Your browser is old and dusty. Try Google Chrome!

Details for slr0476

ORF slr0476
Accession NP_442240.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -259 -245 2.16287 0.178
NP_441061.1_2 Reverse -252 -266 0.786239 0.199
NP_440557.1_1 Forward -259 -240 11.9958 0.0938
NP_440795.1_7 Forward -259 -252 14.6904 0.0123
NP_440795.1_7 Reverse -252 -259 14.6904 0.0123
NP_441418.1_6 Reverse -251 -270 -9.34199 0.0278
NP_441418.1_6 Forward -260 -241 -20.0601 0.103
NP_441418.1_6 Forward -272 -253 -30.0898 0.256
NP_442291.1_5 Reverse -250 -266 16.0865 0.0222
NP_441453.1_4 Reverse -251 -259 16.539 0.00633
NP_441453.1_4 Forward -260 -252 16.539 0.00633
NP_442151.1_6 Forward -260 -246 10.4227 0.123
NP_441818.1_1 Reverse -252 -263 18.446 0.0046
NP_441818.1_1 Reverse -283 -294 9.89126 0.232
NP_440226.1_1 Reverse -251 -270 14.2574 0.0321
NP_440226.1_1 Forward -260 -241 2.94938 0.246
NP_441630.1_3 Forward -268 -249 6.39097 0.126
NP_442173.1_1 Forward -259 -251 15.4574 0.00633
NP_442173.1_1 Reverse -252 -260 15.4574 0.00633
NP_442173.1_3 Reverse -301 -311 15.8113 0.251
NP_442752.1_4 Forward -260 -253 13.8055 0.0199
NP_442752.1_4 Reverse -251 -258 13.8055 0.0199
NP_443027.1_4 Reverse -249 -259 14.828 0.0437
NP_443027.1_4 Forward -262 -252 11.0914 0.107
NP_441812.1_3 Forward -261 -247 8.06273 0.254
NP_442975.1_10 Reverse -247 -261 14.0603 0.0459
NP_440784.1_7 Forward -259 -252 15.9687 0.0123
NP_440784.1_7 Reverse -252 -259 15.9687 0.0123
NP_440061.1_9 Reverse -249 -263 11.2087 0.116
NP_440110.1_8 Forward -262 -243 0.392778 0.211
NP_442062.1_8 Forward -260 -250 19.4496 0.000558
NP_442062.1_8 Reverse -251 -261 17.3846 0.00193
NP_442062.1_8 Forward -304 -294 3.42162 0.272
NP_440761.1_4 Forward -265 -246 -13.5702 0.257
NP_441859.1_3 Reverse -250 -269 11.8967 0.103
NP_440304.1_4 Reverse -249 -259 10.8948 0.051
NP_440304.1_4 Forward -262 -252 1.84832 0.299
NP_442242.1_4 Forward -259 -252 14.3954 0.0124
NP_442242.1_4 Reverse -252 -259 14.3954 0.0124
NP_440044.1_8 Reverse -252 -271 8.65258 0.0739
NP_441492.1_1 Forward -285 -266 12.0942 0.148
NP_440370.1_10 Reverse -242 -261 8.84924 0.24
NP_442110.1_7 Forward -260 -246 12.3893 0.0586
NP_442726.1_1 Reverse -246 -265 9.14423 0.266
NP_440300.1_5 Reverse -20 -38 13.1799 0.271
NP_440856.1_4 Forward -267 -248 -4.52377 0.261
NP_441083.1_5 Reverse -251 -261 20.3345 0.00053
NP_441083.1_5 Forward -260 -250 11.3864 0.0159
NP_441083.1_5 Reverse -237 -247 4.40493 0.146
NP_442827.1_8 Reverse -180 -199 -2.36125 0.274
NP_441738.1_2 Forward -258 -251 15.28 0.0102
NP_441738.1_2 Reverse -253 -260 15.28 0.0102
NP_441558.1_5 Forward -262 -243 4.81767 0.269
NP_441558.1_10 Reverse -279 -298 15.1424 0.251
NP_440209.1_1 Reverse -251 -259 18.1123 0.00295
NP_440209.1_1 Forward -260 -252 18.1123 0.00295
NP_442889.1_8 Reverse -248 -262 4.52221 0.263
NP_442889.1_8 Forward -263 -249 3.34225 0.281
NP_441770.1_4 Forward -378 -359 -9.93197 0.263
NP_440178.1_7 Forward -261 -242 -13.6686 0.141
NP_442570.1_3 Forward -262 -243 -5.50708 0.244
NP_441716.1_1 Reverse -251 -265 8.45605 0.141
NP_441716.1_1 Forward -260 -246 3.73617 0.259
NP_442111.1_4 Forward -261 -247 19.6658 0.00373
NP_442111.1_4 Forward -273 -259 2.65453 0.268
NP_441163.1_1 Forward -371 -354 7.3146 0.245
NP_440343.1_3 Forward -325 -307 4.44329 0.266
NP_440906.1_5 Forward -259 -252 15.8704 0.0124
NP_440906.1_5 Reverse -252 -259 15.8704 0.0124
NP_440747.1_10 Forward -263 -251 16.8536 0.00143
NP_440747.1_10 Reverse -248 -260 7.70879 0.00236
NP_441130.1_10 Reverse -249 -263 19.7641 0.00955
NP_441486.1_1 Forward -263 -249 11.3077 0.0164
NP_441486.1_1 Reverse -248 -262 4.52282 0.0432
NP_442634.1_4 Forward -262 -248 7.76774 0.0479
NP_440403.1_4 Reverse -368 -387 -9.44032 0.275
NP_440403.1_10 Reverse -308 -327 2.65439 0.279
NP_441014.1_8 Reverse -116 -135 -9.44032 0.295
NP_441014.1_10 Forward -261 -242 5.40686 0.185
NP_442848.1_1 Reverse -245 -259 -0.983719 0.263
NP_442848.1_1 Forward -266 -252 -2.36035 0.263
NP_441012.1_4 Reverse -247 -260 7.19745 0.272
NP_443018.1_3 Forward -259 -252 14.8871 0.0123
NP_443018.1_3 Reverse -252 -259 14.8871 0.0123
NP_441634.1_8 Forward -262 -248 6.48943 0.114
NP_441634.1_8 Reverse -127 -141 -4.13031 0.295
NP_440376.1_1 Forward -260 -251 19.4693 0.000692
NP_440376.1_1 Reverse -251 -260 19.4693 0.000692
NP_441588.1_4 Reverse -253 -263 8.73149 0.14
NP_442687.1_7 Reverse -250 -260 15.8113 0.0125
NP_442687.1_7 Forward -261 -251 8.92815 0.0994
NP_442191.1_4 Forward -259 -245 16.4227 0.0378
NP_442485.1_3 Reverse -312 -331 -3.63879 0.277
NP_441846.1_10 Reverse -307 -326 -22.8133 0.266
NP_442958.1_3 Reverse -240 -259 -2.65548 0.297
NP_440642.1_10 Forward -322 -308 9.6354 0.184
NP_440571.1_5 Forward -39 -20 13.2741 0.248
NP_441422.1_7 Forward -262 -245 -2.3211 0.21
NP_441950.1_7 Forward -79 -60 -6.39206 0.251
NP_440360.1_10 Forward -318 -304 4.12949 0.227
NP_442658.1_1 Reverse -249 -259 15.9091 0.00966
NP_442658.1_1 Forward -262 -252 7.94438 0.199
NP_440141.1_8 Reverse -302 -321 13.9625 0.156
NP_442782.1_2 Forward -260 -246 7.57108 0.202
NP_442782.1_2 Forward -338 -324 1.08123 0.282
NP_441414.1_9 Forward -260 -241 -3.93378 0.143
NP_441487.1_9 Reverse -250 -269 6.09597 0.131
NP_442937.1_5 Forward -265 -246 13.8641 0.0867
NP_441958.1_5 Forward -261 -251 12.2714 0.00183
NP_441958.1_5 Reverse -250 -260 12.2714 0.00183
NP_440318.1_1 Forward -332 -313 14.6508 0.103
NP_439905.1_1 Forward -196 -183 9.2624 0.221
NP_439905.1_1 Forward -319 -306 8.27909 0.234
NP_440984.1_7 Forward -265 -251 5.60446 0.248
NP_440984.1_7 Forward -143 -129 4.81781 0.287
NP_442911.1_2 Reverse -241 -260 3.14605 0.0458
NP_441580.1_6 Reverse -240 -259 -7.96535 0.25
NP_440153.1_5 Forward -259 -245 10.4227 0.0989
NP_443055.1_6 Forward -268 -250 6.90155 0.164
NP_442210.1_7 Reverse -336 -355 15.9291 0.178
NP_441099.1_5 Forward -270 -251 -4.22878 0.144
NP_442002.1_9 Reverse -250 -257 10.7572 0.185
NP_440809.1_9 Forward -269 -251 -7.55234 0.225
NP_440411.1_4 Reverse -326 -345 16.4207 0.0892
NP_441646.1_1 Reverse -244 -263 -1.27885 0.281
NP_442438.1_10 Reverse -246 -260 19.0758 0.0137
NP_441000.1_6 Reverse -250 -264 13.3726 0.0396
NP_440484.1_3 Forward -262 -248 11.406 0.242
NP_440147.1_4 Reverse -249 -262 11.0324 0.0341
NP_440147.1_4 Forward -262 -249 7.39411 0.0695
NP_441175.1_7 Forward -260 -241 6.39097 0.258
NP_441295.1_4 Reverse -246 -265 -2.55715 0.29
NP_441295.1_4 Forward -318 -299 -4.91709 0.29
NP_441550.1_8 Forward -262 -252 15.1225 0.0132
NP_441550.1_8 Reverse -249 -259 6.0761 0.214
NP_441916.1_7 Forward -260 -250 18.4663 0.00144
NP_441916.1_7 Reverse -251 -261 10.3048 0.0261
NP_441041.1_4 Forward -260 -241 0.392778 0.0881
NP_441041.1_4 Reverse -329 -348 -13.3736 0.285
NP_441041.1_7 Forward -263 -251 10.8188 0.0864
NP_441041.1_7 Reverse -248 -260 7.61196 0.162
NP_441725.1_4 Forward -40 -26 2.16228 0.291
NP_441725.1_5 Forward -259 -249 11.2881 0.0247
NP_441725.1_5 Reverse -252 -262 2.04498 0.115
NP_439966.1_7 Reverse -249 -259 18.4657 0.00473
NP_439966.1_7 Forward -262 -252 15.3192 0.0152
NP_439966.1_9 Reverse -249 -258 0.983037 0.253
NP_442941.1_3 Reverse -252 -262 19.2529 0.00262
NP_442941.1_3 Forward -259 -249 11.4848 0.0116
NP_440289.1_2 Reverse -248 -261 11.819 0.0171
NP_440289.1_2 Forward -263 -250 5.91914 0.0605
NP_440289.1_2 Reverse -234 -247 1.19926 0.135
NP_440983.1_5 Reverse -305 -324 -7.96535 0.294
NP_440983.1_5 Reverse -329 -348 -8.16202 0.294
NP_440260.1_8 Forward -336 -318 -6.76569 0.295
NP_442281.1_1 Reverse -246 -260 19.7634 0.00247
NP_442281.1_1 Forward -265 -251 17.5018 0.00555
NP_442256.1_2 Forward -262 -244 -7.15901 0.214
NP_442256.1_2 Reverse -249 -267 -9.91228 0.299
NP_440437.1_1 Reverse -245 -264 15.0441 0.025
NP_441087.1_6 Forward -327 -309 8.17984 0.219
NP_442982.1_5 Reverse -241 -260 -0.4922 0.255
NP_441644.1_6 Reverse -251 -261 17.3841 0.00127
NP_441644.1_6 Forward -260 -250 10.1076 0.0628
NP_441644.1_6 Forward -344 -334 3.51951 0.277
NP_442215.1_2 Forward -262 -246 6.9417 0.0699
NP_442215.1_2 Forward -388 -372 -7.31629 0.291
NP_442029.1_6 Forward -265 -246 8.94757 0.199
NP_440253.1_2 Reverse -251 -269 17.0304 0.0115
NP_440929.1_8 Forward -260 -251 19.2726 0.000701
NP_440929.1_8 Reverse -251 -260 19.2726 0.000701
NP_442933.1_5 Reverse -223 -242 9.93088 0.288
NP_442933.1_10 Forward -260 -251 17.601 0.00325
NP_442933.1_10 Reverse -251 -260 17.601 0.00325
NP_441310.1_10 Reverse -320 -330 17.5416 0.0807
NP_441751.2_8 Reverse -252 -266 4.22782 0.0521
NP_442554.1_8 Reverse -252 -262 16.2046 0.0065
NP_442554.1_8 Forward -259 -249 13.8447 0.0145
NP_441762.1_7 Forward -261 -249 2.89058 0.0676
NP_441762.1_7 Reverse -250 -262 2.39892 0.0676
NP_442142.1_4 Reverse -248 -261 17.1282 0.0264
NP_442142.1_4 Forward -263 -250 14.7683 0.0302
NP_442142.1_4 Reverse -332 -345 12.7034 0.0423
NP_442142.1_7 Reverse -309 -326 14.5918 0.298
NP_442292.1_1 Reverse -252 -261 18.486 0.00229
NP_442292.1_1 Forward -259 -250 9.63616 0.0183
NP_441525.1_1 Reverse -69 -82 14.4739 0.215
NP_442476.1_6 Forward -259 -245 2.2612 0.188
NP_442381.1_8 Reverse -248 -267 -4.81876 0.137
NP_443009.1_5 Forward -261 -250 18.3477 0.00265
NP_441715.1_4 Reverse -252 -262 17.3846 0.0106
NP_441715.1_4 Forward -259 -249 16.303 0.0117
NP_441715.1_4 Reverse -283 -293 4.99491 0.24
NP_440357.1_3 Reverse -353 -372 -0.295539 0.291
NP_440357.1_9 Reverse -234 -253 17.8957 0.213
NP_441468.1_1 Forward -259 -252 15.8704 0.0124
NP_441468.1_1 Reverse -252 -259 15.8704 0.0124
NP_441569.1_7 Forward -131 -117 16.8135 0.296
NP_441020.2_6 Reverse -249 -266 8.00365 0.212
NP_441020.2_6 Forward -262 -245 7.31533 0.235
NP_441015.1_10 Forward -265 -246 -4.03212 0.197
NP_441015.1_10 Reverse -305 -324 -11.3086 0.294
NP_441673.1_1 Forward -260 -251 20.8459 0.000698
NP_441673.1_1 Reverse -251 -260 20.8459 0.000698
NP_441339.1_4 Reverse -370 -389 -4.52377 0.251
NP_441876.1_9 Forward -315 -305 12.3692 0.267
NP_441826.1_2 Reverse -245 -259 21.1407 0.00562
NP_441330.1_1 Forward -265 -246 -12.4886 0.183
NP_442490.1_9 Reverse -251 -270 1.37609 0.166
NP_442868.1_6 Forward -262 -252 19.2529 0.00563
NP_442868.1_6 Reverse -249 -259 0.963343 0.205
NP_442719.1_2 Reverse -195 -213 6.90155 0.126
NP_441056.1_1 Reverse -251 -270 -5.21209 0.257
NP_441612.1_2 Forward -13 -3 17.8433 0.189
NP_441612.1_2 Reverse -251 -261 8.54929 0.21
NP_441612.1_2 Reverse -323 -333 7.19391 0.26
NP_442361.1_3 Reverse -245 -258 15.3589 0.0917
NP_442808.1_1 Reverse -250 -260 18.4657 0.00201
NP_442808.1_1 Forward -261 -251 8.63269 0.0481
NP_442808.1_1 Reverse -322 -332 3.51951 0.238
NP_440145.1_3 Reverse -241 -260 1.86774 0.122
NP_442542.1_2 Reverse -249 -262 9.45906 0.134
NP_442113.1_10 Reverse -175 -194 -9.24366 0.295
NP_442050.1_5 Forward -262 -252 14.3359 0.0206
NP_442050.1_5 Reverse -249 -259 9.12434 0.193
NP_442747.1_1 Reverse -306 -325 -16.0285 0.236
NP_440558.1_2 Forward -323 -304 -7.17871 0.289
NP_440111.2_6 Forward -199 -180 17.8957 0.237
NP_442789.1_4 Forward -138 -119 4.62101 0.153
NP_441518.1_3 Forward -270 -251 -6.09707 0.132
NP_441878.1_4 Reverse -309 -328 10.1275 0.171
NP_441878.1_6 Forward -261 -251 10.4031 0.0176
NP_441878.1_6 Reverse -250 -260 10.4031 0.0176
NP_441878.1_6 Forward -79 -69 -7.19813 0.21
NP_441036.1_8 Reverse -250 -260 17.7779 0.000554
NP_441036.1_8 Forward -261 -251 8.33817 0.174
NP_441036.1_8 Reverse -236 -246 5.48657 0.279
NP_441557.1_4 Reverse -320 -334 11.6026 0.291
NP_441557.1_5 Forward -260 -251 19.9609 0.000699
NP_441557.1_5 Reverse -251 -260 19.9609 0.000699
NP_441445.1_1 Forward -269 -250 8.25926 0.122
NP_442066.2_4 Forward -260 -241 2.3594 0.134
NP_442066.2_9 Reverse -233 -246 11.0324 0.154
NP_442066.2_9 Forward -264 -251 8.47575 0.185
NP_441308.1_8 Reverse -249 -259 10.1081 0.22
NP_440101.1_10 Reverse -329 -348 4.71934 0.208
NP_441458.1_10 Reverse -242 -261 6.98095 0.196
NP_442183.1_1 Forward -260 -246 9.93102 0.0903
NP_442183.1_1 Reverse -251 -265 7.76774 0.131
NP_442397.1_9 Reverse -316 -335 1.0811 0.295
NP_441549.1_9 Forward -264 -246 -4.01242 0.198
NP_441467.1_9 Forward -81 -67 17.4042 0.142
NP_442347.1_2 Reverse -252 -261 12.4878 0.056
NP_442347.1_2 Forward -259 -250 11.1111 0.056
NP_442347.1_2 Forward -245 -236 6.68623 0.156
NP_442645.1_2 Forward -268 -249 -21.6334 0.29
NP_441037.1_4 Reverse -249 -259 7.02532 0.237
NP_442317.1_6 Reverse -166 -185 8.65258 0.216
NP_441633.1_3 Forward -262 -249 10.7374 0.0286
NP_441633.1_3 Reverse -235 -248 3.46087 0.0699
NP_441633.1_3 Reverse -147 -160 -0.570702 0.148
NP_441633.1_3 Reverse -249 -262 -3.71729 0.177
NP_441633.1_3 Forward -293 -280 -6.76555 0.271
NP_440136.1_2 Forward -259 -252 15.9687 0.0123
NP_440136.1_2 Reverse -252 -259 15.9687 0.0123
NP_442998.1_10 Forward -258 -251 15.5754 0.0102
NP_442998.1_10 Reverse -253 -260 15.5754 0.0102
NP_440899.1_1 Reverse -305 -324 12.3111 0.148
NP_440899.1_2 Reverse -240 -259 5.30853 0.29
NP_440299.1_1 Reverse -247 -260 20.1765 0.00128
NP_440299.1_1 Forward -264 -251 2.37867 0.291
NP_441799.1_1 Forward -264 -250 13.8636 0.0293
NP_441799.1_1 Reverse -247 -261 4.03056 0.269
NP_440640.1_6 Forward -385 -366 -0.000545616 0.277
NP_440977.1_4 Reverse -21 -40 -0.590531 0.1
NP_441007.1_10 Forward -265 -252 0.412608 0.23
NP_442201.1_10 Reverse -240 -259 3.83436 0.0961
NP_442333.2_5 Reverse -240 -259 -10.817 0.246
NP_440256.1_1 Forward -263 -244 12.2908 0.0121
NP_440256.1_1 Reverse -248 -267 3.53937 0.0518
NP_441559.1_8 Reverse -246 -260 2.45787 0.143
NP_440915.1_6 Reverse -247 -261 5.70279 0.0879
NP_440915.1_6 Forward -264 -250 1.76955 0.131
NP_440915.1_6 Forward -82 -68 -0.492064 0.197
NP_440717.1_1 Forward -319 -300 11.4058 0.201
NP_440319.1_5 Reverse -311 -330 13.47 0.294
NP_441199.1_6 Reverse -247 -266 -0.590531 0.276
NP_439985.1_7 Forward -250 -231 1.96607 0.296
NP_442386.1_9 Reverse -250 -259 15.7322 0.0144
NP_442386.1_9 Forward -261 -252 13.8639 0.0289
NP_442386.1_9 Reverse -187 -196 4.62087 0.294
NP_441750.1_4 Reverse -210 -229 0.884433 0.291
NP_441340.1_5 Forward -259 -252 15.6737 0.0124
NP_441340.1_5 Reverse -252 -259 15.6737 0.0124
NP_442484.1_2 Forward -271 -252 -1.47551 0.292
NP_440168.1_4 Forward -360 -341 -6.58872 0.26
NP_440168.1_8 Forward -350 -331 6.98095 0.187
NP_439976.1_4 Forward -145 -126 5.30853 0.278
NP_442240.1_1 Forward -328 -309 30.3828 0.0000435
NP_442240.1_2 Forward -259 -240 33.9236 0.0000312
NP_442240.1_3 Forward -397 -378 31.5637 0.000207
NP_442240.1_4 Forward -232 -213 26.0572 0.00576
NP_442240.1_5 Forward -348 -329 29.5971 0.000167
NP_442240.1_6 Forward -304 -285 25.9588 0.00718
NP_442950.1_6 Forward -334 -315 11.2092 0.123
NP_440586.1_8 Forward -259 -252 13.2151 0.026
NP_440586.1_8 Reverse -252 -259 13.2151 0.026
NP_440586.1_8 Forward -343 -336 5.8403 0.283
NP_442251.1_6 Forward -259 -252 15.2804 0.0124
NP_442251.1_6 Reverse -252 -259 15.2804 0.0124
NP_440192.1_5 Forward -261 -242 6.88262 0.224
NP_442959.1_5 Forward -40 -21 12.5858 0.222
NP_441262.1_3 Reverse -251 -258 14.7888 0.0223
NP_441262.1_3 Forward -260 -253 14.7888 0.0223
NP_440027.1_3 Reverse -241 -259 12.6047 0.159
NP_440027.1_3 Reverse -123 -141 2.08335 0.293
NP_443051.1_1 Reverse -250 -259 10.4228 0.00754
NP_443051.1_1 Forward -261 -252 10.4228 0.00754
NP_439937.1_8 Forward -274 -255 -4.81876 0.286
NP_440439.1_1 Reverse -248 -261 8.37742 0.0537
NP_440439.1_1 Forward -263 -250 1.9859 0.138
NP_442239.1_4 Reverse -163 -182 28.3188 0.0000391
NP_440372.1_2 Forward -259 -252 16.3621 0.0124
NP_440372.1_2 Reverse -252 -259 16.3621 0.0124
NP_440819.1_5 Reverse -322 -330 7.98423 0.228
NP_441803.1_2 Reverse -246 -265 -1.27885 0.297
NP_440139.1_1 Forward -266 -247 12.29 0.0778
NP_441572.1_7 Reverse -245 -264 -0.590531 0.182
NP_440267.1_2 Forward -265 -251 12.2903 0.125
NP_440267.1_2 Reverse -64 -78 7.27547 0.202
NP_442384.1_10 Forward -260 -247 15.7522 0.00946
NP_442384.1_10 Reverse -251 -264 4.54251 0.153
NP_440364.1_6 Forward -326 -313 13.3917 0.282
NP_441877.1_7 Forward -361 -342 1.86696 0.241
NP_441018.1_7 Forward -264 -245 10.5209 0.202
NP_442262.1_10 Forward -259 -252 14.1988 0.0123
NP_442262.1_10 Reverse -252 -259 14.1988 0.0123
NP_441689.1_5 Reverse -249 -259 8.53436 0.132
NP_441689.1_5 Forward -262 -252 5.78111 0.197
NP_440163.1_10 Reverse -248 -258 16.303 0.0762
NP_440344.1_10 Forward -267 -250 -1.43612 0.0537
NP_440344.1_10 Reverse -244 -261 -4.87771 0.102
NP_440282.1_10 Forward -342 -323 -6.1954 0.25
NP_440531.1_6 Reverse -243 -262 -1.96717 0.241
NP_442832.1_2 Reverse -64 -83 12.7825 0.243
NP_441965.1_10 Forward -263 -247 4.87675 0.228
NP_442693.1_6 Reverse -63 -82 3.6377 0.278
NP_440297.1_9 Forward -259 -249 9.32148 0.0917
NP_440297.1_9 Reverse -252 -262 -0.118297 0.282
NP_440894.1_10 Reverse -154 -173 6.4893 0.215
NP_442067.1_4 Reverse -240 -259 6.19431 0.225
NP_440999.1_2 Reverse -312 -331 13.0775 0.177
NP_440999.1_9 Reverse -247 -261 13.1759 0.0329
NP_440888.1_2 Forward -260 -246 17.6002 0.00354
NP_440888.1_2 Reverse -251 -265 14.7486 0.0152
NP_440792.1_5 Reverse -252 -271 5.50599 0.246
NP_439969.1_3 Reverse -246 -265 2.65439 0.24
NP_442277.1_2 Forward -321 -307 19.2725 0.0963
NP_442277.1_2 Reverse -178 -192 18.4858 0.124
NP_441759.1_6 Reverse -332 -351 9.43923 0.257
NP_441543.1_2 Forward -259 -250 18.486 0.00236
NP_441543.1_2 Reverse -252 -261 16.9127 0.00359
NP_442845.1_2 Forward -260 -246 7.47274 0.195
NP_442845.1_2 Reverse -310 -324 7.47274 0.195
NP_441918.1_7 Forward -345 -326 6.39097 0.262
NP_441469.1_8 Reverse -250 -259 16.126 0.00797
NP_441469.1_8 Reverse -187 -196 9.73449 0.227
NP_441469.1_8 Forward -261 -252 6.48957 0.227
NP_443064.1_6 Reverse -251 -261 12.5669 0.0796
NP_442578.1_7 Forward -259 -252 14.5921 0.026
NP_442578.1_7 Reverse -252 -259 14.5921 0.026
NP_440710.1_1 Reverse -243 -261 -4.30741 0.208
NP_440071.1_6 Reverse -305 -319 13.611 0.261
NP_441462.1_2 Forward -260 -250 11.5831 0.00406
NP_441462.1_2 Reverse -251 -261 11.5831 0.00406
NP_441621.1_7 Forward -262 -248 -3.44199 0.188
NP_443062.1_1 Reverse -251 -269 14.0063 0.0538
NP_443062.1_1 Forward -260 -242 10.106 0.121
NP_443062.1_1 Forward -349 -331 3.37804 0.3
NP_443062.1_6 Forward -268 -249 9.73422 0.123
NP_440519.1_8 Reverse -311 -327 1.73016 0.279
NP_442204.1_1 Reverse -247 -258 9.69511 0.0736
NP_442204.1_1 Forward -342 -331 -0.432984 0.299
NP_442204.1_2 Reverse -253 -272 11.3075 0.223
NP_442204.1_2 Forward -270 -251 8.75091 0.239
NP_442204.1_9 Forward -348 -330 16.6455 0.238
NP_441560.1_10 Reverse -243 -262 7.66927 0.276
NP_440516.1_6 Reverse -179 -193 17.0102 0.186
NP_440516.1_6 Reverse -335 -349 8.3571 0.247
NP_440516.1_8 Forward -260 -251 16.9127 0.00442
NP_440516.1_8 Reverse -251 -260 16.9127 0.00442
NP_442428.1_4 Forward -139 -120 5.01433 0.222
NP_442428.1_5 Forward -259 -252 15.8704 0.0124
NP_442428.1_5 Reverse -252 -259 15.8704 0.0124
NP_442859.1_2 Forward -259 -240 14.8474 0.068
NP_441867.1_2 Reverse -302 -321 -20.3551 0.291
NP_440673.1_3 Forward -258 -251 12.4288 0.0426
NP_440673.1_3 Reverse -253 -260 12.4288 0.0426
NP_440673.1_3 Forward -318 -311 6.23397 0.283
NP_441052.1_2 Reverse -251 -261 19.9412 0.00106
NP_441052.1_2 Forward -260 -250 10.5014 0.0285
NP_442219.1_9 Reverse -252 -261 17.7976 0.00718
NP_442219.1_9 Forward -259 -250 8.35786 0.0681
NP_440436.1_4 Forward -259 -250 18.1905 0.00233
NP_440436.1_4 Reverse -252 -261 17.2072 0.00233
NP_441884.1_9 Reverse -307 -326 -22.8133 0.284
NP_441884.1_9 Reverse -248 -267 -23.895 0.284
NP_441884.1_9 Reverse -323 -342 -25.6649 0.29
NP_442086.1_6 Reverse -251 -270 11.1109 0.255
NP_442412.1_5 Forward -282 -263 4.22769 0.294
NP_441719.1_4 Forward -259 -252 16.3621 0.0124
NP_441719.1_4 Reverse -252 -259 16.3621 0.0124
NP_441733.1_10 Forward -263 -250 9.85238 0.106
NP_441004.1_1 Reverse -305 -324 -3.83545 0.164
NP_441004.1_1 Reverse -341 -360 -10.1286 0.218
NP_441004.1_2 Reverse -300 -319 4.42435 0.195
NP_441004.1_4 Reverse -308 -318 9.32148 0.259
NP_442366.1_3 Reverse -250 -268 4.05072 0.101
NP_442366.1_3 Forward -261 -243 -2.73412 0.232
NP_439949.1_7 Forward -161 -147 14.2576 0.226
NP_440129.1_10 Forward -267 -253 2.45787 0.253
NP_442873.1_9 Forward -270 -251 4.52188 0.287
NP_442206.1_10 Forward -260 -245 2.14318 0.205
NP_440094.1_2 Forward -349 -330 3.6377 0.254
NP_443054.1_2 Reverse -249 -263 3.44117 0.24
NP_443054.1_2 Forward -262 -248 1.08123 0.251
NP_441851.1_10 Reverse -250 -260 16.008 0.00552
NP_441851.1_10 Forward -261 -251 15.8113 0.00552
NP_442622.1_1 Reverse -170 -189 -3.3438 0.177
NP_442856.1_7 Reverse -228 -247 -6.49039 0.298
NP_442515.1_1 Reverse -250 -264 0.982901 0.174
NP_442515.1_1 Forward -261 -247 -4.81863 0.298
NP_440593.1_3 Forward -324 -305 9.24257 0.107
NP_440165.1_5 Reverse -250 -269 10.4225 0.0553
NP_441349.1_10 Forward -270 -251 0.687771 0.0867
NP_441349.1_10 Forward -301 -282 -4.91709 0.186
NP_441349.1_10 Reverse -241 -260 -7.96535 0.262
NP_441409.1_6 Reverse -245 -264 1.47442 0.0603
NP_441409.1_6 Reverse -276 -295 -8.16202 0.164
NP_440432.1_7 Reverse -240 -259 15.8307 0.111
NP_440432.1_9 Reverse -252 -267 7.74804 0.0427
NP_440432.1_9 Reverse -172 -187 -5.32998 0.245
NP_439960.1_10 Reverse -298 -316 -4.01242 0.287
NP_441477.1_10 Reverse -244 -262 2.67408 0.235
NP_442450.1_5 Reverse -249 -259 9.32148 0.115
NP_440195.1_4 Forward -385 -366 5.89931 0.284
NP_442006.1_2 Forward -197 -180 -7.63097 0.179
NP_442006.1_2 Reverse -310 -327 -17.3657 0.274
NP_441003.1_9 Reverse -242 -261 5.211 0.266
NP_441570.1_1 Forward -260 -242 1.59244 0.0299
NP_441570.1_1 Reverse -251 -269 -2.53746 0.0659
NP_440078.1_10 Forward -260 -241 5.40766 0.226
NP_441078.1_4 Forward -260 -251 19.6659 0.0007
NP_441078.1_4 Reverse -251 -260 19.6659 0.0007
NP_442729.1_8 Reverse -247 -260 8.08242 0.125
NP_440526.1_3 Reverse -252 -263 10.2846 0.0646
NP_441432.1_8 Forward -261 -252 16.8143 0.00595
NP_441432.1_8 Reverse -250 -259 8.25953 0.0755
NP_441432.1_9 Reverse -197 -210 12.6706 0.199
NP_442320.1_8 Reverse -245 -259 5.01447 0.0442
NP_442320.1_8 Forward -266 -252 3.63784 0.0578
NP_442344.1_7 Reverse -252 -271 -9.14533 0.239
NP_441732.1_2 Reverse -247 -263 1.92682 0.0254
NP_441732.1_2 Forward -17 -1 -17.4444 0.258
NP_440760.1_1 Forward -260 -241 -19.6667 0.219
NP_440760.1_1 Forward -373 -354 -21.83 0.245
NP_442274.1_8 Forward -327 -309 18.628 0.166
NP_440199.1_10 Forward -263 -253 7.25653 0.231
NP_441945.1_10 Forward -351 -332 7.37428 0.284
NP_441057.1_4 Forward -336 -318 -4.20908 0.299
NP_439900.1_10 Forward -204 -191 20.7671 0.189
NP_440913.1_1 Forward -262 -244 7.98396 0.195
NP_440913.1_1 Reverse -67 -85 3.3624 0.299
NP_442489.1_2 Forward -271 -252 2.45773 0.262
NP_442489.1_7 Forward -260 -251 20.1576 0.000695
NP_442489.1_7 Reverse -251 -260 20.1576 0.000695
NP_442079.1_7 Forward -259 -240 1.86774 0.24
NP_440559.1_1 Reverse -252 -261 17.4043 0.00658
NP_440559.1_1 Forward -259 -250 8.75118 0.0586
NP_441659.2_8 Reverse -251 -261 18.1713 0.00133
NP_441659.2_8 Forward -260 -250 11.9764 0.0147
NP_442913.1_10 Forward -269 -250 -5.21209 0.26
NP_442913.1_10 Reverse -352 -371 -5.60541 0.271
NP_441040.1_2 Forward -328 -309 -4.81876 0.173
NP_441040.1_2 Forward -262 -243 -15.9302 0.289
NP_442849.1_1 Forward -216 -202 10.9143 0.203
NP_442008.1_2 Reverse -248 -267 5.89931 0.223
NP_440708.1_6 Reverse -331 -350 -9.24366 0.261
NP_440779.1_5 Reverse -251 -268 -6.15601 0.164
NP_442346.1_5 Forward -261 -251 16.6963 0.00248
NP_442346.1_5 Reverse -250 -260 9.02648 0.118
NP_440545.1_3 Forward -264 -247 2.69378 0.0961
NP_441856.1_3 Forward -263 -244 -1.57384 0.239
NP_440025.1_1 Forward -264 -245 7.17762 0.243
NP_441710.1_9 Reverse -244 -263 11.2084 0.256
NP_440459.1_2 Forward -262 -245 12.3302 0.151
NP_441653.1_2 Forward -271 -252 20.3439 0.0262
NP_440010.1_4 Forward -264 -245 -0.39464 0.252
NP_440010.1_4 Reverse -325 -344 -0.787962 0.262
NP_442551.1_4 Forward -322 -307 -2.28172 0.259
NP_442603.1_7 Forward -260 -246 11.602 0.114
NP_441888.1_7 Reverse -246 -260 3.8345 0.225
NP_441888.1_7 Forward -265 -251 2.2612 0.225
NP_441948.1_4 Forward -267 -249 -2.0458 0.158
NP_441948.1_4 Reverse -244 -262 -4.60241 0.235
NP_441833.1_4 Forward -259 -252 15.9687 0.0124
NP_441833.1_4 Reverse -252 -259 15.9687 0.0124
NP_442162.1_9 Forward -259 -252 16.2637 0.0124
NP_442162.1_9 Reverse -252 -259 16.2637 0.0124
NP_440671.1_4 Reverse -245 -259 19.7641 0.00827
NP_440224.1_1 Reverse -240 -259 2.94938 0.132
NP_442199.1_5 Forward -268 -249 2.16274 0.152
NP_442140.1_3 Reverse -252 -262 10.3048 0.0902
NP_442140.1_3 Forward -259 -249 8.33817 0.119
NP_442140.1_3 Forward -343 -333 7.74818 0.13
NP_442140.1_3 Forward -196 -186 4.60159 0.242
NP_442021.1_3 Reverse -341 -360 -7.76869 0.28
NP_440875.1_9 Reverse -337 -347 10.0268 0.233
NP_440875.1_9 Forward -258 -248 9.05339 0.233
NP_440875.1_9 Reverse -253 -263 7.69067 0.255
NP_441813.1_5 Forward -262 -252 18.1713 0.00743
NP_441813.1_5 Reverse -249 -259 17.188 0.00979
NP_440590.1_4 Forward -259 -246 4.8375 0.0585
NP_440590.1_4 Reverse -252 -265 4.14919 0.0632
NP_440567.1_1 Forward -259 -245 6.78443 0.0803
NP_442497.1_10 Forward -259 -250 10.4228 0.0087
NP_442497.1_10 Reverse -252 -261 10.4228 0.0087
NP_440821.1_4 Reverse -249 -259 19.0562 0.00399
NP_440821.1_4 Forward -262 -252 9.41981 0.0286
NP_441239.1_9 Reverse -249 -261 13.3137 0.037
NP_441239.1_9 Forward -262 -250 7.80712 0.148
NP_441951.1_9 Forward -312 -293 1.96607 0.254
NP_441727.1_3 Forward -267 -248 3.44104 0.288
NP_441892.1_1 Reverse -242 -259 -5.46769 0.281
NP_441892.1_1 Forward -353 -336 -5.56602 0.283
NP_440833.1_6 Reverse -326 -340 9.53707 0.261
NP_440949.1_7 Forward -196 -177 12.6833 0.214
NP_441567.1_4 Reverse -260 -279 12.5858 0.119
NP_440354.1_5 Forward -323 -304 5.60432 0.193
NP_442138.1_10 Reverse -251 -270 12.8808 0.0359
NP_440412.1_2 Forward -400 -381 6.09597 0.283
NP_440546.1_4 Forward -260 -250 11.8882 0.0679
NP_440546.1_4 Reverse -251 -261 10.046 0.109
NP_440546.1_4 Forward -344 -334 7.71902 0.224
NP_442041.1_5 Forward -355 -336 0.196116 0.257
NP_441230.1_5 Reverse -240 -259 1.0811 0.253
NP_441230.1_5 Forward -265 -246 -0.000545616 0.277
NP_440675.1_3 Reverse -251 -270 7.37428 0.25
NP_440675.1_4 Forward -171 -152 11.4058 0.299
NP_440462.1_6 Reverse -249 -259 15.418 0.0142
NP_440462.1_6 Forward -262 -252 9.61647 0.0429
NP_442611.1_1 Forward -202 -183 3.04771 0.213
NP_440868.1_4 Reverse -247 -259 8.6921 0.0582
NP_440868.1_4 Forward -264 -252 7.80712 0.0637
NP_441204.1_1 Forward -269 -250 16.3224 0.101
NP_441672.1_6 Forward -328 -309 11.3067 0.266
NP_442402.1_4 Forward -340 -321 -2.45958 0.199
NP_442402.1_10 Forward -332 -322 10.4026 0.29
NP_441848.1_7 Reverse -199 -218 -4.62285 0.296
NP_441084.1_6 Forward -199 -185 9.34412 0.287
NP_440696.1_3 Forward -260 -242 -1.35749 0.257
NP_441843.2_9 Forward -244 -226 12.34 0.205
NP_442039.1_4 Forward -259 -252 15.1821 0.0124
NP_442039.1_4 Reverse -252 -259 15.1821 0.0124
NP_442409.1_10 Forward -323 -309 14.5519 0.293
NP_442409.1_10 Forward -329 -315 14.4536 0.293
NP_442837.1_3 Forward -259 -252 15.7721 0.0124
NP_442837.1_3 Reverse -252 -259 15.7721 0.0124
NP_440160.1_2 Reverse -323 -342 -8.45701 0.286
NP_442053.1_1 Forward -260 -251 18.3876 0.0007
NP_442053.1_1 Reverse -251 -260 18.3876 0.0007
NP_440505.1_3 Forward -262 -252 18.3679 0.00213
NP_440505.1_3 Reverse -249 -259 13.8447 0.0247
NP_440505.1_7 Forward -253 -234 -1.67217 0.279
NP_441203.1_1 Forward -259 -240 -10.3253 0.137
NP_440914.1_1 Reverse -251 -261 17.5935 0.000537
NP_440914.1_1 Forward -260 -250 8.6151 0.186
NP_441011.1_8 Forward -259 -250 16.9127 0.00602
NP_441011.1_8 Reverse -252 -261 8.25953 0.144
NP_442101.1_10 Reverse -243 -262 -7.96535 0.224
NP_442533.1_6 Forward -260 -251 17.2076 0.00137
NP_442533.1_6 Reverse -251 -260 17.2076 0.00137
NP_442533.1_6 Reverse -129 -138 4.42462 0.179
NP_442533.1_6 Reverse -188 -197 2.06468 0.275
NP_442541.1_10 Forward -327 -313 5.21053 0.248
NP_440263.1_1 Forward -380 -367 17.1168 0.239
NP_442232.1_3 Reverse -306 -325 -15.3402 0.291
NP_441482.1_7 Reverse -245 -259 10.1277 0.0135
NP_441482.1_7 Forward -266 -252 -12.1934 0.29
NP_439944.1_9 Reverse -252 -262 10.5014 0.0887
NP_439944.1_9 Forward -259 -249 10.3048 0.0887
NP_441028.1_6 Reverse -208 -218 14.9258 0.158
NP_441028.1_6 Forward -245 -235 6.17443 0.232
NP_441028.1_6 Forward -331 -321 5.48612 0.255
NP_442202.1_10 Forward -366 -352 2.94952 0.282
NP_440116.1_8 Reverse -252 -271 -3.73712 0.158
NP_441527.1_4 Forward -210 -191 -4.15432 0.179
NP_440115.1_6 Forward -263 -253 6.8632 0.167
NP_440007.1_9 Reverse -247 -261 3.73617 0.267
NP_442492.1_2 Reverse -251 -270 0.392778 0.241
NP_443045.1_2 Forward -326 -307 16.6174 0.181
NP_441972.1_5 Forward -271 -252 -9.14533 0.281
NP_441106.1_1 Reverse -250 -259 18.191 0.0028
NP_441106.1_1 Forward -261 -252 9.63616 0.0311
NP_439903.1_6 Reverse -326 -345 -0.689632 0.284
NP_440302.1_4 Reverse -356 -375 12.5858 0.283
NP_441286.1_1 Forward -261 -249 14.4936 0.00418
NP_441286.1_1 Reverse -250 -262 3.38223 0.0467
NP_441286.1_1 Forward -292 -280 -6.5492 0.267
NP_442058.1_9 Reverse -24 -38 17.0108 0.252
NP_440670.1_8 Forward -260 -251 18.3876 0.000699
NP_440670.1_8 Reverse -251 -260 18.3876 0.000699
NP_440886.1_7 Reverse -250 -260 17.7774 0.0011
NP_440886.1_7 Forward -261 -251 7.94438 0.0805
NP_440886.1_7 Forward -357 -347 4.89613 0.213
NP_442072.1_9 Forward -261 -243 -5.48739 0.065
NP_441808.1_8 Forward -203 -184 5.89931 0.294
NP_440907.2_8 Forward -259 -249 7.84605 0.117
NP_442264.1_2 Forward -264 -247 6.62702 0.251
NP_441021.1_1 Reverse -252 -271 0.196116 0.0924
NP_441021.1_1 Reverse -260 -279 -12.8819 0.299
NP_440841.1_4 Reverse -249 -268 -6.49039 0.215
NP_441463.1_3 Forward -270 -251 17.994 0.0113
NP_441463.1_5 Reverse -250 -264 13.4709 0.188
NP_441463.1_6 Forward -262 -248 5.54623 0.287
NP_441626.1_2 Forward -259 -252 15.7721 0.0124
NP_441626.1_2 Reverse -252 -259 15.7721 0.0124
NP_442221.1_4 Reverse -301 -320 5.99764 0.296
NP_442365.1_7 Reverse -247 -266 -0.000545616 0.177
NP_442362.1_1 Reverse -295 -314 7.47261 0.288
NP_442794.1_1 Reverse -247 -259 10.1671 0.0721
NP_442794.1_1 Reverse -331 -343 9.77374 0.0789
NP_442615.1_1 Forward -269 -251 7.68896 0.0306
NP_440387.1_1 Forward -260 -244 12.6449 0.0112
NP_441993.1_1 Forward -260 -241 15.006 0.0763
NP_441993.1_4 Reverse -220 -239 14.4533 0.197
NP_442352.1_1 Reverse -182 -195 17.8967 0.13
NP_440114.1_10 Reverse -251 -265 10.1277 0.153
NP_441858.1_2 Reverse -367 -386 10.427 0.278
NP_442437.1_8 Reverse -180 -199 2.85105 0.296
NP_441510.2_7 Reverse -245 -259 10.8154 0.28
NP_440287.1_5 Reverse -204 -223 10.9134 0.286
NP_440293.1_3 Reverse -339 -358 -6.98204 0.296
NP_440293.1_3 Forward -256 -237 -6.98204 0.296
NP_440766.1_4 Reverse -247 -261 8.25939 0.0871
NP_442743.1_4 Forward -259 -240 -0.787193 0.181
NP_439910.1_2 Reverse -243 -260 -13.5308 0.162
NP_439910.1_2 Forward -268 -251 -21.6923 0.184
NP_440457.1_1 Reverse -247 -259 8.29878 0.101
NP_440457.1_1 Forward -264 -252 -0.649339 0.271
NP_440457.1_1 Forward -82 -70 -1.04266 0.289
NP_440798.1_6 Forward -259 -246 3.85419 0.147
NP_442297.1_4 Reverse -247 -266 12.7242 0.263
NP_441984.1_1 Forward -173 -155 5.82068 0.288
NP_441436.1_8 Forward -261 -242 14.4541 0.215
NP_442509.1_9 Forward -260 -250 16.2041 0.00739
NP_442509.1_9 Reverse -251 -261 8.14104 0.192
NP_442509.1_9 Reverse -316 -326 6.27276 0.279
NP_440554.1_4 Forward -259 -249 14.6313 0.02
NP_440554.1_4 Reverse -252 -262 8.92815 0.0646
NP_441845.1_6 Forward -284 -266 3.85406 0.217
NP_441885.1_5 Reverse -251 -261 20.9245 0.000538
NP_441885.1_5 Forward -260 -250 11.4848 0.00668
NP_440478.1_4 Reverse -301 -320 12.0942 0.239
NP_442341.1_7 Forward -261 -247 17.7975 0.0111
NP_442341.1_7 Forward -357 -343 3.04785 0.237
NP_442341.1_7 Reverse -250 -264 1.47456 0.288
NP_442341.1_9 Reverse -249 -263 5.89884 0.252
NP_441756.1_5 Reverse -247 -266 5.99764 0.183
NP_441173.1_9 Forward -330 -322 9.75379 0.284
NP_442395.2_4 Forward -201 -182 3.14526 0.207
NP_440423.1_6 Forward -230 -211 -19.8634 0.247
NP_443000.1_7 Forward -262 -252 19.9412 0.00223
NP_443000.1_7 Reverse -249 -259 8.73149 0.0437
NP_440076.1_5 Reverse -316 -335 15.3382 0.177
NP_441842.1_10 Forward -267 -253 6.09611 0.299
NP_440275.1_3 Forward -262 -252 15.123 0.0182
NP_440275.1_3 Reverse -249 -259 8.4365 0.0602
NP_440091.1_1 Forward -264 -252 8.88877 0.0567
NP_440091.1_1 Reverse -247 -259 1.41561 0.197
NP_443010.1_10 Reverse -248 -265 4.89674 0.216
NP_442451.1_2 Reverse -229 -248 -8.45701 0.248
NP_440149.1_8 Forward -260 -241 2.55606 0.109
NP_442214.1_1 Forward -309 -290 16.4207 0.164
NP_441105.1_3 Reverse -336 -355 -6.68705 0.239
NP_441105.1_3 Forward -208 -189 -7.57203 0.255
NP_441105.1_3 Forward -265 -246 -7.67036 0.258
NP_440216.1_1 Reverse -251 -265 7.9644 0.00737
NP_440216.1_1 Forward -260 -246 7.57108 0.00935
NP_440216.1_1 Forward -246 -232 -11.1118 0.163
NP_440172.1_1 Reverse -251 -261 15.0247 0.00945
NP_440172.1_1 Forward -260 -250 8.73149 0.0586
NP_442015.1_10 Reverse -247 -260 19.1938 0.00444
NP_442015.1_10 Forward -264 -251 2.87088 0.187
NP_441226.1_7 Forward -259 -252 14.4934 0.0123
NP_441226.1_7 Reverse -252 -259 14.4934 0.0123
NP_441111.1_7 Forward -259 -251 18.7023 0.00294
NP_441111.1_7 Reverse -252 -260 18.7023 0.00294
NP_440244.1_1 Reverse -308 -327 1.27776 0.187
NP_440244.1_1 Reverse -309 -328 -9.44032 0.287
NP_441766.1_2 Forward -260 -251 17.5026 0.00297
NP_441766.1_2 Reverse -251 -260 17.5026 0.00297
NP_442417.1_5 Forward -260 -246 19.4691 0.0165
NP_442252.1_3 Forward -267 -249 9.16393 0.244
NP_440416.1_9 Reverse -244 -263 -4.32711 0.077
NP_440416.1_9 Forward -267 -248 -8.752 0.12
NP_440416.1_9 Forward -327 -308 -15.9302 0.204
NP_443052.1_8 Forward -270 -251 -7.57203 0.161
NP_443052.1_9 Forward -324 -305 -1.86883 0.231
NP_440591.1_9 Forward -261 -243 7.68896 0.196
NP_442154.1_1 Forward -81 -63 -16.0088 0.229
NP_442154.1_1 Reverse -345 -363 -16.3038 0.238
NP_440261.1_5 Forward -259 -246 -1.06236 0.0655
NP_440261.1_5 Reverse -252 -265 -12.1738 0.272
NP_440988.1_10 Reverse -309 -323 3.54345 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGGTTTTATTGTGGGCTAATACCAATGTTGGTCGTCCCAACTCCGCAATAACCGAAGCCATGGTGAAGGTTTTCCCCGTTCCCGTTGCCCCCAGCAGGGTTTGAAACTTGTGCTCTCCCTGCAAAGACTCGATCAAACTGGCGATCGCCGTGGGTTGATCTCCGGTAGGACGAAAGGGCGCATGGAGGGAAAAGAGGTCAGAAGTCATGGCGGCAAAGGAGCTATAGTCTGGGATAATAGGGCTGATTAAAGATAACTATCGTGGCTGGCCATTCAGCGGTGTATCTTTGAAGACAAGCAGAGTAATGCTAACAAAACACGGTGGGTGGCCTGTCTGTCTCGCACAGTGCTTTATTGTTGATCAATTAATCGAATATTTATATTAAGGAGATAAACAGC

CDS

ATGACTGAGGAACAGCAGGGGCCCAACACCACCCCCAACGAAGAAACCGCCAGCAAAACCACTGCCGCTAACCGGAGCCGTCGTCCTAGAGCCGGTTCCAGCAAAGATGAGTCCGCCTTGGTGAAGCCCAAGCATATCGGTGGTCTTGATCTACTGCCTACCCCCAAGGGCATGCCCACTAATCGACCGATTGAAGCCAGCAAGATCCATGTGGTAAGTACTTATGGTTCTATGGGAGCCACCAGACCAGTGGGGGCCAGCACCATGGAAGTGAGCAGTACCATGACCGTTTCCGGTAATCGCCCCATTGCCCTGAGCCATCTCCACATCAGCGAAATCACCGCTGGCAATCGTCCCGTAGCTTCCAACGAGATTGATGATCCCAACACCCTGATGGGCTACCTGGATTAG

Protein

MTEEQQGPNTTPNEETASKTTAANRSRRPRAGSSKDESALVKPKHIGGLDLLPTPKGMPTNRPIEASKIHVVSTYGSMGATRPVGASTMEVSSTMTVSGNRPIALSHLHISEITAGNRPVASNEIDDPNTLMGYLD