Your browser is old and dusty. Try Google Chrome!

Details for slr0474

ORF slr0474
Accession NP_442238.1
Symbol rcp1
Category two-component response regulator CheY subfamily, regulator for phytochrome 1 (Cph1)
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -213 -227 10.521 0.278
NP_441061.1_2 Reverse -207 -221 14.0609 0.0392
NP_441061.1_2 Forward -311 -297 4.52282 0.147
NP_441061.1_2 Forward -221 -207 3.34284 0.165
NP_441061.1_2 Forward -35 -21 2.2612 0.178
NP_441061.1_2 Forward -215 -201 1.86788 0.181
NP_441061.1_2 Forward -259 -245 0.589577 0.205
NP_441061.1_2 Reverse -201 -215 -0.688726 0.237
NP_440795.1_7 Forward -259 -252 14.6904 0.0123
NP_440795.1_7 Reverse -252 -259 14.6904 0.0123
NP_441418.1_3 Reverse -3 -22 12.6523 0.211
NP_441418.1_6 Reverse -251 -270 -13.4719 0.0767
NP_441418.1_6 Forward -260 -241 -28.4182 0.205
NP_441418.1_6 Forward -249 -230 -30.1882 0.262
NP_441453.1_1 Forward -267 -249 6.21323 0.241
NP_441453.1_4 Reverse -251 -259 16.539 0.00633
NP_441453.1_4 Forward -260 -252 16.539 0.00633
NP_441453.1_7 Reverse -56 -63 12.9205 0.23
NP_441453.1_7 Reverse -148 -155 11.9372 0.298
NP_441453.1_8 Forward -139 -122 6.72535 0.288
NP_442151.1_6 Reverse -251 -265 18.2892 0.00782
NP_442151.1_6 Forward -260 -246 9.43936 0.148
NP_442151.1_6 Forward -318 -304 9.14437 0.157
NP_442151.1_6 Reverse -309 -323 8.35772 0.175
NP_441818.1_1 Reverse -252 -263 11.4645 0.177
NP_441818.1_1 Forward -259 -248 9.79292 0.232
NP_440226.1_1 Forward -260 -241 1.96607 0.282
NP_441630.1_3 Reverse -243 -262 6.39097 0.126
NP_442623.1_3 Forward -259 -240 -18.2901 0.263
NP_442655.1_10 Forward -240 -221 -19.2734 0.282
NP_442173.1_1 Forward -259 -251 15.4574 0.00633
NP_442173.1_1 Reverse -252 -260 15.4574 0.00633
NP_442752.1_4 Forward -260 -253 13.8055 0.0199
NP_442752.1_4 Reverse -251 -258 13.8055 0.0199
NP_442752.1_4 Reverse -27 -34 12.1338 0.0546
NP_442752.1_4 Forward -59 -52 9.47889 0.109
NP_442752.1_4 Reverse -309 -316 4.26735 0.293
NP_443027.1_4 Reverse -249 -259 11.0914 0.107
NP_443027.1_4 Forward -308 -298 6.76487 0.269
NP_443027.1_4 Forward -262 -252 6.46988 0.275
NP_441812.1_3 Reverse -308 -322 9.83269 0.228
NP_441812.1_3 Reverse -59 -73 7.57108 0.272
NP_442975.1_10 Forward -264 -250 11.602 0.0497
NP_442975.1_10 Forward -322 -308 8.16044 0.105
NP_441225.1_4 Reverse -124 -143 -4.91709 0.27
NP_440784.1_7 Forward -259 -252 15.9687 0.0123
NP_440784.1_7 Reverse -252 -259 15.9687 0.0123
NP_440061.1_9 Reverse -249 -263 20.0584 0.0045
NP_440061.1_9 Forward -103 -89 11.4053 0.111
NP_440110.1_4 Reverse -62 -81 2.75272 0.244
NP_441054.1_4 Forward -270 -252 -1.25915 0.198
NP_441054.1_4 Reverse -76 -94 -4.01242 0.294
NP_442062.1_8 Reverse -251 -261 17.6796 0.00193
NP_442062.1_8 Forward -260 -250 17.3846 0.00193
NP_442062.1_8 Reverse -92 -102 10.0098 0.0527
NP_441859.1_3 Reverse -250 -269 8.16011 0.144
NP_440304.1_4 Forward -262 -252 17.9746 0.00654
NP_440304.1_4 Forward -139 -129 10.1081 0.051
NP_440304.1_4 Forward -223 -213 3.32329 0.299
NP_440304.1_4 Reverse -249 -259 1.84832 0.299
NP_442242.1_4 Forward -259 -252 14.3954 0.0124
NP_442242.1_4 Reverse -252 -259 14.3954 0.0124
NP_439918.1_3 Reverse -96 -115 5.70265 0.264
NP_441935.1_1 Reverse -303 -322 7.7676 0.24
NP_441935.1_1 Reverse -191 -210 5.50599 0.293
NP_441208.1_9 Forward -240 -226 4.91614 0.282
NP_441594.1_6 Reverse -300 -319 0.491109 0.285
NP_442110.1_7 Forward -260 -246 0.88457 0.245
NP_440273.1_2 Forward -311 -292 10.1267 0.288
NP_440273.1_3 Forward -137 -118 9.24257 0.19
NP_440856.1_4 Reverse -244 -263 13.2741 0.0346
NP_440856.1_4 Reverse -108 -127 3.73603 0.12
NP_440856.1_7 Forward -372 -353 -6.49039 0.245
NP_441083.1_5 Forward -260 -250 20.3345 0.00053
NP_441083.1_5 Reverse -251 -261 19.3512 0.000718
NP_441083.1_5 Forward -318 -308 8.1415 0.0443
NP_442827.1_8 Forward -268 -249 -0.591301 0.231
NP_441738.1_2 Forward -258 -251 15.28 0.0102
NP_441738.1_2 Reverse -253 -260 15.28 0.0102
NP_441558.1_5 Reverse -249 -268 20.2556 0.00543
NP_441558.1_5 Forward -262 -243 9.24257 0.126
NP_441942.1_6 Reverse -244 -263 13.016 0.298
NP_440209.1_1 Reverse -251 -259 18.1123 0.00295
NP_440209.1_1 Forward -260 -252 18.1123 0.00295
NP_442889.1_8 Forward -263 -249 9.83206 0.0943
NP_440447.1_6 Forward -268 -250 8.96727 0.139
NP_441713.1_1 Forward -266 -247 -14.6519 0.259
NP_441770.1_4 Forward -338 -319 -11.9969 0.29
NP_440178.1_7 Forward -261 -242 -21.24 0.215
NP_442570.1_3 Reverse -58 -77 -5.60541 0.246
NP_441716.1_1 Reverse -251 -265 10.7177 0.0936
NP_440644.1_4 Reverse -177 -196 10.7175 0.27
NP_442111.1_4 Reverse -250 -264 21.1407 0.00255
NP_442111.1_4 Forward -261 -247 2.5562 0.271
NP_441624.1_7 Reverse -123 -137 10.7177 0.217
NP_440906.1_5 Forward -259 -252 15.8704 0.0124
NP_440906.1_5 Reverse -252 -259 15.8704 0.0124
NP_441209.1_4 Forward -78 -59 13.3716 0.259
NP_440747.1_1 Forward -38 -20 6.41066 0.259
NP_440747.1_10 Reverse -248 -260 26.5883 0.000317
NP_440747.1_10 Forward -263 -251 -2.02597 0.0196
NP_440747.1_10 Forward -129 -117 -11.7607 0.142
NP_441130.1_10 Forward -262 -248 8.25939 0.139
NP_441130.1_10 Reverse -249 -263 6.98109 0.173
NP_441486.1_1 Reverse -248 -262 -2.65535 0.175
NP_442145.1_4 Forward -284 -265 3.77151 0.284
NP_442634.1_4 Forward -262 -248 5.01447 0.0671
NP_442634.1_4 Reverse -249 -263 -3.34366 0.161
NP_441265.1_3 Forward -266 -252 5.01447 0.181
NP_440842.1_10 Forward -263 -249 1.27789 0.294
NP_441014.1_5 Reverse -112 -130 8.96727 0.291
NP_442848.1_1 Forward -266 -252 -1.5737 0.263
NP_443018.1_3 Forward -259 -252 14.8871 0.0123
NP_443018.1_3 Reverse -252 -259 14.8871 0.0123
NP_441316.1_7 Forward -262 -247 5.19144 0.121
NP_441634.1_8 Reverse -249 -263 6.48943 0.114
NP_441634.1_8 Forward -233 -219 -1.77037 0.295
NP_441634.1_8 Forward -212 -198 -4.32697 0.295
NP_440376.1_1 Forward -260 -251 19.4693 0.000692
NP_440376.1_1 Reverse -251 -260 19.4693 0.000692
NP_440376.1_1 Forward -126 -117 5.80125 0.119
NP_441588.1_4 Forward -316 -306 8.33817 0.151
NP_442730.1_8 Reverse -301 -320 2.85027 0.279
NP_440580.1_4 Forward -127 -108 10.2259 0.169
NP_442687.1_7 Forward -261 -251 18.5646 0.0028
NP_442687.1_7 Reverse -250 -260 8.92815 0.0994
NP_442687.1_7 Reverse -199 -209 3.81494 0.286
NP_441846.1_10 Forward -261 -242 -22.6167 0.264
NP_440781.1_1 Forward -98 -84 11.2093 0.293
NP_440741.1_1 Forward -378 -359 12.6833 0.115
NP_440533.1_6 Reverse -85 -104 7.37428 0.297
NP_440533.1_9 Forward -260 -241 3.73603 0.239
NP_440236.1_2 Reverse -167 -185 -4.11075 0.277
NP_442658.1_1 Forward -262 -252 17.6791 0.00565
NP_442658.1_1 Reverse -249 -259 7.94438 0.199
NP_442658.1_1 Forward -362 -352 5.58445 0.262
NP_440141.1_8 Forward -269 -250 3.93269 0.296
NP_442782.1_2 Reverse -207 -221 4.22782 0.256
NP_442782.1_2 Forward -221 -207 0.491246 0.289
NP_442782.1_2 Reverse -291 -305 0.196253 0.293
NP_442782.1_7 Reverse -19 -38 1.17943 0.207
NP_441414.1_9 Forward -260 -241 11.9958 0.0169
NP_441414.1_9 Reverse -251 -270 -2.26216 0.112
NP_441256.1_1 Forward -257 -238 -9.53865 0.287
NP_442937.1_5 Reverse -78 -97 7.17762 0.26
NP_441958.1_5 Forward -261 -251 20.5312 0.000966
NP_441958.1_5 Reverse -250 -260 12.2714 0.00183
NP_442836.1_5 Forward -266 -247 4.81767 0.202
NP_439905.1_1 Forward -259 -246 11.6223 0.204
NP_440984.1_7 Reverse -246 -260 19.0758 0.00991
NP_439990.1_5 Forward -265 -252 12.9006 0.105
NP_439990.1_5 Reverse -246 -259 10.4424 0.128
NP_442690.1_1 Reverse -378 -397 -14.3569 0.272
NP_442911.1_2 Reverse -241 -260 16.3224 0.00925
NP_442911.1_2 Forward -270 -251 14.4541 0.0112
NP_441591.1_10 Reverse -300 -319 7.86593 0.267
NP_442064.1_1 Reverse -105 -124 -10.227 0.259
NP_442064.1_1 Forward -41 -22 -13.4719 0.289
NP_443055.1_3 Reverse -51 -70 10.9316 0.273
NP_440993.1_3 Reverse -241 -260 3.53858 0.181
NP_440496.1_1 Forward -92 -73 20.354 0.0124
NP_440138.1_6 Forward -259 -240 4.03023 0.24
NP_440138.1_7 Reverse -241 -259 15.5672 0.278
NP_440615.1_2 Forward -389 -370 11.8975 0.135
NP_440615.1_2 Reverse -74 -93 10.7175 0.144
NP_441099.1_5 Forward -270 -251 0.687771 0.0744
NP_441099.1_5 Reverse -241 -260 -10.6203 0.258
NP_442002.1_9 Forward -261 -254 14.1004 0.074
NP_442002.1_9 Forward -86 -79 11.1505 0.185
NP_440809.1_9 Forward -327 -309 2.57575 0.118
NP_441294.1_7 Forward -322 -308 9.05865 0.263
NP_441646.1_1 Forward -267 -248 1.86774 0.227
NP_442438.1_10 Reverse -246 -260 2.35953 0.178
NP_441000.1_6 Forward -261 -247 -2.95034 0.221
NP_440147.1_4 Reverse -249 -262 18.4072 0.00407
NP_440147.1_4 Forward -262 -249 11.6223 0.0326
NP_441550.1_8 Forward -262 -252 19.8424 0.00352
NP_441550.1_8 Reverse -249 -259 15.1225 0.0132
NP_441550.1_8 Reverse -307 -317 8.23937 0.127
NP_441550.1_8 Forward -320 -310 5.87944 0.224
NP_441916.1_7 Reverse -251 -261 16.893 0.00407
NP_441916.1_7 Forward -260 -250 10.3048 0.0261
NP_440206.1_4 Reverse -118 -137 5.60352 0.242
NP_441041.1_4 Forward -221 -202 1.37609 0.0808
NP_441041.1_4 Reverse -207 -226 -1.37718 0.1
NP_441041.1_4 Reverse -251 -270 -9.93197 0.226
NP_441041.1_7 Forward -263 -251 12.4708 0.0611
NP_441041.1_7 Reverse -248 -260 7.51478 0.162
NP_440715.1_1 Forward -221 -202 16.5191 0.072
NP_442396.1_5 Reverse -42 -55 5.52582 0.28
NP_440569.1_10 Reverse -380 -399 5.39487 0.24
NP_441568.1_7 Reverse -213 -232 14.5524 0.114
NP_442004.1_6 Reverse -239 -253 9.43936 0.14
NP_441725.1_5 Reverse -252 -262 18.7612 0.0119
NP_441725.1_5 Forward -259 -249 2.04498 0.115
NP_439966.1_7 Reverse -249 -259 15.3192 0.0152
NP_439966.1_7 Forward -262 -252 8.14104 0.14
NP_439966.1_7 Forward -320 -310 4.69947 0.263
NP_439966.1_9 Forward -262 -253 0.983037 0.253
NP_442941.1_3 Forward -259 -249 19.2529 0.00262
NP_442941.1_3 Reverse -252 -262 2.43831 0.14
NP_440289.1_2 Forward -263 -250 11.4257 0.0196
NP_440289.1_2 Reverse -248 -261 5.91914 0.0605
NP_441514.1_1 Reverse -73 -83 13.7721 0.284
NP_442281.1_1 Reverse -246 -260 15.9285 0.00992
NP_442281.1_1 Forward -220 -206 3.14559 0.243
NP_442281.1_1 Forward -265 -251 1.5723 0.296
NP_440018.1_3 Forward -137 -118 3.04771 0.28
NP_442256.1_2 Forward -262 -244 8.86894 0.0965
NP_442500.1_8 Forward -110 -96 13.4562 0.198
NP_442012.1_1 Reverse -245 -264 11.9958 0.0721
NP_442012.1_4 Reverse -220 -239 19.1731 0.224
NP_441556.1_10 Reverse -246 -260 13.4339 0.178
NP_440498.1_1 Reverse -242 -260 2.28076 0.193
NP_441644.1_6 Forward -260 -250 17.3841 0.00127
NP_441644.1_6 Reverse -251 -261 15.7125 0.0048
NP_441644.1_6 Forward -311 -301 5.28945 0.199
NP_441644.1_6 Forward -318 -308 4.60114 0.233
NP_443049.1_6 Reverse -26 -36 16.3254 0.114
NP_443049.1_6 Reverse -308 -318 13.5928 0.154
NP_442215.1_2 Forward -262 -246 1.73016 0.128
NP_442215.1_2 Reverse -198 -214 0.845183 0.147
NP_442215.1_2 Reverse -46 -62 -0.138127 0.162
NP_442215.1_2 Forward -100 -84 -0.728113 0.171
NP_442215.1_2 Forward -38 -22 -4.56302 0.235
NP_442215.1_2 Reverse -12 -28 -7.41462 0.294
NP_442177.1_5 Reverse -300 -314 10.1277 0.229
NP_442029.1_5 Forward -261 -242 16.3242 0.219
NP_442247.1_8 Reverse -249 -263 13.4709 0.247
NP_440253.1_2 Reverse -251 -269 6.31233 0.0823
NP_440929.1_8 Forward -260 -251 19.2726 0.000701
NP_440929.1_8 Reverse -251 -260 19.2726 0.000701
NP_440929.1_8 Reverse -182 -191 1.76968 0.277
NP_441346.1_4 Forward -261 -242 12.7825 0.268
NP_441346.1_6 Forward -371 -353 18.997 0.22
NP_442933.1_10 Forward -260 -251 17.601 0.00325
NP_442933.1_10 Reverse -251 -260 17.601 0.00325
NP_441751.2_8 Forward -259 -245 5.01447 0.0448
NP_441751.2_8 Reverse -252 -266 -5.31028 0.202
NP_442554.1_8 Reverse -252 -262 16.9913 0.0065
NP_442554.1_8 Forward -259 -249 16.2046 0.0065
NP_442970.1_3 Forward -195 -177 12.3015 0.247
NP_441762.1_7 Reverse -250 -262 2.59558 0.0676
NP_441762.1_7 Forward -261 -249 1.80894 0.0735
NP_441762.1_7 Forward -361 -349 -6.15587 0.276
NP_442313.1_3 Reverse -258 -277 6.39097 0.271
NP_442142.1_4 Forward -159 -146 10.1468 0.079
NP_442142.1_4 Reverse -348 -361 8.47516 0.113
NP_442142.1_4 Reverse -248 -261 6.80355 0.154
NP_442142.1_4 Forward -263 -250 3.95196 0.239
NP_442292.1_1 Forward -259 -250 18.486 0.00229
NP_442292.1_1 Reverse -252 -261 9.53783 0.0183
NP_442292.1_1 Forward -317 -308 -0.786921 0.287
NP_442476.1_6 Forward -259 -245 11.3077 0.056
NP_442476.1_6 Reverse -252 -266 1.08123 0.231
NP_440421.1_1 Reverse -300 -314 16.3225 0.177
NP_442381.1_8 Forward -263 -244 -14.2585 0.28
NP_443009.1_5 Reverse -250 -261 15.7911 0.0107
NP_443009.1_5 Forward -261 -250 11.1696 0.066
NP_443009.1_5 Forward -249 -238 3.69644 0.282
NP_441715.1_4 Forward -259 -249 17.3846 0.0106
NP_440357.1_3 Forward -262 -243 5.11266 0.242
NP_440015.1_9 Reverse -251 -269 0.21581 0.255
NP_441198.1_5 Forward -316 -303 12.3101 0.228
NP_441198.1_8 Forward -262 -252 15.2245 0.0427
NP_440379.1_5 Reverse -197 -216 -3.24547 0.204
NP_441468.1_1 Forward -259 -252 15.8704 0.0124
NP_441468.1_1 Reverse -252 -259 15.8704 0.0124
NP_441020.2_6 Forward -262 -245 12.1336 0.101
NP_441015.1_10 Forward -265 -246 -11.4069 0.296
NP_441673.1_1 Forward -260 -251 20.8459 0.000698
NP_441673.1_1 Reverse -251 -260 20.8459 0.000698
NP_441731.1_3 Reverse -243 -262 3.53937 0.159
NP_441339.1_4 Forward -216 -197 -3.3438 0.227
NP_442253.1_5 Reverse -197 -214 0.333834 0.203
NP_441876.1_9 Reverse -283 -293 10.5993 0.287
NP_441826.1_2 Forward -266 -252 4.32615 0.104
NP_441826.1_2 Reverse -245 -259 -2.45868 0.271
NP_441826.1_2 Reverse -303 -317 -2.95034 0.28
NP_441826.1_2 Reverse -21 -35 -3.54032 0.286
NP_441330.1_1 Reverse -246 -265 -12.7836 0.183
NP_442490.1_10 Forward -102 -84 8.08229 0.286
NP_442868.1_6 Reverse -249 -259 19.2529 0.00563
NP_442868.1_6 Forward -262 -252 16.7946 0.0131
NP_442719.1_2 Reverse -68 -86 -4.30813 0.21
NP_441612.1_2 Forward -260 -250 8.54929 0.21
NP_442427.1_8 Forward -269 -250 14.4541 0.117
NP_442808.1_1 Forward -261 -251 8.73102 0.0481
NP_442808.1_1 Reverse -250 -260 8.63269 0.0481
NP_442808.1_1 Forward -37 -27 2.63453 0.26
NP_441101.1_10 Reverse -247 -266 -1.37718 0.199
NP_442775.1_6 Forward -311 -292 12.3892 0.277
NP_442542.1_2 Forward -262 -249 20.6688 0.00569
NP_442050.1_5 Forward -262 -252 14.9258 0.0175
NP_442050.1_5 Reverse -249 -259 14.3359 0.0206
NP_442050.1_7 Forward -245 -226 20.7473 0.156
NP_442342.1_9 Reverse -249 -265 6.35172 0.221
NP_440558.1_2 Reverse -197 -216 14.3558 0.0634
NP_440558.1_2 Forward -213 -194 -6.49039 0.275
NP_441518.1_3 Reverse -172 -191 -13.5702 0.264
NP_441878.1_6 Forward -261 -251 20.2362 0.0046
NP_441878.1_6 Reverse -250 -260 10.4031 0.0176
NP_441878.1_6 Reverse -49 -59 -1.00328 0.188
NP_441878.1_6 Reverse -66 -76 -7.59145 0.245
NP_441036.1_8 Forward -261 -251 8.4365 0.174
NP_441036.1_8 Reverse -250 -260 8.33817 0.174
NP_441557.1_5 Forward -260 -251 19.9609 0.000699
NP_441557.1_5 Reverse -251 -260 19.9609 0.000699
NP_442066.2_4 Reverse -351 -370 -8.94866 0.296
NP_442066.2_9 Reverse -247 -260 10.8357 0.154
NP_440084.1_8 Forward -276 -262 11.0887 0.252
NP_440101.1_1 Forward -253 -234 15.8307 0.23
NP_442192.1_4 Reverse -269 -288 13.47 0.233
NP_442183.1_1 Reverse -251 -265 10.816 0.0784
NP_442397.1_9 Reverse -296 -315 6.4893 0.246
NP_441549.1_9 Reverse -247 -265 -5.88071 0.198
NP_442347.1_2 Forward -317 -308 12.5861 0.056
NP_442347.1_2 Forward -259 -250 12.4878 0.056
NP_442347.1_2 Forward -205 -196 8.35786 0.0927
NP_442347.1_2 Forward -35 -26 5.70292 0.226
NP_442347.1_2 Reverse -252 -261 3.34298 0.284
NP_440547.1_5 Forward -317 -298 18.289 0.147
NP_441037.1_4 Forward -262 -252 18.9151 0.00351
NP_441633.1_3 Reverse -249 -262 22.6354 0.00371
NP_441633.1_3 Forward -211 -198 -2.04567 0.171
NP_440136.1_2 Forward -259 -252 15.9687 0.0123
NP_440136.1_2 Reverse -252 -259 15.9687 0.0123
NP_442590.1_10 Forward -318 -299 10.5209 0.181
NP_442998.1_5 Forward -87 -77 12.9597 0.158
NP_442998.1_10 Forward -258 -251 15.5754 0.0102
NP_442998.1_10 Reverse -253 -260 15.5754 0.0102
NP_442998.1_10 Forward -316 -309 5.93897 0.206
NP_440899.1_8 Reverse -270 -289 -10.227 0.277
NP_440299.1_1 Forward -264 -251 18.9965 0.00298
NP_440299.1_1 Reverse -247 -260 10.5401 0.0569
NP_441799.1_1 Reverse -247 -261 8.84875 0.105
NP_441799.1_1 Forward -264 -250 4.71887 0.238
NP_441799.1_1 Reverse -88 -102 4.71887 0.238
NP_441799.1_9 Forward -261 -242 -1.37718 0.213
NP_440640.1_6 Reverse -201 -220 -0.197208 0.28
NP_441007.1_10 Reverse -246 -259 8.86907 0.108
NP_441007.1_10 Forward -265 -252 1.88757 0.203
NP_442201.1_10 Reverse -240 -259 -14.3569 0.281
NP_441743.1_8 Reverse -322 -341 13.7658 0.185
NP_440256.1_1 Reverse -306 -325 -0.787193 0.0961
NP_440256.1_1 Reverse -248 -267 -5.50708 0.184
NP_441559.1_8 Reverse -55 -69 0.982901 0.159
NP_441559.1_8 Reverse -235 -249 -4.13031 0.217
NP_441559.1_8 Forward -265 -251 -5.9986 0.271
NP_441559.1_8 Reverse -246 -260 -6.58858 0.279
NP_441270.1_5 Reverse -143 -162 11.14 0.294
NP_442860.1_7 Forward -120 -102 17.1138 0.179
NP_440915.1_6 Forward -264 -250 14.9459 0.0183
NP_440915.1_6 Reverse -247 -261 8.75105 0.0507
NP_440915.1_6 Reverse -305 -319 2.35953 0.119
NP_440915.1_6 Reverse -46 -60 -2.75368 0.28
NP_440717.1_3 Forward -33 -19 7.3738 0.28
NP_441866.1_6 Forward -38 -19 7.07848 0.285
NP_440748.1_5 Reverse -203 -222 4.916 0.195
NP_440748.1_5 Forward -309 -290 -1.27885 0.267
NP_440748.1_5 Reverse -305 -324 -3.24547 0.293
NP_441464.1_1 Reverse -118 -137 9.73422 0.24
NP_441464.1_8 Reverse -251 -265 8.94771 0.192
NP_440695.1_5 Forward -260 -241 -1.96717 0.293
NP_441939.1_3 Forward -259 -240 15.9291 0.0459
NP_442993.1_1 Forward -215 -199 -12.4295 0.271
NP_442386.1_9 Reverse -250 -259 13.8639 0.0289
NP_442386.1_9 Forward -261 -252 6.39082 0.219
NP_442386.1_9 Forward -312 -303 6.09583 0.23
NP_440570.1_5 Forward -225 -206 -2.85214 0.282
NP_441340.1_5 Forward -259 -252 15.6737 0.0124
NP_441340.1_5 Reverse -252 -259 15.6737 0.0124
NP_442484.1_2 Reverse -240 -259 9.3409 0.131
NP_440168.1_9 Reverse -211 -230 -5.31042 0.296
NP_440327.1_6 Forward -305 -286 7.27595 0.228
NP_442240.1_1 Reverse -243 -262 14.2566 0.167
NP_440586.1_8 Forward -259 -252 13.2151 0.026
NP_440586.1_8 Reverse -252 -259 13.2151 0.026
NP_442251.1_6 Forward -259 -252 15.2804 0.0124
NP_442251.1_6 Reverse -252 -259 15.2804 0.0124
NP_440192.1_4 Reverse -188 -207 9.20356 0.279
NP_441262.1_3 Reverse -251 -258 14.7888 0.0223
NP_441262.1_3 Forward -260 -253 14.7888 0.0223
NP_440027.1_3 Forward -101 -83 6.60656 0.225
NP_440027.1_3 Forward -69 -51 1.5917 0.3
NP_440027.1_8 Forward -39 -20 8.06178 0.249
NP_440027.1_8 Forward -129 -110 3.9319 0.294
NP_443051.1_1 Forward -261 -252 18.0926 0.00402
NP_443051.1_1 Reverse -250 -259 10.4228 0.00754
NP_439937.1_9 Reverse -250 -267 -6.84499 0.157
NP_439937.1_9 Forward -211 -194 -10.1882 0.224
NP_441595.1_5 Forward -267 -249 4.14905 0.292
NP_440408.1_7 Forward -260 -241 16.5191 0.13
NP_440408.1_7 Forward -222 -203 9.0459 0.265
NP_440626.1_8 Forward -232 -213 8.94757 0.264
NP_440439.1_1 Forward -62 -49 11.3273 0.0339
NP_440439.1_1 Reverse -248 -261 11.1307 0.0339
NP_440372.1_2 Forward -259 -252 16.3621 0.0124
NP_440372.1_2 Reverse -252 -259 16.3621 0.0124
NP_440372.1_2 Reverse -310 -317 4.07068 0.262
NP_441803.1_2 Reverse -246 -265 7.07928 0.145
NP_441803.1_2 Reverse -84 -103 -1.27885 0.297
NP_439977.1_5 Reverse -245 -264 13.4708 0.0531
NP_440210.1_8 Forward -36 -20 10.3833 0.22
NP_441572.1_7 Forward -366 -347 -2.65548 0.197
NP_441155.1_2 Forward -221 -202 15.6341 0.225
NP_442384.1_10 Forward -260 -247 18.9972 0.00338
NP_442384.1_10 Reverse -251 -264 12.2123 0.0296
NP_442114.1_8 Forward -286 -272 8.45543 0.234
NP_441877.1_5 Reverse -74 -93 2.65439 0.249
NP_442262.1_10 Forward -259 -252 14.1988 0.0123
NP_442262.1_10 Reverse -252 -259 14.1988 0.0123
NP_441689.1_5 Reverse -249 -259 5.78111 0.197
NP_440163.1_10 Reverse -24 -34 9.81313 0.222
NP_440344.1_10 Forward -267 -250 -0.0594896 0.0381
NP_440282.1_10 Reverse -241 -260 -0.688862 0.21
NP_440282.1_10 Forward -136 -117 -10.1286 0.294
NP_440531.1_6 Reverse -84 -103 14.3558 0.0397
NP_440531.1_6 Reverse -243 -262 -2.55715 0.253
NP_441060.1_6 Forward -124 -108 12.0549 0.254
NP_441965.1_10 Forward -263 -247 22.0847 0.0148
NP_441965.1_10 Reverse -47 -63 4.68009 0.234
NP_441640.1_8 Forward -29 -10 -1.57384 0.218
NP_440297.1_9 Reverse -252 -262 9.51814 0.0917
NP_440297.1_9 Reverse -207 -217 3.91327 0.253
NP_440297.1_9 Forward -259 -249 -0.118297 0.282
NP_442187.1_3 Reverse -308 -318 13.0581 0.275
NP_442280.1_10 Reverse -51 -69 5.45442 0.284
NP_441896.1_3 Forward -269 -250 6.19431 0.106
NP_441103.1_9 Reverse -52 -62 12.6848 0.29
NP_441679.1_3 Reverse -298 -317 4.52268 0.21
NP_440999.1_9 Forward -264 -250 5.1128 0.113
NP_440999.1_9 Reverse -247 -261 4.81781 0.115
NP_440999.1_9 Forward -210 -196 1.08123 0.171
NP_440888.1_2 Forward -260 -246 14.1586 0.02
NP_440888.1_2 Reverse -251 -265 11.7987 0.0588
NP_440888.1_2 Forward -36 -22 7.07881 0.208
NP_440888.1_2 Forward -318 -304 6.68548 0.223
NP_440491.1_1 Forward -263 -244 10.4255 0.188
NP_439969.1_3 Forward -265 -246 9.43923 0.116
NP_442948.1_6 Reverse -64 -83 15.7324 0.268
NP_442033.1_10 Reverse -249 -268 -6.09707 0.183
NP_442033.1_10 Reverse -48 -67 -11.3086 0.251
NP_441543.1_2 Forward -259 -250 16.9127 0.00359
NP_441543.1_2 Reverse -252 -261 9.34117 0.0818
NP_442845.1_2 Reverse -21 -35 6.78443 0.202
NP_442845.1_2 Reverse -303 -317 5.21113 0.24
NP_440739.1_8 Forward -308 -289 4.81767 0.296
NP_441918.1_7 Reverse -250 -269 -1.7705 0.297
NP_441469.1_8 Forward -261 -252 13.3727 0.073
NP_441469.1_8 Reverse -250 -259 6.48957 0.227
NP_443064.1_6 Reverse -251 -261 13.8273 0.0796
NP_443064.1_6 Forward -260 -250 12.5669 0.0796
NP_442578.1_7 Forward -259 -252 14.5921 0.026
NP_442578.1_7 Reverse -252 -259 14.5921 0.026
NP_440071.1_6 Forward -293 -279 13.1262 0.299
NP_441462.1_2 Reverse -251 -261 20.1379 0.000967
NP_441462.1_2 Forward -260 -250 11.5831 0.00406
NP_441462.1_2 Reverse -309 -319 6.46988 0.0664
NP_441621.1_7 Forward -262 -248 5.01447 0.0934
NP_443062.1_1 Forward -260 -242 12.9338 0.0708
NP_443062.1_1 Forward -36 -18 9.13097 0.14
NP_443062.1_1 Forward -318 -300 8.54592 0.152
NP_443062.1_1 Reverse -297 -315 7.27833 0.18
NP_443062.1_1 Forward -372 -354 5.6207 0.224
NP_443062.1_6 Reverse -243 -262 9.24257 0.13
NP_442204.1_1 Forward -63 -52 10.2851 0.0736
NP_442204.1_1 Reverse -247 -258 1.7303 0.266
NP_442204.1_2 Reverse -17 -36 12.4875 0.223
NP_442204.1_2 Reverse -241 -260 10.4225 0.223
NP_442204.1_6 Reverse -83 -102 4.03102 0.297
NP_440516.1_2 Reverse -216 -234 -1.35749 0.285
NP_440516.1_6 Forward -372 -358 8.3571 0.247
NP_440516.1_8 Forward -260 -251 16.9127 0.00442
NP_440516.1_8 Reverse -251 -260 16.9127 0.00442
NP_440516.1_8 Reverse -309 -318 9.24284 0.0264
NP_442428.1_4 Reverse -116 -135 2.0644 0.271
NP_442428.1_5 Forward -259 -252 15.8704 0.0124
NP_442428.1_5 Reverse -252 -259 15.8704 0.0124
NP_440783.1_5 Forward -137 -118 4.52268 0.15
NP_442120.1_10 Forward -221 -202 -6.39206 0.21
NP_440673.1_2 Forward -86 -67 11.7553 0.165
NP_440673.1_3 Forward -258 -251 12.4288 0.0426
NP_440673.1_3 Reverse -253 -260 12.4288 0.0426
NP_440673.1_3 Forward -316 -309 10.1672 0.149
NP_440718.1_2 Reverse -312 -331 10.5209 0.282
NP_441052.1_2 Forward -260 -250 19.9412 0.00106
NP_441052.1_2 Reverse -251 -261 10.4031 0.0285
NP_441052.1_2 Forward -318 -308 8.4365 0.0449
NP_441052.1_2 Forward -36 -26 5.78156 0.103
NP_441052.1_2 Reverse -117 -127 5.38824 0.12
NP_442219.1_9 Forward -259 -250 17.7976 0.00718
NP_442219.1_9 Reverse -252 -261 8.25953 0.0681
NP_442219.1_9 Forward -317 -308 4.71961 0.198
NP_440436.1_4 Forward -259 -250 17.2072 0.00233
NP_440436.1_4 Reverse -252 -261 15.9289 0.00508
NP_441884.1_9 Forward -263 -244 -5.80207 0.0594
NP_441884.1_9 Forward -104 -85 -23.7966 0.284
NP_441321.1_5 Forward -86 -67 3.93269 0.265
NP_440314.1_9 Reverse -252 -271 -9.73531 0.276
NP_440648.1_1 Reverse -251 -270 5.40766 0.219
NP_441719.1_4 Forward -259 -252 16.3621 0.0124
NP_441719.1_4 Reverse -252 -259 16.3621 0.0124
NP_441733.1_10 Forward -263 -250 7.29578 0.156
NP_441733.1_10 Reverse -248 -261 5.62415 0.21
NP_441004.1_1 Reverse -21 -40 -15.1435 0.273
NP_441004.1_1 Forward -366 -347 -15.6352 0.276
NP_441004.1_1 Forward -266 -247 -17.6018 0.292
NP_441004.1_1 Reverse -117 -136 -17.8968 0.295
NP_442366.1_5 Reverse -306 -316 13.9425 0.0549
NP_440296.1_10 Forward -263 -244 -12.3902 0.269
NP_441115.1_4 Reverse -350 -368 7.49153 0.286
NP_442694.1_4 Forward -185 -176 12.2911 0.253
NP_442206.1_10 Forward -260 -245 6.46974 0.178
NP_440328.1_4 Reverse -245 -264 2.45773 0.201
NP_443054.1_2 Reverse -249 -263 8.06273 0.13
NP_441851.1_10 Forward -261 -251 17.4829 0.0027
NP_441851.1_10 Reverse -250 -260 15.8113 0.00552
NP_441851.1_10 Forward -249 -239 4.3066 0.277
NP_442026.1_3 Forward -392 -373 4.81767 0.192
NP_442622.1_1 Reverse -50 -69 -7.37537 0.257
NP_442856.1_7 Forward -161 -142 -6.58872 0.299
NP_441668.1_4 Reverse -241 -260 0.884433 0.229
NP_442515.1_1 Reverse -250 -264 16.5192 0.0227
NP_442515.1_1 Forward -261 -247 11.0127 0.0431
NP_442515.1_1 Forward -210 -196 1.17956 0.168
NP_440593.1_3 Forward -214 -195 -3.63879 0.238
NP_440593.1_9 Reverse -248 -262 8.35772 0.261
NP_442709.1_3 Forward -267 -248 3.6377 0.281
NP_441046.1_2 Forward -365 -346 0.294447 0.271
NP_442689.1_8 Reverse -382 -399 -4.58271 0.267
NP_440940.1_7 Forward -270 -252 5.22993 0.23
NP_441349.1_10 Reverse -241 -260 3.73603 0.064
NP_441349.1_10 Reverse -107 -126 -5.21209 0.194
NP_441409.1_6 Forward -266 -247 -7.96535 0.161
NP_440432.1_9 Reverse -252 -267 6.46974 0.0475
NP_442843.1_1 Forward -91 -72 -10.817 0.281
NP_439960.1_10 Reverse -244 -262 -4.30741 0.293
NP_440431.1_3 Forward -121 -102 -1.27885 0.155
NP_440431.1_3 Reverse -250 -269 -12.0953 0.296
NP_442450.1_5 Forward -262 -252 10.1081 0.115
NP_440588.1_2 Reverse -242 -261 6.09597 0.06
NP_440040.1_8 Forward -115 -96 6.92274 0.209
NP_440954.1_1 Reverse -129 -148 -4.22878 0.289
NP_442006.1_2 Reverse -20 -37 -16.8741 0.265
NP_443047.1_4 Reverse -18 -28 17.3846 0.28
NP_442243.1_1 Reverse -245 -263 -3.22649 0.299
NP_441570.1_1 Forward -260 -242 -8.83064 0.122
NP_441570.1_1 Reverse -117 -135 -10.0106 0.156
NP_441078.1_4 Forward -260 -251 19.6659 0.0007
NP_441078.1_4 Reverse -251 -260 19.6659 0.0007
NP_441078.1_4 Reverse -117 -126 6.09625 0.0863
NP_442729.1_8 Forward -264 -251 18.5055 0.0312
NP_441663.1_8 Reverse -245 -264 -0.197208 0.227
NP_442348.1_2 Forward -216 -207 9.14451 0.28
NP_442348.1_2 Forward -186 -177 7.17789 0.285
NP_442443.1_1 Forward -368 -349 9.43923 0.108
NP_442443.1_1 Reverse -183 -202 6.09597 0.155
NP_440526.1_3 Reverse -252 -263 11.4645 0.0646
NP_440526.1_3 Forward -259 -248 8.02298 0.126
NP_440526.1_3 Forward -35 -24 0.156538 0.297
NP_441432.1_8 Reverse -250 -259 16.8143 0.00595
NP_441432.1_8 Reverse -308 -317 11.0128 0.0629
NP_441432.1_8 Forward -210 -201 9.24284 0.0755
NP_441432.1_8 Forward -261 -252 8.35786 0.0755
NP_441432.1_8 Forward -216 -207 3.7363 0.243
NP_441333.1_1 Reverse -265 -275 13.5918 0.217
NP_442320.1_8 Forward -266 -252 -1.5737 0.0821
NP_441732.1_2 Forward -264 -248 -15.1828 0.145
NP_441732.1_2 Reverse -247 -263 -16.1661 0.165
NP_440714.1_2 Forward -97 -79 14.2771 0.297
NP_440760.1_1 Reverse -251 -270 -2.95047 0.0334
NP_440760.1_1 Forward -260 -241 -21.4367 0.237
NP_442797.1_7 Forward -133 -115 18.702 0.0629
NP_442797.1_7 Reverse -244 -262 0.609134 0.272
NP_442274.1_8 Forward -37 -19 13.3789 0.286
NP_441328.2_8 Forward -103 -84 14.8466 0.268
NP_442353.1_4 Forward -266 -247 4.03023 0.206
NP_440281.1_7 Forward -34 -17 22.4583 0.0926
NP_441072.1_2 Reverse -298 -317 5.50599 0.296
NP_440713.1_4 Forward -258 -239 1.76941 0.279
NP_442489.1_7 Forward -260 -251 20.1576 0.000695
NP_442489.1_7 Reverse -251 -260 20.1576 0.000695
NP_442079.1_6 Forward -103 -84 12.7825 0.283
NP_442079.1_7 Forward -259 -240 2.3594 0.229
NP_440559.1_1 Forward -259 -250 17.4043 0.00658
NP_440559.1_1 Reverse -252 -261 17.306 0.00658
NP_441659.2_8 Reverse -251 -261 19.3512 0.000966
NP_441659.2_8 Forward -260 -250 18.1713 0.00133
NP_442913.1_10 Reverse -242 -261 -2.36049 0.184
NP_439956.1_7 Forward -266 -247 1.96607 0.276
NP_442008.1_2 Forward -263 -244 8.35759 0.2
NP_440708.1_6 Reverse -52 -71 -5.21209 0.232
NP_442776.1_1 Reverse -201 -220 4.03102 0.278
NP_442346.1_5 Forward -261 -251 17.9746 0.00128
NP_442346.1_5 Reverse -250 -260 16.6963 0.00248
NP_440352.1_5 Forward -96 -77 13.7264 0.18
NP_440545.1_3 Forward -264 -247 7.41366 0.0499
NP_440545.1_3 Reverse -247 -264 0.0388413 0.146
NP_440545.1_3 Forward -292 -275 -7.04099 0.295
NP_441856.1_3 Forward -263 -244 -2.0655 0.253
NP_441856.1_5 Forward -212 -193 17.5015 0.214
NP_441856.1_6 Reverse -350 -364 15.5359 0.265
NP_440831.1_3 Reverse -242 -261 12.2118 0.146
NP_440486.1_6 Forward -99 -80 5.99764 0.284
NP_440459.1_2 Forward -320 -303 13.3135 0.131
NP_440459.1_2 Forward -224 -207 8.39697 0.264
NP_441653.1_2 Reverse -240 -259 5.65556 0.243
NP_441653.1_2 Forward -259 -240 5.26902 0.248
NP_441653.1_2 Forward -371 -352 4.59259 0.255
NP_440010.1_10 Reverse -80 -99 1.57275 0.297
NP_440847.1_8 Reverse -77 -96 11.8975 0.277
NP_442603.1_7 Reverse -251 -265 18.5835 0.0131
NP_442603.1_7 Forward -260 -246 16.9119 0.0273
NP_441585.1_5 Forward -92 -73 -0.689632 0.296
NP_441948.1_4 Reverse -150 -168 -3.71743 0.203
NP_441948.1_4 Reverse -244 -262 -4.20908 0.22
NP_441833.1_4 Forward -259 -252 15.9687 0.0124
NP_441833.1_4 Reverse -252 -259 15.9687 0.0124
NP_442162.1_9 Forward -259 -252 16.2637 0.0124
NP_442162.1_9 Reverse -252 -259 16.2637 0.0124
NP_440671.1_2 Forward -315 -301 14.9459 0.223
NP_441973.1_1 Reverse -80 -95 10.0097 0.235
NP_442199.1_5 Reverse -243 -262 -7.57203 0.299
NP_442140.1_1 Forward -45 -26 16.8403 0.201
NP_442140.1_3 Reverse -252 -262 14.828 0.0433
NP_442140.1_3 Forward -259 -249 10.3048 0.0902
NP_442723.1_1 Forward -46 -27 3.63691 0.278
NP_441671.1_10 Reverse -150 -169 4.42435 0.219
NP_440875.1_9 Forward -258 -248 8.37203 0.233
NP_441813.1_5 Reverse -249 -259 18.1713 0.00743
NP_441813.1_5 Forward -262 -252 8.92815 0.0347
NP_441813.1_5 Forward -320 -310 2.92996 0.181
NP_440594.1_5 Reverse -178 -197 7.27514 0.293
NP_440594.1_8 Reverse -252 -265 11.6217 0.152
NP_440590.1_4 Reverse -252 -265 13.0973 0.013
NP_440590.1_4 Forward -259 -246 3.06754 0.0772
NP_440590.1_4 Forward -317 -304 0.215946 0.165
NP_440567.1_1 Forward -259 -245 6.58777 0.0816
NP_440567.1_1 Reverse -252 -266 -0.197071 0.27
NP_442497.1_10 Reverse -252 -261 19.8626 0.00532
NP_442497.1_10 Forward -259 -250 10.4228 0.0087
NP_440821.1_4 Forward -262 -252 19.5479 0.00399
NP_440821.1_4 Reverse -249 -259 9.41981 0.0286
NP_441239.1_9 Forward -262 -250 14.4936 0.0272
NP_441239.1_9 Reverse -249 -261 8.79043 0.122
NP_441239.1_9 Forward -313 -301 4.5622 0.251
NP_441951.1_9 Reverse -286 -305 1.96607 0.254
NP_441892.1_1 Forward -269 -252 -3.00942 0.231
NP_440665.1_1 Reverse -117 -136 -13.4719 0.257
NP_440604.1_6 Forward -260 -241 0.392778 0.166
NP_442044.1_9 Reverse -251 -270 8.16093 0.178
NP_442193.1_8 Forward -321 -302 15.2399 0.211
NP_442270.1_9 Forward -220 -201 -3.83545 0.19
NP_442629.1_3 Reverse -16 -35 1.47442 0.284
NP_440833.1_6 Reverse -74 -88 9.93039 0.257
NP_440354.1_7 Reverse -296 -314 14.2771 0.167
NP_440546.1_4 Reverse -251 -261 12.8578 0.0572
NP_440546.1_4 Forward -260 -250 10.046 0.109
NP_440546.1_4 Forward -132 -122 6.74945 0.282
NP_440462.1_4 Forward -133 -119 11.2093 0.21
NP_440462.1_6 Forward -262 -252 10.4031 0.0396
NP_440462.1_6 Reverse -249 -259 9.61647 0.0429
NP_440462.1_6 Forward -320 -310 3.51995 0.242
NP_440868.1_4 Reverse -247 -259 17.0502 0.0124
NP_440868.1_8 Forward -264 -245 -1.86883 0.263
NP_442499.1_3 Forward -216 -198 6.90232 0.282
NP_442479.1_9 Forward -84 -65 -10.4236 0.268
NP_440402.1_3 Forward -269 -250 3.14605 0.297
NP_442402.1_4 Forward -338 -319 -5.31116 0.24
NP_442258.1_4 Reverse -291 -310 17.2065 0.196
NP_441084.1_6 Reverse -300 -314 9.24716 0.29
NP_440653.1_10 Forward -317 -298 11.1109 0.142
NP_440653.1_10 Forward -227 -208 2.85105 0.288
NP_442882.1_7 Reverse -244 -258 11.7987 0.261
NP_442039.1_4 Forward -259 -252 15.1821 0.0124
NP_442039.1_4 Reverse -252 -259 15.1821 0.0124
NP_442039.1_7 Forward -27 -17 7.15819 0.279
NP_441811.1_8 Forward -266 -252 15.1426 0.162
NP_440008.1_9 Reverse -245 -264 7.27595 0.283
NP_440825.1_7 Forward -317 -307 10.8602 0.286
NP_442696.1_6 Forward -105 -86 -12.6852 0.253
NP_442786.1_5 Forward -75 -56 6.09597 0.294
NP_442837.1_3 Forward -259 -252 15.7721 0.0124
NP_442837.1_3 Reverse -252 -259 15.7721 0.0124
NP_442053.1_1 Forward -260 -251 18.3876 0.0007
NP_442053.1_1 Reverse -251 -260 18.3876 0.0007
NP_442053.1_1 Forward -318 -309 4.71961 0.228
NP_440505.1_3 Reverse -249 -259 18.3679 0.00213
NP_440505.1_3 Forward -262 -252 7.84651 0.147
NP_440505.1_3 Forward -128 -118 4.60159 0.277
NP_440505.1_7 Reverse -56 -75 7.66927 0.162
NP_440505.1_7 Reverse -215 -234 -1.27885 0.272
NP_441203.1_1 Forward -259 -240 -19.4701 0.297
NP_442255.1_5 Forward -232 -213 8.94757 0.265
NP_441408.2_7 Reverse -198 -217 -1.47551 0.251
NP_440914.1_1 Forward -260 -250 17.5935 0.000537
NP_440914.1_1 Reverse -207 -217 9.39583 0.186
NP_440914.1_1 Forward -311 -301 9.00547 0.186
NP_440914.1_1 Reverse -309 -319 9.00547 0.186
NP_440914.1_1 Reverse -251 -261 8.51751 0.186
NP_440914.1_1 Reverse -21 -31 7.05364 0.254
NP_441011.1_8 Reverse -252 -261 14.356 0.0249
NP_441011.1_8 Forward -259 -250 8.25953 0.144
NP_442533.1_6 Forward -260 -251 17.2076 0.00137
NP_442533.1_6 Reverse -251 -260 17.2076 0.00137
NP_442533.1_6 Reverse -129 -138 7.86621 0.0862
NP_442533.1_6 Reverse -117 -126 5.21127 0.15
NP_442533.1_6 Forward -59 -50 1.76968 0.289
NP_441482.1_7 Forward -266 -252 8.65272 0.0162
NP_441482.1_7 Forward -65 -51 -4.91696 0.162
NP_441482.1_7 Reverse -245 -259 -10.5218 0.209
NP_439944.1_9 Reverse -252 -262 17.4829 0.00423
NP_439944.1_9 Forward -259 -249 10.5014 0.0887
NP_442269.1_10 Forward -131 -112 1.76941 0.282
NP_441028.1_6 Forward -205 -195 6.0761 0.232
NP_442664.1_8 Forward -174 -155 14.2566 0.233
NP_440116.1_5 Reverse -248 -265 4.95539 0.176
NP_440116.1_8 Forward -259 -240 4.12936 0.0747
NP_441527.1_4 Forward -400 -381 -9.40638 0.258
NP_441527.1_4 Forward -397 -378 -12.6531 0.292
NP_440115.1_6 Reverse -248 -258 16.008 0.0325
NP_440115.1_6 Forward -263 -253 10.0098 0.115
NP_440007.1_9 Reverse -203 -217 9.2427 0.171
NP_440007.1_9 Reverse -293 -307 3.24451 0.272
NP_440007.1_9 Forward -219 -205 2.2612 0.281
NP_440007.1_9 Reverse -125 -139 1.86788 0.282
NP_440007.1_9 Reverse -23 -37 0.392915 0.298
NP_439965.1_1 Reverse -219 -238 -8.85033 0.278
NP_441059.1_10 Reverse -25 -38 12.3107 0.226
NP_441602.1_3 Forward -377 -358 1.96607 0.206
NP_441602.1_3 Reverse -246 -265 -2.45882 0.233
NP_442673.1_5 Reverse -296 -314 11.2289 0.277
NP_441170.1_2 Reverse -53 -72 0.982764 0.275
NP_441972.1_5 Forward -259 -240 4.916 0.0969
NP_441972.1_5 Reverse -229 -248 -5.99873 0.227
NP_441106.1_1 Forward -261 -252 9.73449 0.0311
NP_441106.1_1 Reverse -250 -259 9.63616 0.0311
NP_441106.1_1 Forward -60 -51 2.85133 0.255
NP_441420.1_1 Reverse -250 -269 -5.31042 0.292
NP_442306.1_10 Reverse -246 -265 -11.2103 0.121
NP_441286.1_1 Reverse -250 -262 24.2284 0.000758
NP_441286.1_1 Forward -261 -249 3.48056 0.0467
NP_441286.1_1 Reverse -308 -320 -5.76255 0.223
NP_440670.1_8 Forward -260 -251 18.3876 0.000699
NP_440670.1_8 Reverse -251 -260 18.3876 0.000699
NP_442881.1_3 Forward -208 -189 19.5664 0.11
NP_440886.1_7 Forward -261 -251 8.04271 0.0805
NP_440886.1_7 Reverse -250 -260 7.94438 0.0805
NP_440886.1_7 Reverse -227 -237 5.68278 0.168
NP_442614.1_2 Forward -260 -246 18.1908 0.0491
NP_442072.1_9 Reverse -250 -268 -4.20908 0.0413
NP_442072.1_9 Forward -261 -243 -19.7454 0.204
NP_442213.1_6 Reverse -243 -262 3.53937 0.29
NP_441427.1_6 Reverse -79 -97 7.59063 0.297
NP_440907.2_8 Reverse -252 -262 19.449 0.00351
NP_441021.1_1 Reverse -252 -271 -7.4737 0.184
NP_441021.1_1 Reverse -207 -226 -9.53865 0.217
NP_441463.1_3 Reverse -241 -260 -8.26035 0.267
NP_441463.1_3 Forward -328 -309 -9.34199 0.278
NP_441463.1_6 Reverse -249 -263 6.70583 0.267
NP_441626.1_2 Forward -259 -252 15.7721 0.0124
NP_441626.1_2 Reverse -252 -259 15.7721 0.0124
NP_441626.1_6 Forward -264 -246 6.50823 0.267
NP_442365.1_7 Reverse -247 -266 -2.75381 0.204
NP_442238.1_1 Forward -221 -202 31.8587 0.000104
NP_442238.1_1 Forward -137 -118 5.80098 0.175
NP_442238.1_2 Forward -170 -151 29.4004 0.000869
NP_442238.1_3 Forward -137 -118 32.0554 0.0000087
NP_442238.1_4 Forward -53 -34 20.649 0.117
NP_442238.1_5 Forward -107 -88 23.2047 0.0249
NP_442238.1_6 Forward -311 -292 19.4774 0.0546
NP_442238.1_7 Forward -332 -313 29.1045 0.000528
NP_442238.1_8 Forward -80 -61 19.2723 0.112
NP_442238.1_9 Forward -195 -176 24.4839 0.021
NP_442238.1_10 Forward -353 -334 19.0748 0.167
NP_442794.1_1 Reverse -247 -259 10.1671 0.0721
NP_442615.1_1 Reverse -242 -260 7.19731 0.0324
NP_442615.1_1 Forward -269 -251 -4.30741 0.183
NP_442615.1_1 Reverse -300 -318 -5.88071 0.227
NP_441962.1_4 Forward -265 -246 -4.81876 0.161
NP_441962.1_4 Forward -377 -358 -11.1119 0.238
NP_440387.1_1 Reverse -251 -267 7.13836 0.0282
NP_440387.1_1 Forward -260 -244 -5.15301 0.217
NP_441431.1_2 Reverse -248 -262 7.86545 0.231
NP_441431.1_3 Reverse -21 -40 9.73422 0.236
NP_441488.1_8 Reverse -304 -318 17.9935 0.074
NP_441836.1_2 Forward -266 -247 -3.14714 0.234
NP_441836.1_2 Reverse -245 -264 -3.54046 0.239
NP_440814.1_4 Forward -269 -250 -12.3902 0.23
NP_440467.1_3 Reverse -240 -259 12.3305 0.246
NP_440114.1_10 Forward -311 -297 5.99778 0.289
NP_442698.1_10 Reverse -163 -182 5.89931 0.233
NP_442323.1_7 Reverse -246 -265 10.9134 0.147
NP_440287.1_6 Reverse -300 -319 9.53756 0.144
NP_441272.1_4 Reverse -300 -319 0.491109 0.258
NP_440293.1_3 Forward -217 -198 2.16274 0.202
NP_440766.1_5 Forward -393 -381 10.9025 0.268
NP_439988.1_3 Forward -136 -122 21.7307 0.111
NP_441237.1_9 Reverse -252 -262 17.2863 0.00348
NP_441237.1_9 Forward -209 -199 11.3864 0.184
NP_442743.1_4 Forward -259 -240 0.196116 0.174
NP_442743.1_4 Reverse -144 -163 -8.55534 0.296
NP_439910.1_2 Forward -268 -251 -13.6292 0.162
NP_439910.1_2 Forward -109 -92 -13.9242 0.171
NP_442867.1_1 Forward -101 -82 7.86593 0.053
NP_440457.1_1 Forward -264 -252 15.1819 0.0611
NP_440457.1_1 Reverse -23 -35 1.61227 0.232
NP_440457.1_1 Reverse -247 -259 0.530633 0.25
NP_442940.1_2 Forward -260 -241 1.76941 0.295
NP_440142.1_7 Reverse -229 -248 10.5209 0.203
NP_441984.1_1 Forward -266 -248 7.78729 0.271
NP_441984.1_3 Forward -226 -208 8.67227 0.22
NP_440473.1_1 Forward -67 -48 13.5712 0.188
NP_442509.1_9 Reverse -251 -261 17.3841 0.00128
NP_442509.1_9 Forward -260 -250 8.14104 0.192
NP_441489.1_3 Forward -116 -102 12.0436 0.202
NP_441253.1_8 Forward -106 -92 12.5039 0.206
NP_442514.1_5 Forward -38 -19 -8.6544 0.288
NP_440554.1_4 Forward -259 -249 8.92815 0.0646
NP_440554.1_4 Reverse -252 -262 6.27322 0.123
NP_441885.1_5 Forward -260 -250 20.9245 0.000538
NP_441885.1_5 Reverse -251 -261 11.3864 0.00668
NP_441885.1_5 Reverse -117 -127 7.94484 0.0385
NP_440478.1_4 Forward -264 -245 18.584 0.0571
NP_440478.1_10 Forward -262 -248 7.57108 0.261
NP_442341.1_3 Reverse -229 -248 2.65439 0.236
NP_442341.1_5 Forward -99 -80 19.6656 0.142
NP_442341.1_7 Reverse -250 -264 18.3875 0.0111
NP_442341.1_7 Forward -261 -247 3.24451 0.23
NP_441756.1_5 Forward -264 -245 11.1109 0.116
NP_441173.1_9 Reverse -107 -115 11.0321 0.228
NP_443000.1_7 Reverse -249 -259 19.9412 0.00223
NP_443000.1_7 Forward -262 -252 2.14332 0.226
NP_440275.1_3 Forward -262 -252 19.5479 0.00756
NP_440275.1_3 Reverse -249 -259 15.123 0.0182
NP_442275.1_1 Forward -85 -66 7.66927 0.253
NP_441397.1_8 Forward -393 -380 11.6163 0.297
NP_441902.1_3 Forward -393 -383 13.4676 0.23
NP_442451.1_2 Reverse -243 -262 -6.68705 0.232
NP_441122.1_1 Forward -124 -109 2.73316 0.298
NP_439962.1_4 Reverse -182 -201 -4.72043 0.272
NP_440175.1_4 Reverse -198 -217 -2.16383 0.122
NP_440149.1_8 Forward -260 -241 2.85105 0.104
NP_440149.1_10 Forward -137 -118 -3.14714 0.214
NP_440149.1_10 Forward -311 -292 -11.9969 0.285
NP_442214.1_1 Reverse -329 -348 7.86593 0.298
NP_441105.1_3 Reverse -112 -131 -5.99873 0.227
NP_441105.1_3 Reverse -240 -259 -8.35868 0.272
NP_440216.1_1 Forward -260 -246 9.2427 0.00589
NP_440216.1_1 Reverse -251 -265 -2.45868 0.0513
NP_440216.1_1 Reverse -240 -254 -12.3901 0.264
NP_440216.1_9 Reverse -287 -296 5.50626 0.292
NP_440172.1_1 Reverse -251 -261 16.303 0.00854
NP_440172.1_1 Forward -260 -250 15.0247 0.00945
NP_440172.1_1 Reverse -309 -319 5.97822 0.121
NP_440172.1_1 Reverse -213 -223 2.7333 0.268
NP_440172.1_1 Forward -311 -301 2.04498 0.286
NP_442371.1_1 Reverse -186 -196 13.0576 0.215
NP_442015.1_10 Reverse -247 -260 11.3273 0.0372
NP_442015.1_10 Forward -264 -251 4.44418 0.169
NP_442015.1_10 Reverse -56 -69 -0.177378 0.255
NP_441226.1_4 Reverse -85 -104 8.75091 0.278
NP_441226.1_7 Forward -259 -252 14.4934 0.0123
NP_441226.1_7 Reverse -252 -259 14.4934 0.0123
NP_441111.1_7 Forward -259 -251 18.7023 0.00294
NP_441111.1_7 Reverse -252 -260 18.7023 0.00294
NP_442379.1_10 Reverse -244 -261 0.333834 0.223
NP_441766.1_2 Forward -260 -251 17.5026 0.00297
NP_441766.1_2 Reverse -251 -260 17.5026 0.00297
NP_441766.1_2 Forward -318 -309 4.91628 0.154
NP_440416.1_9 Reverse -244 -263 2.45773 0.0409
NP_440416.1_9 Forward -255 -236 -9.93197 0.135
NP_440416.1_9 Forward -217 -198 -16.7168 0.22
NP_443052.1_9 Forward -201 -182 5.99764 0.138
NP_443052.1_9 Forward -40 -21 -4.81876 0.261
NP_442116.1_6 Reverse -103 -120 11.8931 0.189
NP_442154.1_1 Forward -239 -221 -18.1721 0.278
NP_440261.1_5 Forward -259 -246 16.2439 0.0122
NP_440261.1_5 Reverse -252 -265 6.90245 0.0316
NP_440261.1_5 Forward -208 -195 -6.47056 0.201
NP_440261.1_5 Forward -100 -87 -6.47056 0.201
NP_440988.1_10 Forward -32 -18 14.3865 0.134
NP_440988.1_10 Forward -262 -248 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGAAAGTGGAGCAGAAATTGAAGTGGGTTCCATGCCCGCAGTAATGGCGGATCAAATTCAGCTCATGCAGGTATTCCAGAACCTGATCGCCAATGGCATCAAGTTTGCCGGGGACAAGTCACCCAAAATTAAAATCTGGGGCGATCGCCAGGAGGATGCCTGGGTGTTTGCGGTCCAAGACAACGGCATTGGCATTGACCCCCAATTCTTCGAGCGGATTTTTGTCATTTTCCAACGACTCCACACCAGGGATGAATATAAAGGCACCGGCATGGGGCTAGCCATTTGCAAAAAAATCATCGAAGGCCACCAAGGGCAAATTTGGCTAGAGTCCAACCCAGGGGAGGGCTCCACATTCTACTTCTCCATCCCCATTGGCAACTAAAAAGGTATTGAACC

CDS

ATGTCCGACGAATCTAATCCCCCCAAGGTCATTTTGCTGGTGGAAGATAGCAAAGCCGACAGCCGCCTTGTCCAGGAGGTGTTGAAAACCAGCACCATCGACCACGAACTGATCATTCTCCGGGATGGTTTGGCGGCCATGGCCTTTTTACAGCAACAGGGAGAATACGAAAATTCCCCTCGCCCCAACCTAATTTTGCTGGATTTAAATCTTCCTAAAAAGGATGGCCGGGAAGTGTTGGCGGAAATCAAACAAAACCCGGACCTAAAAAGAATTCCCGTGGTAGTGTTAACCACTTCCCACAATGAGGATGATGTGATTGCCAGTTACGAACTCCACGTTAATTGTTATTTAACCAAATCCCGCAATTTGAAGGATTTATTCAAGATGGTGCAAGGGATTGAATCCTTTTGGCTAGAAACAGTCACTTTACCGGCAGCTTAA

Protein

MSDESNPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPAA