Your browser is old and dusty. Try Google Chrome!

Details for slr0462

ORF slr0462
Accession NP_443008.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY352g: 3511668 - 3512290, join 3513238 - 3514051]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Forward -386 -367 9.63507 0.278
NP_441480.1_1 Forward -392 -373 -0.787193 0.287
NP_442272.1_2 Forward -217 -198 11.0289 0.232
NP_442151.1_1 Reverse -337 -356 4.42435 0.287
NP_440259.1_4 Reverse -125 -139 11.5281 0.255
NP_440259.1_4 Reverse -2 -16 9.79275 0.278
NP_441675.1_4 Forward -127 -108 5.99764 0.236
NP_441934.1_4 Forward -53 -34 10.7175 0.237
NP_441043.1_3 Forward -175 -156 15.7324 0.254
NP_441492.1_1 Reverse -332 -351 11.1109 0.148
NP_440365.1_1 Forward -207 -188 12.9387 0.256
NP_441365.1_5 Reverse -332 -351 37.5619 0.000000115
NP_442110.1_7 Forward -173 -159 4.42448 0.201
NP_440300.1_5 Forward -323 -305 12.225 0.271
NP_441149.1_9 Reverse -35 -54 1.86696 0.221
NP_441434.1_1 Reverse -120 -134 7.93745 0.26
NP_440659.1_1 Forward -141 -122 8.84924 0.152
NP_442445.1_1 Forward -166 -147 15.3391 0.159
NP_441716.1_2 Forward -300 -281 3.35565 0.229
NP_442973.1_5 Reverse -340 -359 9.93088 0.287
NP_441316.1_7 Forward -253 -238 -3.65835 0.286
NP_442730.1_8 Forward -386 -367 8.16011 0.185
NP_442687.1_7 Reverse -381 -391 4.20827 0.262
NP_440642.1_10 Reverse -37 -51 7.07881 0.223
NP_440642.1_10 Reverse -208 -222 5.60385 0.241
NP_442770.1_1 Reverse -124 -138 14.9452 0.271
NP_442658.1_1 Reverse -347 -357 6.37109 0.231
NP_440353.1_3 Reverse -202 -214 19.1152 0.123
NP_442496.1_5 Forward -167 -149 11.0322 0.217
NP_442911.1_2 Reverse -232 -251 -6.29373 0.18
NP_442064.1_1 Reverse -33 -52 -4.22878 0.182
NP_442064.1_4 Reverse -134 -153 13.9616 0.147
NP_439975.1_2 Forward -172 -154 8.08229 0.215
NP_442002.1_9 Forward -142 -135 11.4455 0.185
NP_440411.1_4 Forward -212 -193 10.0292 0.181
NP_441000.1_1 Reverse -331 -349 13.3937 0.184
NP_441369.1_1 Reverse -297 -316 38.7419 0.000000157
NP_441369.1_2 Reverse -327 -346 38.9385 0.0000000955
NP_441369.1_3 Reverse -280 -294 28.5156 0.00021
NP_442996.1_1 Forward -137 -118 5.77684 0.246
NP_440703.1_9 Forward -147 -134 5.72191 0.291
NP_441079.1_3 Reverse -351 -370 13.4708 0.166
NP_442288.1_5 Reverse -295 -309 16.7159 0.12
NP_441556.1_6 Reverse -299 -317 12.4797 0.296
NP_442247.1_5 Forward -324 -310 14.4865 0.234
NP_442247.1_8 Reverse -238 -252 8.06273 0.286
NP_442933.1_2 Forward -219 -201 5.34953 0.299
NP_442671.1_2 Reverse -305 -324 24.6829 0.000359
NP_442075.1_3 Forward -69 -50 14.0608 0.279
NP_442970.1_1 Reverse -307 -321 9.56081 0.269
NP_441762.1_7 Forward -183 -171 -6.84419 0.284
NP_442076.1_5 Reverse -301 -320 9.93088 0.186
NP_441764.1_8 Forward -130 -120 12.0764 0.284
NP_441764.1_8 Forward -215 -205 11.3107 0.284
NP_441911.1_10 Forward -219 -200 10.7764 0.226
NP_440871.1_3 Forward -301 -287 15.905 0.166
NP_440031.1_10 Forward -190 -171 3.34271 0.256
NP_441849.1_2 Reverse -196 -215 11.4109 0.161
NP_440274.1_2 Reverse -152 -166 20.6484 0.0631
NP_442721.1_6 Forward -215 -196 7.07928 0.26
NP_440101.1_3 Reverse -127 -146 1.17943 0.282
NP_441564.1_2 Forward -173 -154 -0.000545616 0.214
NP_440356.1_4 Reverse -27 -46 18.584 0.0159
NP_442508.1_9 Forward -174 -160 13.6676 0.273
NP_442998.1_5 Reverse -328 -338 8.53483 0.261
NP_440899.1_8 Forward -320 -301 -9.14533 0.258
NP_441118.1_2 Reverse -368 -387 24.4839 0.000875
NP_441362.1_2 Reverse -303 -322 5.55684 0.243
NP_440537.1_7 Reverse -281 -300 16.6629 0.0599
NP_440586.1_8 Forward -140 -133 8.98688 0.188
NP_442959.1_5 Forward -127 -108 7.07928 0.241
NP_440372.1_3 Reverse -308 -322 15.0039 0.165
NP_440819.1_5 Forward -42 -34 7.68924 0.266
NP_440075.1_2 Forward -165 -146 2.0644 0.292
NP_440350.1_5 Reverse -198 -217 -6.58872 0.296
NP_441896.1_5 Forward -167 -160 12.2322 0.273
NP_440894.1_10 Reverse -2 -21 5.89931 0.227
NP_442129.1_6 Reverse -306 -325 13.9464 0.246
NP_440999.1_9 Reverse -238 -252 -3.34366 0.291
NP_440888.1_2 Forward -384 -370 6.19383 0.243
NP_442710.1_7 Reverse -304 -323 -7.22274 0.294
NP_440519.1_6 Forward -389 -375 9.43936 0.29
NP_442204.1_1 Forward -51 -40 3.20526 0.266
NP_440544.1_5 Reverse -123 -130 14.5681 0.264
NP_442694.1_8 Forward -321 -303 12.3105 0.191
NP_441851.1_5 Forward -148 -129 8.94757 0.23
NP_441555.1_2 Reverse -103 -122 10.6469 0.299
NP_441668.1_4 Forward -117 -98 3.34271 0.187
NP_441683.1_7 Forward -173 -154 -11.9969 0.284
NP_441982.1_10 Forward -349 -330 8.55343 0.143
NP_442689.1_8 Forward -321 -304 -8.61428 0.294
NP_441124.1_5 Reverse -300 -310 12.7217 0.215
NP_440431.1_4 Forward -218 -199 -5.96867 0.248
NP_440588.1_5 Forward -211 -197 16.3492 0.195
NP_440943.1_5 Reverse -346 -360 14.1593 0.22
NP_441528.1_2 Reverse -148 -167 6.58682 0.297
NP_441432.1_8 Reverse -374 -383 2.85133 0.281
NP_441432.1_9 Reverse -123 -136 8.40445 0.289
NP_441333.1_1 Reverse -207 -217 12.4479 0.235
NP_440565.1_3 Reverse -96 -115 15.8702 0.218
NP_440284.1_8 Reverse -338 -357 29.6945 0.000000161
NP_442849.1_1 Forward -44 -30 7.76774 0.282
NP_441833.1_3 Forward -138 -124 18.8791 0.133
NP_441329.1_1 Forward -296 -277 8.6416 0.224
NP_442028.1_1 Reverse -205 -218 9.80195 0.251
NP_440863.1_4 Reverse -6 -25 14.8466 0.267
NP_441541.1_1 Reverse -317 -335 -3.43572 0.264
NP_441617.1_8 Reverse -105 -124 18.9765 0.0783
NP_441230.1_8 Forward -178 -159 17.8957 0.135
NP_442402.1_4 Reverse -1 -20 -4.03287 0.22
NP_442402.1_4 Reverse -36 -55 -6.58946 0.259
NP_441848.1_7 Reverse -118 -137 -4.1312 0.287
NP_442679.1_1 Forward -143 -124 32.9403 0.000000831
NP_442679.1_2 Forward -55 -36 30.3837 0.00000872
NP_442679.1_3 Forward -219 -201 32.37 0.0000246
NP_440160.1_1 Forward -227 -208 10.1506 0.244
NP_441959.1_8 Reverse -307 -320 8.61288 0.286
NP_442456.1_5 Reverse -371 -389 6.80398 0.26
NP_442844.1_5 Reverse -211 -230 3.53858 0.26
NP_442532.1_4 Reverse -108 -126 9.61321 0.273
NP_441299.1_4 Forward -176 -158 30.4034 0.00000227
NP_441011.1_8 Reverse -10 -19 5.3096 0.271
NP_441028.1_6 Reverse -35 -45 7.35439 0.229
NP_441028.1_6 Reverse -122 -132 4.89613 0.275
NP_441527.1_4 Forward -38 -19 6.63627 0.097
NP_441527.1_4 Forward -159 -140 1.76618 0.131
NP_441527.1_4 Forward -218 -199 -5.30023 0.198
NP_441527.1_4 Forward -46 -27 -5.96867 0.212
NP_441527.1_4 Forward -144 -125 -8.26048 0.242
NP_441527.1_4 Forward -48 -29 -9.50187 0.259
NP_441527.1_4 Forward -152 -133 -9.78835 0.262
NP_441527.1_4 Forward -229 -210 -11.2207 0.278
NP_441527.1_4 Forward -214 -195 -11.9847 0.285
NP_441527.1_4 Forward -160 -141 -12.0802 0.285
NP_441527.1_4 Forward -50 -31 -12.5576 0.291
NP_441527.1_4 Forward -21 -2 -12.5576 0.291
NP_441527.1_4 Forward -211 -192 -12.8441 0.294
NP_440903.1_2 Forward -131 -121 16.303 0.247
NP_442463.1_3 Forward -390 -371 10.0292 0.275
NP_439940.1_1 Reverse -279 -298 31.957 0.00000438
NP_441431.1_1 Forward -322 -304 5.06306 0.245
NP_442805.1_6 Reverse -368 -387 1.86774 0.292
NP_440114.1_10 Reverse -349 -363 7.37441 0.236
NP_442324.1_7 Reverse -337 -356 6.24429 0.268
NP_442930.1_1 Reverse -249 -259 9.71433 0.28
NP_440502.1_3 Reverse -155 -165 14.6665 0.209
NP_440987.1_4 Forward -127 -108 7.37428 0.18
NP_442680.1_5 Forward -142 -123 2.90525 0.237
NP_441332.1_4 Forward -240 -221 5.50599 0.261
NP_442128.1_6 Forward -137 -123 19.2725 0.156
NP_442703.1_1 Forward -223 -204 6.63627 0.266
NP_442703.1_8 Reverse -142 -160 13.3914 0.253
NP_440191.1_5 Forward -172 -153 15.5357 0.27
NP_440191.1_6 Forward -322 -308 13.1895 0.294
NP_443000.1_3 Forward -103 -84 12.1042 0.248
NP_440091.1_1 Forward -246 -234 2.10393 0.197
NP_442451.1_7 Reverse -302 -321 12.9791 0.113
NP_441207.1_7 Forward -218 -204 9.54584 0.275
NP_440305.1_1 Forward -137 -123 16.5317 0.133
NP_442116.1_6 Forward -323 -306 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCTATATAAGCTACTACCCTTTGCCTTAAATCTAAACTGTAAGCCATTGTTTAAACCTGTTCATTTTGTACACTCCATAATTTTACATTAAATTCTCTCATCGTTAATTGAAATGACTATAAAGGTAGTATTAGCATATAGTGAATATGGAGAGAGCAGCGAGAACTTTGTAAGAGTATTAGAAAAAGAAAATCTAGAATATGTACTAGCTATAAGGAGTGATCATGGAGTCTGGCTTGGGAAAGAGGAAAGAGTAAGAGCGAACAAATGGAGAAAATTTGAGAGAGAATTTGCAAGTGGAAAGTCGGAAGTAAGATACGAATAAGATACGTGAGAGAAATTATTTATGGAAGGAGAGGGGAAAAAAGATATTAGCAAGTAACGGATAACAAGGAGAAA

CDS

ATGCCGTCAAATTCAACGTATTTTATTATGACAAAAGTATCAGAAATAAAATATAAAGAAGTGGGTAACTTATATGGAGCAAGGAACTGGATAGAGTATGGATTAAAGCAAATAAAGAATGAACTGGGGTGGGCAGATTTTAGAATGATGGACTATTCCAGAATAGAAAAATGGCGGGAAATAGTGATGAGCGTATATTTAATGGTAAGTCTTCAGATAGAAAATTTGCCTCCGCATGATAACTCCTTAAACAAATCAAAACAGACTAGGGAGATAGCTTATCAGAATATACAAAAACATCCTTGGTGGAATCAAAAAAGTGGATGGAAAAACATACTTAACAACATGAAATTAATAATTCAGCCATTATGTTACTTTAATTTATTAAAGCCGTGGATGACGGTGATTTATACACCTCAGTTATTGAAAAACTTCCATTGCTTATTTGACAGATTGAAGAAGGCAGTAATGGCTTTAGGAGACCTTATTATTGCTCCAATTATTTTACCTTTCCACCTACACTGA

Protein

MPSNSTYFIMTKVSEIKYKEVGNLYGARNWIEYGLKQIKNELGWADFRMMDYSRIEKWREIVMSVYLMVSLQIENLPPHDNSLNKSKQTREIAYQNIQKHPWWNQKSGWKNILNNMKLIIQPLCYFNLLKPWMTVIYTPQLLKNFHCLFDRLKKAVMALGDLIIAPIILPFHLH