Your browser is old and dusty. Try Google Chrome!

Details for slr0469

ORF slr0469
Accession NP_442234.1
Symbol rps4
Category Ribosomal proteins: synthesis and modification
Definition 30S ribosomal protein S4
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_9 Reverse -164 -183 -9.83364 0.291
NP_441675.1_4 Forward -337 -318 9.24257 0.23
NP_441145.1_7 Reverse -66 -85 1.57275 0.282
NP_442972.1_2 Forward -276 -262 11.5037 0.272
NP_441083.1_5 Forward -17 -7 5.19158 0.123
NP_441083.1_5 Forward -290 -280 3.91327 0.162
NP_443017.1_1 Reverse -147 -166 14.5434 0.274
NP_441014.1_10 Reverse -280 -299 -3.44288 0.3
NP_439978.1_1 Forward -248 -232 9.30165 0.297
NP_441077.1_6 Forward -123 -107 3.2839 0.271
NP_442530.1_2 Reverse -386 -396 12.9597 0.263
NP_440642.1_10 Reverse -188 -202 6.68548 0.225
NP_442816.1_7 Reverse -268 -287 8.54611 0.238
NP_439990.1_5 Reverse -249 -262 8.86907 0.158
NP_442690.1_1 Forward -224 -205 -10.3253 0.212
NP_441712.1_1 Forward -285 -266 12.8065 0.251
NP_442554.1_8 Forward -16 -6 1.84832 0.292
NP_441298.1_3 Forward -29 -19 16.9233 0.157
NP_441015.1_8 Forward -354 -335 4.03102 0.262
NP_442719.1_2 Forward -396 -378 -11.2896 0.291
NP_441251.1_9 Reverse -241 -260 23.2519 0.0245
NP_441612.1_2 Forward -17 -7 13.4867 0.21
NP_441612.1_2 Forward -302 -292 9.90466 0.21
NP_441612.1_2 Forward -290 -280 6.51622 0.287
NP_440145.1_3 Forward -358 -339 -1.08219 0.146
NP_441114.1_3 Reverse -50 -59 14.5527 0.193
NP_441878.1_6 Forward -18 -8 -7.98478 0.285
NP_440861.1_2 Forward -357 -338 15.1257 0.169
NP_442965.1_2 Forward -56 -37 -8.16202 0.277
NP_442327.1_3 Forward -126 -107 5.68135 0.276
NP_440378.1_2 Forward -188 -169 15.6341 0.103
NP_440819.1_5 Forward -343 -335 7.68924 0.266
NP_440316.1_10 Forward -58 -48 13.353 0.214
NP_440210.1_10 Reverse -329 -348 5.01354 0.296
NP_442917.1_3 Forward -201 -182 5.70265 0.22
NP_442556.1_10 Reverse -351 -370 7.68492 0.299
NP_440350.1_5 Reverse -348 -367 8.94757 0.134
NP_442280.1_10 Forward -73 -55 7.69463 0.268
NP_440575.1_1 Reverse -33 -52 -3.14789 0.294
NP_440544.1_5 Reverse -295 -302 13.8024 0.28
NP_441052.1_2 Forward -17 -7 4.3066 0.161
NP_442843.1_1 Forward -56 -37 -10.6203 0.279
NP_440396.1_10 Reverse -232 -248 11.4642 0.186
NP_440195.1_4 Forward -302 -283 5.50599 0.284
NP_440040.1_3 Reverse -56 -66 17.0896 0.25
NP_441078.1_4 Forward -17 -8 -1.86856 0.272
NP_441432.1_9 Reverse -343 -356 8.21054 0.292
NP_441333.1_1 Reverse -352 -362 13.4965 0.217
NP_441732.1_2 Forward -21 -5 -16.0677 0.164
NP_440313.1_7 Forward -217 -198 19.0757 0.235
NP_440713.1_3 Forward -353 -334 1.17943 0.28
NP_442489.1_7 Forward -17 -8 -1.57357 0.213
NP_440786.1_9 Forward -276 -257 15.6341 0.189
NP_439956.1_7 Forward -75 -56 3.04771 0.262
NP_440847.1_3 Reverse -31 -45 11.7003 0.261
NP_441329.1_6 Forward -340 -321 -0.143661 0.266
NP_441895.1_10 Forward -361 -342 -8.85033 0.278
NP_442199.1_5 Forward -25 -6 -1.37718 0.18
NP_441848.1_4 Forward -397 -381 8.3146 0.288
NP_441848.1_7 Reverse -328 -347 3.63691 0.217
NP_442039.1_7 Reverse -383 -393 7.05986 0.283
NP_442679.1_1 Forward -362 -343 -2.95047 0.245
NP_442679.1_1 Forward -270 -251 -3.44213 0.255
NP_442679.1_1 Forward -343 -324 -3.83545 0.264
NP_440160.1_1 Reverse -379 -398 8.52366 0.289
NP_440914.1_1 Forward -263 -253 7.5416 0.232
NP_440914.1_1 Forward -57 -47 6.17532 0.293
NP_442533.1_6 Forward -17 -8 3.93297 0.197
NP_441028.1_6 Reverse -295 -305 4.20782 0.278
NP_441527.1_4 Forward -353 -334 3.96249 0.111
NP_441527.1_4 Forward -354 -335 -2.62645 0.161
NP_441527.1_4 Forward -340 -321 -3.48588 0.167
NP_441527.1_4 Forward -355 -336 -5.39572 0.201
NP_441527.1_4 Forward -338 -319 -6.63711 0.222
NP_441527.1_4 Forward -370 -351 -8.35597 0.243
NP_441527.1_4 Forward -349 -330 -10.7433 0.274
NP_441527.1_4 Reverse -127 -146 -11.0297 0.278
NP_441527.1_4 Forward -269 -250 -11.5072 0.282
NP_441527.1_4 Forward -283 -264 -12.2711 0.285
NP_441527.1_4 Forward -265 -246 -13.0351 0.298
NP_441527.1_4 Forward -368 -349 -13.1306 0.298
NP_441527.1_7 Reverse -243 -262 6.98015 0.298
NP_441059.1_10 Forward -334 -321 11.819 0.254
NP_441836.1_1 Reverse -270 -289 13.5447 0.223
NP_440114.1_10 Forward -57 -43 7.66941 0.229
NP_440492.1_9 Reverse -101 -115 12.6756 0.294
NP_440766.1_5 Reverse -134 -146 8.89719 0.277
NP_442930.1_1 Reverse -22 -32 11.9759 0.242
NP_440213.1_4 Forward -394 -375 14.864 0.262
NP_441984.1_3 Reverse -79 -97 7.78729 0.239
NP_442234.1_5 Forward -49 -30 21.7306 0.0937
NP_440216.1_9 Reverse -57 -66 5.70292 0.29
NP_440244.1_1 Forward -202 -183 -2.16383 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTTAATTATTGCCAATGTTGCATATTGTGTCAAACAGAAAGTGAAAAAACAGGTGAAGGGAAAAAAAGTAGATGGAGAATACATACGTCGCAGCATAGAAGAAAACTATGCAGATAACCAAACTCAAAAAGAACGAAACAATGACAACAAAGTGATAGAGGATATTGAAAGTGGTATGAACTCTTCATTCAATTCAAAGTGGGAGAGGATAATCGACCCACTAGAACAACATTGACTATTGAGATGTGTATTGTATTTGTATGCCTTGTTTTTACAATGCAAAGTTAATGATTTAAGCTAATCCAGTGGCTACCTTATCTAATAATCTCTAGGTTTTGCTTGGACAATGGGGTATAATGGGACGTTTGGGAATTATTAATTAGGAGATGACCAACTAAG

CDS

ATGTCTCGTTATAGAGGACCTCGTCTGCGGATCGTCCGCCGCCTTGGGGAATTACCCGGTTTAAGCCGCAAATCCCCTCGCCGTGCCTACCCCCCCGGCCAACATGGCCAAGCCCGTCGCAAACGTTCTGAGTATGCCATTCGGCTAGAAGAAAAACAGAAACTACGGTTGAACTACGGCATTACGGAAAAGCAATTGGTCCGTTATGTGAAAAAAGCCCGTCGGGCTACGGGTTCCACCGGACAAGCTCTGTTAGAACTGCTGGAAATGCGCTTGGACAACACTGTGTTCCGTTTGGGCATGGCTGGCACCATTCCGGGGGCTCGGCAGTTAGTCTGCCACGGCCACATCACCGTTAATGGCCAAGTAGTAGATATTCCTAGCTACCAGTGCCGCCCCGGGGATATTGTCAGTGTCCGTGATCGGGATCGTTCCCGTAAATTGGTGGAAACCAATATGGAATTTCCGGGTTTGGCCAATGTGCCTTCCCATTTGGAGTTCGATAAAAATACGTTTACTGGCAAGGTCAACAGTGTTATTGACCGCGAGTGGGTGGCGTTGCAGATCAATGAATTGCTTGTAATTGAGTATTATTCTAGGAAAGCGTAG

Protein

MSRYRGPRLRIVRRLGELPGLSRKSPRRAYPPGQHGQARRKRSEYAIRLEEKQKLRLNYGITEKQLVRYVKKARRATGSTGQALLELLEMRLDNTVFRLGMAGTIPGARQLVCHGHITVNGQVVDIPSYQCRPGDIVSVRDRDRSRKLVETNMEFPGLANVPSHLEFDKNTFTGKVNSVIDREWVALQINELLVIEYYSRKA