442292.1_1 Reverse -341 -350 17.5026 0.00435
NP_442292.1_1 Forward -71 -62 4.22796 0.181
NP_442476.1_6 Forward -348 -334 1.96621 0.199
NP_440895.1_6 Reverse -334 -347 9.75405 0.218
NP_441523.1_6 Forward -353 -334 3.14605 0.277
NP_443009.1_5 Reverse -339 -350 14.5128 0.02
NP_443009.1_5 Forward -350 -339 10.1862 0.0792
NP_443009.1_5 Reverse -172 -183 3.69644 0.282
NP_441715.1_4 Forward -348 -338 17.3846 0.0106
NP_441715.1_4 Reverse -341 -351 7.35486 0.108
NP_440357.1_3 Forward -184 -165 10.7175 0.203
NP_441448.1_1 Forward -50 -31 12.0942 0.178
NP_441448.1_1 Forward -398 -379 5.50599 0.261
NP_441198.1_8 Forward -351 -341 12.783 0.116
NP_441468.1_1 Forward -348 -341 15.8704 0.0124
NP_441468.1_1 Reverse -341 -348 15.8704 0.0124
NP_441468.1_1 Reverse -85 -92 3.97235 0.277
NP_441468.1_1 Reverse -64 -71 3.97235 0.277
NP_441020.2_6 Reverse -338 -355 9.97027 0.156
NP_441015.1_10 Forward -354 -335 1.96607 0.154
NP_441015.1_10 Forward -348 -329 -5.60541 0.228
NP_441673.1_1 Forward -349 -340 20.8459 0.000698
NP_441673.1_1 Reverse -340 -349 20.8459 0.000698
NP_441956.1_9 Reverse -333 -352 6.4893 0.274
NP_441826.1_2 Reverse -334 -348 16.4209 0.0187
NP_441330.1_1 Reverse -335 -354 -14.3569 0.219
NP_442490.1_9 Forward -349 -330 -5.99873 0.273
NP_441764.1_8 Reverse -376 -386 12.842 0.284
NP_442868.1_6 Reverse -338 -348 19.2529 0.00563
NP_442868.1_6 Forward -351 -341 0.963343 0.205
NP_441056.1_1 Forward -349 -330 2.45773 0.137
NP_441612.1_2 Forward -349 -339 8.54929 0.21
NP_442227.1_2 Reverse -175 -194 -1.47551 0.262
NP_443058.1_1 Reverse -168 -187 14.1583 0.153
NP_442808.1_1 Forward -350 -340 8.73102 0.0481
NP_442808.1_1 Reverse -339 -349 8.63269 0.0481
NP_441101.1_10 Reverse -25 -44 -7.17871 0.29
NP_441101.1_10 Reverse -336 -355 -7.67036 0.29
NP_442050.1_5 Reverse -338 -348 14.3359 0.0206
NP_442050.1_5 Forward -351 -341 9.22267 0.193
NP_442050.1_5 Forward -80 -70 7.25606 0.265
NP_441937.1_5 Forward -50 -31 14.7491 0.0726
NP_440558.1_2 Forward -87 -68 -3.44213 0.236
NP_442789.1_4 Forward -184 -165 1.76941 0.185
NP_442789.1_4 Reverse -338 -357 -1.47551 0.219
NP_441518.1_3 Reverse -377 -396 -13.2752 0.264
NP_441878.1_6 Forward -350 -340 10.5014 0.0176
NP_441878.1_6 Reverse -339 -349 10.4031 0.0176
NP_441878.1_6 Forward -26 -16 0.963343 0.128
NP_441878.1_6 Reverse -15 -25 -6.41148 0.191
NP_441878.1_10 Reverse -276 -290 12.1926 0.289
NP_441036.1_8 Forward -350 -340 15.713 0.00724
NP_441036.1_8 Reverse -339 -349 8.33817 0.174
NP_441036.1_8 Forward -183 -173 5.97822 0.246
NP_441557.1_5 Forward -349 -340 19.9609 0.000699
NP_441557.1_5 Reverse -340 -349 19.9609 0.000699
NP_442066.2_4 Forward -349 -330 -0.39387 0.173
NP_442066.2_9 Reverse -169 -182 8.47575 0.185
NP_440101.1_3 Forward -354 -335 11.0125 0.111
NP_441458.1_10 Forward -358 -339 5.40766 0.216
NP_441564.1_2 Reverse -69 -88 3.44104 0.128
NP_442183.1_1 Reverse -340 -354 10.9143 0.078
NP_442183.1_1 Forward -182 -168 4.52282 0.26
NP_442347.1_2 Reverse -174 -183 14.4544 0.056
NP_442347.1_2 Forward -348 -339 12.4878 0.056
NP_442347.1_2 Forward -88 -79 5.99792 0.201
NP_442347.1_2 Reverse -341 -350 3.34298 0.284
NP_442645.1_2 Reverse -332 -351 -15.7335 0.209
NP_442645.1_4 Forward -289 -270 7.37428 0.235
NP_441037.1_4 Forward -351 -341 15.0168 0.028
NP_442508.1_2 Reverse -120 -139 25.7622 0.000721
NP_442508.1_4 Reverse -186 -205 27.5312 0.00128
NP_441633.1_3 Reverse -338 -351 3.36254 0.0699
NP_441633.1_3 Forward -351 -338 -5.97891 0.236
NP_440136.1_2 Forward -348 -341 15.9687 0.0123
NP_440136.1_2 Reverse -341 -348 15.9687 0.0123
NP_442590.1_10 Forward -349 -330 3.73603 0.286
NP_442998.1_5 Forward -246 -236 10.8948 0.201
NP_442998.1_10 Forward -347 -340 15.5754 0.0102
NP_442998.1_10 Reverse -342 -349 15.5754 0.0102
NP_442998.1_10 Forward -76 -69 13.5105 0.0225
NP_442998.1_10 Forward -284 -277 4.16902 0.259
NP_440899.1_2 Forward -360 -341 15.4366 0.0689
NP_440299.1_1 Reverse -336 -349 20.2748 0.00128
NP_440299.1_1 Reverse -65 -78 4.73861 0.201
NP_440299.1_1 Forward -353 -340 3.46031 0.243
NP_441799.1_1 Forward -353 -339 18.8785 0.00745
NP_441799.1_1 Reverse -336 -350 7.57046 0.138
NP_441007.1_10 Forward -354 -341 10.5407 0.0656
NP_441007.1_10 Reverse -335 -348 -0.669033 0.287
NP_440256.1_1 Forward -352 -333 1.47442 0.0744
NP_440256.1_1 Reverse -337 -356 0.687771 0.0814
NP_440256.1_1 Reverse -77 -96 -8.85033 0.268
NP_441559.1_8 Reverse -335 -349 2.94952 0.143
NP_441559.1_8 Reverse -231 -245 2.85119 0.143
NP_440915.1_6 Reverse -336 -350 19.6658 0.00738
NP_440915.1_6 Reverse -26 -40 -1.77037 0.246
NP_442785.1_7 Forward -351 -337 8.35772 0.298
NP_442866.1_1 Reverse -159 -178 8.65258 0.101
NP_442866.1_1 Forward -354 -335 -9.34199 0.292
NP_441939.1_3 Forward -348 -329 20.944 0.00674
NP_440677.1_1 Forward -358 -339 15.2408 0.103
NP_442386.1_9 Reverse -339 -348 13.8639 0.0289
NP_442386.1_9 Forward -350 -341 6.39082 0.219
NP_442386.1_9 Forward -73 -64 4.62087 0.294
NP_441404.1_8 Forward -81 -67 11.9953 0.271
NP_441340.1_5 Forward -348 -341 15.6737 0.0124
NP_441340.1_5 Reverse -341 -348 15.6737 0.0124
NP_441340.1_5 Forward -71 -64 11.3472 0.0526
NP_441340.1_9 Reverse -377 -387 8.54444 0.256
NP_441947.1_4 Forward -360 -341 12.2908 0.234
NP_442484.1_2 Reverse -329 -348 -1.18052 0.287
NP_440168.1_4 Forward -35 -16 -5.9004 0.255
NP_440168.1_8 Forward -355 -336 3.14605 0.246
NP_440168.1_9 Reverse -338 -357 5.89931 0.227
NP_442240.1_1 Reverse -332 -351 5.80018 0.261
NP_442240.1_2 Forward -348 -329 -19.5684 0.295
NP_440161.1_3 Reverse -338 -357 16.2241 0.084
NP_440586.1_1 Reverse -154 -173 -2.0655 0.25
NP_440586.1_8 Forward -348 -341 13.2151 0.026
NP_440586.1_8 Reverse -341 -348 13.2151 0.026
NP_440586.1_8 Reverse -64 -71 5.74197 0.283
NP_442251.1_6 Forward -348 -341 15.2804 0.0124
NP_442251.1_6 Reverse -341 -348 15.2804 0.0124
NP_440684.1_9 Forward -92 -78 8.55439 0.226
NP_441262.1_3 Reverse -340 -347 14.7888 0.0223
NP_441262.1_3 Forward -349 -342 14.7888 0.0223
NP_441262.1_3 Reverse -69 -76 5.25066 0.215
NP_440027.1_8 Forward -352 -333 8.65176 0.246
NP_443051.1_1 Forward -350 -341 19.5676 0.00335
NP_443051.1_1 Reverse -339 -348 10.4228 0.00754
NP_441232.1_10 Reverse -162 -181 0.58944 0.296
NP_439937.1_8 Forward -193 -174 -5.50708 0.297
NP_442294.1_3 Forward -392 -378 12.0937 0.29
NP_440398.1_2 Forward -194 -175 9.93088 0.172
NP_440408.1_7 Forward -349 -330 16.9124 0.118
NP_440439.1_1 Reverse -337 -350 8.86907 0.0488
NP_440439.1_1 Forward -352 -339 2.08423 0.138
NP_440439.1_1 Forward -185 -172 0.904263 0.168
NP_440372.1_2 Forward -348 -341 16.3621 0.0124
NP_440372.1_2 Reverse -341 -348 16.3621 0.0124
NP_440991.1_8 Reverse -243 -262 18.2306 0.268
NP_440819.1_5 Forward -246 -238 7.68924 0.266
NP_440316.1_10 Forward -192 -182 9.91146 0.235
NP_441803.1_2 Forward -354 -335 2.55606 0.209
NP_441572.1_7 Reverse -334 -353 6.98095 0.0785
NP_442384.1_10 Forward -349 -336 20.8655 0.00194
NP_442384.1_10 Reverse -340 -353 13.589 0.0195
NP_442384.1_10 Reverse -173 -186 3.16588 0.199
NP_442384.1_10 Reverse -328 -341 1.49425 0.257
NP_442114.1_8 Reverse -208 -222 10.8154 0.234
NP_441877.1_5 Reverse -278 -297 0.491109 0.276
NP_441018.1_7 Forward -353 -334 11.4058 0.185
NP_442790.1_4 Reverse -331 -350 -8.55534 0.172
NP_442262.1_10 Forward -348 -341 14.1988 0.0123
NP_442262.1_10 Reverse -341 -348 14.1988 0.0123
NP_442262.1_10 Reverse -64 -71 12.0355 0.062
NP_442262.1_10 Reverse -70 -77 9.18389 0.211
NP_442262.1_10 Forward -92 -85 8.10225 0.257
NP_441689.1_5 Forward -351 -341 8.3377 0.132
NP_441689.1_5 Forward -95 -85 7.94438 0.18
NP_441689.1_5 Reverse -338 -348 5.78111 0.197
NP_442244.1_6 Forward -45 -26 -1.57384 0.299
NP_440344.1_10 Forward -356 -339 -3.69774 0.0862
NP_440282.1_10 Forward -359 -340 -7.08038 0.251
NP_440531.1_6 Forward -357 -338 15.2408 0.0375
NP_440562.1_3 Forward -348 -331 5.05372 0.175
NP_441965.1_3 Reverse -330 -349 -0.590531 0.266
NP_441965.1_10 Reverse -337 -353 10.8749 0.107
NP_441640.1_8 Reverse -64 -83 6.19431 0.111
NP_440297.1_9 Forward -348 -338 -0.118297 0.282
NP_440297.1_9 Reverse -341 -351 -0.216628 0.282
NP_440350.1_5 Reverse -227 -246 -3.93378 0.272
NP_441592.1_4 Forward -349 -330 -2.75381 0.269
NP_441679.1_6 Reverse -168 -187 -1.08219 0.273
NP_440999.1_2 Forward -133 -114 11.2092 0.221
NP_440999.1_9 Reverse -336 -350 7.57108 0.0846
NP_440999.1_9 Forward -353 -339 0.294584 0.189
NP_440888.1_2 Forward -349 -335 17.7968 0.00308
NP_440888.1_2 Reverse -173 -187 9.24208 0.134
NP_440600.1_4 Forward -357 -339 8.86894 0.0635
NP_440600.1_4 Reverse -332 -350 -3.02911 0.216
NP_442948.1_2 Reverse -79 -98 5.01433 0.256
NP_442948.1_2 Forward -350 -331 2.94938 0.296
NP_442277.1_4 Reverse -331 -350 9.14342 0.116
NP_441123.1_6 Forward -33 -15 13.5888 0.133
NP_441543.1_2 Forward -348 -339 16.9127 0.00359
NP_441543.1_2 Reverse -341 -350 15.9293 0.00518
NP_441543.1_2 Forward -77 -68 5.50626 0.197
NP_442845.1_2 Forward -78 -64 11.3077 0.131
NP_442845.1_2 Reverse -334 -348 7.76774 0.195
NP_442845.1_2 Reverse -153 -167 7.66941 0.195
NP_442845.1_2 Forward -349 -335 7.37441 0.195
NP_442845.1_2 Forward -355 -341 4.12949 0.267
NP_442845.1_2 Reverse -15 -29 3.53951 0.287
NP_441551.1_5 Reverse -80 -96 10.3826 0.193
NP_441469.1_8 Forward -350 -341 6.5879 0.227
NP_441469.1_8 Reverse -339 -348 6.48957 0.227
NP_442315.1_2 Reverse -154 -166 8.79043 0.293
NP_443064.1_6 Forward -182 -172 15.0878 0.0796
NP_443064.1_6 Forward -349 -339 12.5669 0.0796
NP_443064.1_6 Reverse -340 -350 10.8217 0.13
NP_443064.1_6 Forward -89 -79 9.07643 0.247
NP_442578.1_7 Forward -348 -341 14.5921 0.026
NP_442578.1_7 Reverse -341 -348 14.5921 0.026
NP_442578.1_7 Reverse -70 -77 11.4455 0.0898
NP_440710.1_1 Forward -357 -339 -0.472507 0.163
NP_440220.1_4 Forward -85 -66 -2.16459 0.266
NP_441462.1_2 Reverse -340 -350 20.2362 0.000805
NP_441462.1_2 Forward -349 -339 11.5831 0.00406
NP_441621.1_7 Reverse -338 -352 -5.21195 0.248
NP_441621.1_7 Reverse -180 -194 -6.58858 0.298
NP_443062.1_1 Forward -89 -71 6.01073 0.211
NP_443062.1_1 Forward -349 -331 5.6207 0.224
NP_443062.1_1 Forward -72 -54 4.64563 0.255
NP_442204.1_1 Reverse -336 -347 11.5634 0.0565
NP_442204.1_1 Forward -353 -342 8.4168 0.0945
NP_442204.1_1 Reverse -65 -76 -0.236322 0.289
NP_442204.1_2 Reverse -330 -349 8.65258 0.245
NP_441560.1_8 Forward -30 -11 13.5579 0.205
NP_441560.1_10 Forward -357 -338 10.4225 0.195
NP_440516.1_6 Forward -24 -10 9.14375 0.238
NP_440516.1_8 Forward -349 -340 16.9127 0.00442
NP_440516.1_8 Reverse -340 -349 16.9127 0.00442
NP_442428.1_4 Reverse -15 -34 3.34271 0.242
NP_442428.1_5 Forward -348 -341 15.8704 0.0124
NP_442428.1_5 Reverse -341 -348 15.8704 0.0124
NP_442428.1_5 Reverse -85 -92 4.46401 0.267
NP_442428.1_5 Reverse -64 -71 4.36568 0.271
NP_440673.1_3 Forward -347 -340 12.4288 0.0426
NP_440673.1_3 Reverse -342 -349 12.4288 0.0426
NP_440673.1_7 Reverse -58 -77 -0.0988766 0.283
NP_441052.1_2 Forward -349 -339 19.9412 0.00106
NP_441052.1_2 Reverse -340 -350 10.4031 0.0285
NP_442219.1_9 Forward -348 -339 17.7976 0.00718
NP_442219.1_9 Reverse -341 -350 8.25953 0.0681
NP_440436.1_4 Forward -348 -339 17.2072 0.00233
NP_440436.1_4 Reverse -341 -350 9.24241 0.0871
NP_441884.1_9 Forward -185 -166 -14.1602 0.138
NP_441884.1_9 Reverse -337 -356 -24.9766 0.29
NP_441719.1_4 Forward -348 -341 16.3621 0.0124
NP_441719.1_4 Reverse -341 -348 16.3621 0.0124
NP_441719.1_4 Reverse -70 -77 3.77569 0.285
NP_442366.1_3 Forward -350 -332 -2.93078 0.235
NP_442366.1_5 Forward -352 -342 14.0409 0.0497
NP_439949.1_7 Forward -230 -216 13.1759 0.257
NP_442873.1_9 Reverse -163 -182 4.32522 0.287
NP_440296.1_1 Reverse -178 -197 20.2556 0.0372
NP_440296.1_10 Reverse -337 -356 -4.81876 0.213
NP_441115.1_4 Forward -350 -332 17.8162 0.0158
NP_442206.1_10 Reverse -340 -355 16.0078 0.0799
NP_442854.1_6 Forward -349 -330 2.75272 0.272
NP_440328.1_4 Reverse -334 -353 27.2371 0.000677
NP_443054.1_2 Reverse -338 -352 -0.492064 0.295
NP_442430.1_10 Reverse -330 -349 13.3716 0.192
NP_441851.1_10 Reverse -339 -349 15.8113 0.00552
NP_441851.1_10 Forward -350 -340 8.53483 0.114
NP_441195.1_1 Forward -360 -341 -0.885524 0.203
NP_442011.1_1 Forward -192 -173 3.53937 0.239
NP_442515.1_1 Reverse -339 -353 -2.65535 0.277
NP_440593.1_9 Reverse -18 -32 9.14437 0.255
NP_440165.1_5 Forward -350 -331 -7.57203 0.27
NP_441349.1_10 Reverse -330 -349 2.26107 0.0753
NP_441349.1_10 Forward -359 -340 -8.45701 0.275
NP_441409.1_6 Forward -355 -336 -6.58872 0.13
NP_441409.1_6 Forward -78 -59 -9.14533 0.18
NP_441409.1_6 Reverse -63 -82 -12.1936 0.225
NP_441394.1_2 Forward -54 -35 15.5357 0.265
NP_440432.1_9 Reverse -341 -356 -0.315096 0.164
NP_440432.1_9 Forward -113 -98 -5.52664 0.253
NP_442843.1_1 Forward -395 -376 -10.4236 0.278
NP_439960.1_10 Reverse -333 -351 -2.3408 0.254
NP_441124.1_5 Reverse -130 -140 10.8118 0.283
NP_440431.1_3 Forward -350 -331 -4.32711 0.178
NP_440431.1_4 Forward -323 -304 -9.97933 0.295
NP_442450.1_5 Forward -351 -341 7.64985 0.13
NP_440588.1_2 Reverse -331 -350 6.09597 0.06
NP_441003.1_9 Forward -358 -339 6.4893 0.249
NP_440483.1_9 Forward -194 -175 9.93088 0.122
NP_442243.1_1 Reverse -334 -352 -1.9482 0.283
NP_441570.1_1 Reverse -340 -358 2.0841 0.0267
NP_441078.1_4 Forward -349 -340 19.6659 0.0007
NP_441078.1_4 Reverse -340 -349 19.6659 0.0007
NP_441078.1_4 Forward -78 -69 -1.57357 0.266
NP_442729.1_7 Forward -273 -255 5.52568 0.286
NP_441663.1_8 Reverse -334 -353 10.5209 0.0758
NP_441663.1_8 Forward -355 -336 2.3594 0.203
NP_442348.1_2 Forward -390 -381 14.7494 0.146
NP_442443.1_4 Reverse -375 -385 13.4509 0.233
NP_440793.1_1 Forward -385 -371 9.6354 0.293
NP_440526.1_3 Forward -348 -337 8.02298 0.126
NP_441432.1_8 Reverse -339 -348 16.8143 0.00595
NP_441432.1_8 Forward -350 -341 16.8143 0.00595
NP_442320.1_8 Reverse -334 -348 -4.22864 0.151
NP_442320.1_8 Reverse -63 -77 -6.19526 0.269
NP_441732.1_2 Forward -353 -337 1.73016 0.0299
NP_441732.1_2 Reverse -336 -352 -16.0677 0.164
NP_441732.1_2 Forward -82 -66 -16.8544 0.207
NP_442343.1_1 Reverse -32 -51 15.9291 0.271
NP_442003.1_4 Reverse -64 -83 16.1257 0.19
NP_442815.1_2 Forward -184 -166 15.4571 0.0752
NP_440760.1_1 Forward -349 -330 -22.9117 0.274
NP_442353.1_4 Reverse -334 -353 2.35861 0.234
NP_442353.1_4 Forward -191 -172 1.6703 0.242
NP_440913.1_1 Reverse -338 -356 8.67227 0.183
NP_440713.1_4 Forward -192 -173 7.96426 0.174
NP_440713.1_4 Reverse -330 -349 3.6377 0.24
NP_442489.1_7 Forward -349 -340 20.1576 0.000695
NP_442489.1_7 Reverse -340 -349 20.1576 0.000695
NP_442079.1_7 Reverse -64 -83 1.76941 0.241
NP_442079.1_7 Reverse -341 -360 -0.000545616 0.287
NP_440559.1_1 Forward -348 -339 17.4043 0.00658
NP_440559.1_1 Reverse -341 -350 8.65285 0.0586
NP_441659.2_8 Reverse -340 -350 20.9245 0.000805
NP_441659.2_8 Forward -349 -339 18.1713 0.00133
NP_442008.1_2 Forward -352 -333 24.6805 0.00482
NP_442346.1_5 Reverse -339 -349 16.6963 0.00248
NP_442346.1_5 Forward -350 -340 16.303 0.00248
NP_442346.1_5 Reverse -83 -93 4.89658 0.269
NP_440352.1_5 Reverse -367 -386 10.5143 0.272
NP_440545.1_3 Forward -353 -336 6.13536 0.0568
NP_440545.1_3 Reverse -336 -353 5.84037 0.059
NP_440545.1_3 Reverse -65 -82 1.61214 0.116
NP_440545.1_3 Forward -29 -12 -5.66436 0.256
NP_440545.1_5 Reverse -148 -165 5.84037 0.228
NP_441856.1_3 Reverse -337 -356 -2.95047 0.272
NP_441629.1_1 Reverse -292 -311 8.75091 0.235
NP_440486.1_6 Forward -350 -331 11.3075 0.208
NP_441126.1_6 Forward -149 -135 13.7567 0.283
NP_440459.1_2 Forward -351 -334 14.9851 0.117
NP_441653.1_2 Reverse -329 -348 15.2223 0.079
NP_441653.1_2 Forward -245 -226 4.88249 0.252
NP_440010.1_4 Forward -195 -176 1.17865 0.24
NP_442603.1_7 Forward -349 -335 19.7634 0.00895
NP_441888.1_7 Reverse -335 -349 3.73617 0.225
NP_441833.1_4 Forward -348 -341 15.9687 0.0124
NP_441833.1_4 Reverse -341 -348 15.9687 0.0124
NP_442162.1_9 Forward -348 -341 16.2637 0.0124
NP_442162.1_9 Reverse -341 -348 16.2637 0.0124
NP_440671.1_2 Forward -346 -332 15.5359 0.174
NP_440671.1_4 Reverse -334 -348 11.0127 0.142
NP_442404.1_9 Reverse -176 -190 17.4035 0.208
NP_440224.1_1 Reverse -329 -348 1.0811 0.132
NP_442140.1_3 Forward -348 -338 10.3048 0.0902
NP_442140.1_3 Reverse -341 -351 6.66654 0.159
NP_442140.1_3 Forward -193 -183 5.19158 0.221
NP_440875.1_9 Forward -171 -161 9.54007 0.233
NP_440875.1_9 Reverse -342 -352 8.37203 0.233
NP_440875.1_9 Forward -347 -337 8.37203 0.233
NP_440875.1_9 Reverse -175 -185 7.39866 0.267
NP_441813.1_5 Reverse -338 -348 18.1713 0.00743
NP_441813.1_5 Forward -351 -341 8.63316 0.0367
NP_441813.1_5 Reverse -61 -71 4.50326 0.155
NP_440590.1_4 Forward -348 -335 12.8023 0.013
NP_440567.1_1 Reverse -341 -355 11.0127 0.0305
NP_440567.1_1 Forward -348 -334 5.80112 0.0959
NP_440567.1_1 Forward -77 -63 2.75286 0.164
NP_442497.1_10 Reverse -341 -350 17.601 0.00813
NP_442497.1_10 Forward -348 -339 10.4228 0.0087
NP_440821.1_4 Reverse -338 -348 9.41981 0.0286
NP_440821.1_4 Forward -351 -341 2.24165 0.131
NP_441239.1_9 Forward -351 -339 11.1504 0.0648
NP_441239.1_9 Forward -95 -83 6.43049 0.189
NP_441239.1_9 Reverse -338 -350 5.25052 0.223
NP_441951.1_9 Forward -190 -171 -1.18052 0.285
NP_442568.1_8 Reverse -210 -224 9.93102 0.257
NP_441727.1_3 Forward -356 -337 5.80098 0.248
NP_441892.1_1 Forward -358 -341 2.89044 0.133
NP_440665.1_1 Forward -200 -181 -3.73712 0.186
NP_440604.1_6 Reverse -340 -359 -0.590531 0.183
NP_442044.1_1 Forward -187 -168 -5.40875 0.187
NP_442193.1_1 Reverse -147 -165 7.4923 0.291
NP_440354.1_5 Forward -352 -333 4.916 0.204
NP_440546.1_4 Reverse -340 -350 13.5365 0.0459
NP_440546.1_4 Reverse -84 -94 11.7912 0.0712
NP_440546.1_4 Forward -349 -339 10.046 0.109
NP_440546.1_4 Reverse -277 -287 8.6886 0.176
NP_440675.1_1 Reverse -155 -174 6.39097 0.195
NP_440462.1_6 Forward -351 -341 10.5014 0.0396
NP_440462.1_6 Reverse -338 -348 9.61647 0.0429
NP_442465.1_9 Reverse -373 -387 10.6193 0.288
NP_442340.1_3 Forward -171 -152 -7.37537 0.232
NP_442611.1_1 Reverse -58 -77 -0.000545616 0.265
NP_442611.1_1 Reverse -69 -88 -0.39387 0.266
NP_440868.1_4 Forward -353 -341 15.1819 0.0164
NP_440868.1_4 Reverse -336 -348 8.00379 0.0602
NP_440868.1_4 Forward -186 -174 -0.452677 0.269
NP_440868.1_7 Reverse -25 -44 19.1731 0.0702
NP_441204.1_1 Reverse -29 -48 13.7658 0.2
NP_440374.1_3 Forward -333 -315 11.27 0.277
NP_442479.1_9 Forward -142 -123 -10.4236 0.268
NP_441474.1_1 Forward -359 -340 4.71854 0.221
NP_441084.1_6 Forward -288 -274 13.1254 0.145
NP_440653.1_10 Forward -348 -329 1.96607 0.29
NP_441843.2_9 Reverse -118 -136 10.492 0.231
NP_442923.1_4 Forward -295 -276 -6.09707 0.295
NP_442039.1_4 Forward -348 -341 15.1821 0.0124
NP_442039.1_4 Reverse -341 -348 15.1821 0.0124
NP_442039.1_7 Forward -171 -161 14.6313 0.211
NP_441811.1_8 Reverse -78 -92 6.3911 0.273
NP_440753.1_5 Forward -389 -370 9.3409 0.244
NP_442837.1_3 Forward -348 -341 15.7721 0.0124
NP_442837.1_3 Reverse -341 -348 15.7721 0.0124
NP_442837.1_3 Forward -88 -81 5.74231 0.275
NP_440160.1_9 Reverse -69 -88 18.1907 0.115
NP_442053.1_1 Forward -349 -340 18.3876 0.0007
NP_442053.1_1 Reverse -340 -349 18.3876 0.0007
NP_440505.1_3 Reverse -338 -348 18.3679 0.00213
NP_440505.1_3 Forward -351 -341 8.04317 0.147
NP_440505.1_3 Reverse -67 -77 5.97822 0.202
NP_441408.2_7 Forward -351 -332 -5.40875 0.294
NP_440914.1_1 Forward -349 -339 17.5935 0.000537
NP_440914.1_1 Reverse -340 -350 16.3248 0.00196
NP_440914.1_1 Forward -182 -172 7.34642 0.241
NP_441011.1_8 Reverse -341 -350 16.6177 0.00602
NP_441011.1_8 Forward -348 -339 8.25953 0.144
NP_442533.1_6 Forward -349 -340 17.2076 0.00137
NP_442533.1_6 Reverse -340 -349 17.2076 0.00137
NP_442533.1_6 Reverse -173 -182 3.7363 0.204
NP_442533.1_6 Forward -24 -15 3.63797 0.206
NP_442541.1_10 Forward -174 -160 1.76896 0.279
NP_442232.1_3 Reverse -156 -175 -8.94866 0.239
NP_443016.1_1 Forward -355 -336 -5.70374 0.251
NP_441482.1_7 Reverse -334 -348 -0.590395 0.0612
NP_441482.1_7 Forward -355 -341 -3.24533 0.115
NP_439944.1_9 Forward -348 -338 10.5014 0.0887
NP_439944.1_9 Reverse -85 -95 9.7148 0.1
NP_439944.1_9 Reverse -341 -351 9.12481 0.1
NP_439944.1_9 Forward -77 -67 6.46988 0.179
NP_441028.1_6 Reverse -238 -248 10.1076 0.21
NP_441028.1_6 Forward -88 -78 3.42118 0.296
NP_442351.1_2 Forward -218 -199 24.8772 0.00749
NP_442351.1_8 Forward -187 -168 20.944 0.0464
NP_440116.1_5 Reverse -337 -354 6.23369 0.169
NP_440116.1_8 Forward -348 -329 -2.55715 0.135
NP_441527.1_4 Reverse -366 -385 -3.1994 0.164
NP_440115.1_6 Reverse -337 -347 16.008 0.0325
NP_440115.1_6 Reverse -27 -37 14.3364 0.0615
NP_440115.1_6 Forward -352 -342 7.35486 0.147
NP_440007.1_9 Reverse -336 -350 8.84938 0.171
NP_440007.1_9 Reverse -59 -73 5.1128 0.265
NP_443045.1_3 Forward -26 -7 20.2556 0.184
NP_441602.1_3 Forward -187 -168 -1.27885 0.226
NP_441972.1_3 Reverse -353 -372 11.2092 0.284
NP_441972.1_5 Forward -348 -329 -9.44032 0.285
NP_441106.1_1 Forward -350 -341 18.486 0.0028
NP_441106.1_1 Reverse -339 -348 9.63616 0.0311
NP_441106.1_1 Forward -192 -183 2.26134 0.293
NP_439903.1_6 Reverse -337 -356 7.57013 0.151
NP_441286.1_1 Reverse -339 -351 5.93884 0.0258
NP_441286.1_1 Forward -350 -338 3.48056 0.0467
NP_442674.1_3 Forward -357 -338 5.50519 0.266
NP_440670.1_8 Forward -349 -340 18.3876 0.000699
NP_440670.1_8 Reverse -340 -349 18.3876 0.000699
NP_439955.1_10 Forward -172 -153 12.3883 0.258
NP_440886.1_7 Reverse -181 -191 12.5659 0.0805
NP_440886.1_7 Forward -350 -340 8.04271 0.0805
NP_440886.1_7 Reverse -339 -349 7.94438 0.0805
NP_442614.1_2 Forward -349 -335 9.04604 0.242
NP_442072.1_9 Forward -350 -332 -12.1739 0.0823
NP_442072.1_9 Forward -26 -8 -23.187 0.284
NP_442022.1_6 Reverse -148 -167 20.1573 0.146
NP_440907.2_8 Reverse -341 -351 15.9091 0.0161
NP_440907.2_8 Reverse -174 -184 5.09279 0.222
NP_441021.1_1 Forward -348 -329 -3.14714 0.153
NP_441463.1_2 Reverse -305 -323 1.33175 0.256
NP_441626.1_2 Forward -348 -341 15.7721 0.0124
NP_441626.1_2 Reverse -341 -348 15.7721 0.0124
NP_441626.1_2 Reverse -70 -77 4.66067 0.267
NP_442365.1_7 Reverse -336 -355 0.392778 0.177
NP_441460.1_2 Reverse -137 -150 14.5717 0.234
NP_442794.1_1 Reverse -336 -348 20.0002 0.00523
NP_442794.1_1 Forward -353 -341 2.69391 0.286
NP_442615.1_1 Reverse -331 -349 5.62401 0.0376
NP_442615.1_1 Forward -358 -340 0.0191479 0.109
NP_441962.1_4 Reverse -335 -354 -9.047 0.211
NP_441962.1_4 Reverse -16 -35 -9.34199 0.215
NP_441962.1_4 Forward -348 -329 -13.2752 0.271
NP_440387.1_1 Reverse -340 -356 13.4315 0.00865
NP_440387.1_1 Forward -349 -333 -2.30141 0.147
NP_440855.1_5 Reverse -332 -351 7.96345 0.285
NP_441431.1_2 Reverse -337 -351 10.8154 0.153
NP_441431.1_2 Forward -28 -14 6.0955 0.28
NP_441488.1_7 Reverse -167 -186 2.85105 0.242
NP_441488.1_8 Reverse -335 -349 10.717 0.146
NP_441488.1_8 Forward -77 -63 8.06211 0.209
NP_441836.1_2 Forward -188 -169 1.47442 0.193
NP_441836.1_2 Forward -355 -336 -0.000545616 0.209
NP_441836.1_2 Reverse -170 -189 -5.31042 0.277
NP_440467.1_3 Reverse -329 -348 13.6001 0.19
NP_440114.1_10 Forward -72 -58 10.1277 0.153
NP_440114.1_10 Reverse -340 -354 8.84938 0.192
NP_440114.1_10 Forward -286 -272 6.19444 0.282
NP_440114.1_10 Forward -173 -159 5.60446 0.3
NP_442698.1_10 Forward -189 -170 -0.197208 0.297
NP_442323.1_7 Forward -83 -64 5.80018 0.202
NP_442323.1_7 Reverse -335 -354 5.11187 0.209
NP_441510.2_9 Reverse -341 -360 5.89931 0.251
NP_441272.1_4 Reverse -331 -350 0.294447 0.263
NP_439988.1_3 Reverse -11 -25 11.406 0.219
NP_441311.1_2 Forward -355 -341 13.6669 0.229
NP_441531.1_6 Reverse -179 -192 8.27909 0.271
NP_440457.1_1 Reverse -336 -348 7.61046 0.101
NP_440457.1_1 Forward -400 -388 3.48056 0.195
NP_440457.1_1 Reverse -65 -77 -0.944332 0.285
NP_440798.1_6 Forward -285 -272 2.37923 0.177
NP_440798.1_6 Reverse -341 -354 1.39592 0.217
NP_442680.1_5 Reverse -203 -222 0.169919 0.268
NP_442509.1_9 Reverse -173 -183 12.6642 0.0835
NP_442509.1_9 Forward -349 -339 8.14104 0.192
NP_442509.1_9 Reverse -340 -350 8.04271 0.192
NP_440081.1_1 Reverse -79 -98 14.1591 0.281
NP_440554.1_4 Forward -348 -338 8.92815 0.0646
NP_440554.1_4 Reverse -341 -351 8.82982 0.0646
NP_440554.1_4 Forward -71 -61 6.56821 0.121
NP_440554.1_4 Forward -92 -82 2.14332 0.276
NP_441885.1_5 Forward -349 -339 20.9245 0.000538
NP_441885.1_5 Reverse -340 -350 11.3864 0.00668
NP_441885.1_5 Forward -78 -68 -0.0199663 0.186
NP_441885.1_5 Forward -182 -172 -0.511621 0.202
NP_440478.1_4 Forward -82 -63 14.8474 0.161
NP_440478.1_4 Forward -353 -334 13.5691 0.19
NP_440478.1_10 Forward -351 -337 8.06273 0.257
NP_442341.1_7 Forward -183 -169 10.0294 0.0682
NP_442341.1_7 Reverse -339 -353 4.81781 0.177
NP_442341.1_9 Forward -351 -337 11.5037 0.125
NP_442341.1_9 Reverse -338 -352 10.3237 0.135
NP_441173.1_9 Reverse -128 -136 9.85212 0.275
NP_440423.1_6 Forward -357 -338 -15.5368 0.229
NP_443000.1_7 Reverse -338 -348 19.9412 0.00223
NP_443000.1_7 Forward -351 -341 10.6981 0.0345
NP_441842.1_10 Reverse -270 -284 6.98109 0.27
NP_441842.1_10 Forward -356 -342 6.19444 0.297
NP_440275.1_3 Reverse -338 -348 15.123 0.0182
NP_440275.1_3 Forward -351 -341 9.02648 0.0563
NP_441902.1_3 Reverse -367 -377 12.0099 0.281
NP_440679.1_10 Forward -189 -170 -20.4534 0.284
NP_443010.1_10 Forward -92 -75 3.9304 0.246
NP_443010.1_10 Forward -185 -168 2.77079 0.27
NP_440149.1_8 Forward -349 -330 -5.50708 0.228
NP_440149.1_8 Reverse -340 -359 -6.68705 0.258
NP_441105.1_3 Reverse -329 -348 7.86593 0.0513
NP_440216.1_1 Forward -349 -335 9.2427 0.00589
NP_440216.1_1 Reverse -340 -354 -2.45868 0.0513
NP_440216.1_1 Reverse -69 -83 -12.0951 0.24
NP_440216.1_9 Forward -248 -239 7.27622 0.286
NP_440172.1_1 Reverse -340 -350 17.5813 0.00421
NP_440172.1_1 Forward -349 -339 15.0247 0.00945
NP_440172.1_1 Reverse -84 -94 5.48657 0.143
NP_442371.1_1 Forward -208 -198 11.5826 0.295
NP_442015.1_10 Reverse -336 -349 21.1604 0.00329
NP_442015.1_10 Forward -353 -340 2.37923 0.193
NP_442015.1_10 Reverse -166 -179 0.805932 0.218
NP_441226.1_7 Forward -348 -341 14.4934 0.0123
NP_441226.1_7 Reverse -341 -348 14.4934 0.0123
NP_441226.1_7 Forward -71 -64 12.4284 0.0404
NP_442222.1_7 Reverse -26 -45 22.7139 0.0351
NP_441757.1_3 Reverse -339 -358 2.3594 0.155
NP_441111.1_7 Forward -348 -340 18.7023 0.00294
NP_441111.1_7 Reverse -341 -349 18.7023 0.00294
NP_442379.1_10 Reverse -333 -350 0.137172 0.223
NP_440244.1_1 Reverse -355 -374 -8.26035 0.287
NP_441766.1_2 Forward -349 -340 17.5026 0.00297
NP_441766.1_2 Reverse -340 -349 17.5026 0.00297
NP_442417.1_5 Forward -349 -335 7.37441 0.19
NP_442417.1_5 Reverse -340 -354 7.17775 0.195
NP_440416.1_9 Reverse -333 -352 0.58944 0.0513
NP_440416.1_9 Forward -356 -337 -14.3569 0.176
NP_442403.1_9 Reverse -170 -189 5.60432 0.211
NP_440591.1_9 Reverse -333 -351 4.44404 0.279
NP_440261.1_5 Forward -348 -335 6.80412 0.0316
NP_440261.1_5 Reverse -341 -354 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCTTGCGGTGGGAATTTTTGCTTTGTTCCCTTACCCTGAACTCCCATCTAGGCGATCGCCAGGGGCATAGTTAATCAAAACAGGTCTACTAAAAATGAGCCTCCAGCTTCGGAAACTATGGCCGACTGGAGGTTTTCACTATCTAAATTGTCCAGGGAAAAACCTAGGAACGGGTGATTTTGTCTTTTTGGCTGATGAAAATTAACCCGACGGTGGCGGGGATCAGCACAATGGCAGCCCCTAAAACCAGGCTCCAGAGAAAGTTTGCTAAAGAAGGGGTCATATCGCGTTAACCTCATTTTATAAAGACATCGCTCCCCATTCTATCGCCATCGGATGTCAAAGTTAGCCCGTTGAGGGCAGGATTGCTCCGGGGCCCAAGCCCCTAATTTTTAACCT

CDS

ATGTCGGCTATGTCAGATTTGTCGAATAACTTGAGTTTTATTTCCCCCCCCGTTGCTTTAGGGAATATTCCCCAACCCCGCTGTTTATCCCTTGGGATAATGGCATCCGGTAGTGGTAGTAATTTTGAGGCGATCGCCAAGGCCATTAAGGAGGGAAAGTTAAATGCAGTGGTGAAACTGGTGATTTACAACAACCCTAATGCTGGGGTTAGGAAACGGGCCATGGACCATGGGGTGCCCCACCGATTACTCAACCATCGGGACTACGACAGCCGGGAAGATTTGGATCAAGATATTGTTGAGCATTTTCGCCAAGCAGGGGTGGAATGGGTGATCATGGCCGGGTGGATGCGTATTGTCACTCCAGTACTATTAGATGCTTTTAGCCGTCGGGTGTTGAATATCCACCCCAGTTTATTGCCTAGTTTTCGAGGTGTGCGGGCTGTGGAACAGGCCTTGGCGGCGGGGGTGAAAGTGAGTGGTTGCACAGTCCATTATGCCGAAGCAACGGTGGATAGTGGCCCCATTGTGGCCCAGGCGGTAGTGCCCATTCTGGCTGATGATACGGGGGAGACTCTCCATCAACGCATTCAAGTCCAAGAACATCGCCTCTTTCCCCTGGCGATCGCCCTTGCCGCCCAGCAAAGCCCATGA

Protein

MSAMSDLSNNLSFISPPVALGNIPQPRCLSLGIMASGSGSNFEAIAKAIKEGKLNAVVKLVIYNNPNAGVRKRAMDHGVPHRLLNHRDYDSREDLDQDIVEHFRQAGVEWVIMAGWMRIVTPVLLDAFSRRVLNIHPSLLPSFRGVRAVEQALAAGVKVSGCTVHYAEATVDSGPIVAQAVVPILADDTGETLHQRIQVQEHRLFPLAIALAAQQSP