Your browser is old and dusty. Try Google Chrome!

Details for slr0457

ORF slr0457
Accession NP_443002.1
Symbol
Category Aminoacyl tRNA synthetases and tRNA modification
Definition tRNA pseudouridine synthase B
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -371 -357 14.7492 0.0392
NP_441061.1_2 Reverse -364 -378 2.16287 0.178
NP_441061.1_2 Reverse -358 -372 1.96621 0.179
NP_441061.1_2 Forward -66 -52 0.786239 0.199
NP_440795.1_7 Forward -371 -364 14.6904 0.0123
NP_440795.1_7 Reverse -364 -371 14.6904 0.0123
NP_440795.1_7 Forward -66 -59 14.6904 0.0123
NP_440795.1_7 Reverse -59 -66 14.6904 0.0123
NP_441418.1_6 Reverse -58 -77 -20.5517 0.117
NP_441418.1_6 Forward -67 -48 -28.1232 0.203
NP_441418.1_6 Forward -372 -353 -28.2215 0.203
NP_441418.1_6 Reverse -231 -250 -30.2865 0.267
NP_442291.1_5 Reverse -57 -73 15.3982 0.0222
NP_442291.1_5 Reverse -362 -378 8.71166 0.0558
NP_442291.1_5 Forward -373 -357 1.23851 0.149
NP_440897.1_6 Forward -67 -48 1.08032 0.171
NP_441453.1_4 Reverse -363 -371 16.539 0.00633
NP_441453.1_4 Reverse -58 -66 16.539 0.00633
NP_441453.1_4 Forward -372 -364 16.539 0.00633
NP_441453.1_4 Forward -67 -59 16.539 0.00633
NP_441453.1_4 Forward -259 -251 4.14932 0.264
NP_441453.1_7 Forward -315 -308 11.9372 0.298
NP_441453.1_7 Forward -297 -290 11.9372 0.298
NP_442151.1_6 Forward -67 -53 20.7474 0.0045
NP_442151.1_6 Forward -372 -358 9.04604 0.159
NP_442151.1_6 Reverse -363 -377 8.75105 0.164
NP_441818.1_1 Forward -371 -360 9.79292 0.232
NP_441818.1_1 Reverse -59 -70 8.80962 0.277
NP_440226.1_1 Reverse -58 -77 10.4225 0.0622
NP_440226.1_1 Forward -67 -48 4.32602 0.196
NP_441630.1_3 Reverse -50 -69 -0.295539 0.287
NP_440150.1_6 Reverse -162 -181 0.58944 0.297
NP_442744.1_9 Forward -378 -364 15.744 0.266
NP_442287.1_1 Forward -135 -125 14.0409 0.266
NP_443002.1_3 Forward -138 -119 22.8122 0.0134
NP_442173.1_1 Forward -371 -363 15.4574 0.00633
NP_442173.1_1 Forward -66 -58 15.4574 0.00633
NP_442173.1_1 Reverse -364 -372 15.4574 0.00633
NP_442173.1_1 Reverse -59 -67 15.4574 0.00633
NP_442173.1_1 Reverse -382 -390 7.00092 0.186
NP_442173.1_5 Reverse -184 -194 15.9202 0.287
NP_442752.1_4 Forward -372 -365 13.8055 0.0199
NP_442752.1_4 Reverse -363 -370 13.8055 0.0199
NP_442752.1_4 Forward -67 -60 13.8055 0.0199
NP_442752.1_4 Reverse -58 -65 13.8055 0.0199
NP_443027.1_4 Forward -69 -59 13.2547 0.0521
NP_443027.1_4 Reverse -361 -371 11.0914 0.107
NP_441812.1_3 Reverse -57 -71 10.4227 0.222
NP_442975.1_10 Forward -71 -57 11.7987 0.0482
NP_442975.1_10 Reverse -54 -68 10.2254 0.056
NP_442975.1_10 Forward -376 -362 9.93039 0.0607
NP_441470.1_6 Reverse -310 -329 12.2908 0.0665
NP_440784.1_7 Forward -371 -364 15.9687 0.0123
NP_440784.1_7 Reverse -364 -371 15.9687 0.0123
NP_440784.1_7 Forward -66 -59 15.9687 0.0123
NP_440784.1_7 Reverse -59 -66 15.9687 0.0123
NP_442909.1_7 Reverse -364 -378 6.68548 0.242
NP_440061.1_9 Forward -374 -360 19.6651 0.00478
NP_440061.1_9 Reverse -56 -70 13.7653 0.076
NP_440061.1_9 Reverse -361 -375 10.422 0.124
NP_440061.1_9 Forward -69 -55 9.24208 0.149
NP_440061.1_9 Reverse -291 -305 5.70218 0.275
NP_440061.1_9 Forward -137 -123 5.21053 0.293
NP_439979.1_2 Forward -366 -347 9.43923 0.226
NP_442062.1_8 Forward -372 -362 17.3846 0.00193
NP_442062.1_8 Reverse -363 -373 17.3846 0.00193
NP_442062.1_8 Forward -67 -57 17.3846 0.00193
NP_442062.1_8 Reverse -58 -68 10.3048 0.0493
NP_442062.1_8 Reverse -250 -260 6.8632 0.116
NP_442062.1_8 Forward -259 -249 4.60159 0.206
NP_440304.1_4 Forward -69 -59 10.8948 0.051
NP_440304.1_4 Forward -56 -46 3.12662 0.299
NP_440304.1_4 Forward -374 -364 1.84832 0.299
NP_440304.1_4 Reverse -361 -371 1.84832 0.299
NP_440304.1_4 Reverse -56 -66 1.84832 0.299
NP_442242.1_4 Forward -371 -364 14.3954 0.0124
NP_442242.1_4 Reverse -364 -371 14.3954 0.0124
NP_442242.1_4 Forward -66 -59 14.3954 0.0124
NP_442242.1_4 Reverse -59 -66 14.3954 0.0124
NP_440044.1_8 Reverse -59 -78 15.6341 0.025
NP_440044.1_8 Forward -66 -47 4.916 0.107
NP_440044.1_8 Forward -215 -196 -1.08219 0.235
NP_441935.1_1 Forward -193 -174 5.01433 0.293
NP_441619.1_8 Forward -378 -364 10.9137 0.185
NP_440307.1_2 Reverse -346 -365 10.2259 0.122
NP_441208.1_1 Forward -66 -47 -6.78538 0.296
NP_441208.1_9 Reverse -247 -261 12.291 0.141
NP_441208.1_9 Forward -288 -274 10.4227 0.188
NP_441208.1_9 Reverse -55 -69 7.57108 0.221
NP_441594.1_6 Reverse -354 -373 5.211 0.209
NP_442110.1_2 Reverse -246 -259 20.137 0.0972
NP_442110.1_7 Forward -372 -358 10.3243 0.0684
NP_442110.1_7 Reverse -62 -76 2.75286 0.222
NP_442110.1_7 Forward -67 -53 2.06454 0.222
NP_441082.1_10 Reverse -113 -126 10.1474 0.236
NP_442726.1_1 Reverse -358 -377 8.94757 0.268
NP_441925.1_4 Forward -32 -13 -15.4392 0.264
NP_441083.1_5 Forward -372 -362 20.3345 0.00053
NP_441083.1_5 Reverse -363 -373 20.3345 0.00053
NP_441083.1_5 Forward -67 -57 20.3345 0.00053
NP_441083.1_5 Reverse -58 -68 11.2881 0.0159
NP_441083.1_5 Forward -259 -249 1.06167 0.218
NP_441738.1_2 Forward -370 -363 15.28 0.0102
NP_441738.1_2 Reverse -365 -372 15.28 0.0102
NP_441738.1_2 Forward -65 -58 15.28 0.0102
NP_441738.1_2 Reverse -60 -67 15.28 0.0102
NP_441738.1_2 Forward -124 -117 6.52862 0.261
NP_441558.1_5 Forward -69 -50 6.4893 0.214
NP_441558.1_5 Reverse -361 -380 4.52268 0.28
NP_440209.1_1 Reverse -363 -371 18.1123 0.00295
NP_440209.1_1 Reverse -58 -66 18.1123 0.00295
NP_440209.1_1 Forward -372 -364 18.1123 0.00295
NP_440209.1_1 Forward -67 -59 18.1123 0.00295
NP_442889.1_8 Forward -70 -56 11.4053 0.0733
NP_442889.1_8 Forward -262 -248 5.50552 0.226
NP_442889.1_8 Reverse -360 -374 5.40719 0.227
NP_441713.1_1 Reverse -52 -71 -17.1101 0.298
NP_440178.1_7 Reverse -57 -76 -11.8986 0.107
NP_440178.1_7 Reverse -249 -268 -20.8467 0.201
NP_440178.1_7 Forward -373 -354 -21.9284 0.246
NP_442570.1_3 Forward -305 -286 -3.04881 0.216
NP_442570.1_3 Forward -374 -355 -4.22878 0.228
NP_441716.1_1 Forward -372 -358 10.6193 0.0936
NP_441716.1_1 Reverse -357 -371 9.04604 0.127
NP_441716.1_1 Reverse -58 -72 8.75105 0.133
NP_442111.1_4 Forward -373 -359 14.3559 0.0307
NP_442111.1_4 Reverse -57 -71 10.9143 0.0518
NP_442111.1_4 Forward -68 -54 8.35772 0.0758
NP_442111.1_4 Reverse -362 -376 1.67122 0.296
NP_441163.1_1 Forward -373 -356 6.62629 0.254
NP_440906.1_5 Forward -371 -364 15.8704 0.0124
NP_440906.1_5 Reverse -364 -371 15.8704 0.0124
NP_440906.1_5 Forward -66 -59 15.8704 0.0124
NP_440906.1_5 Reverse -59 -66 15.8704 0.0124
NP_440747.1_10 Reverse -360 -372 26.5883 0.000317
NP_440747.1_10 Forward -375 -363 14.887 0.00223
NP_440747.1_10 Reverse -55 -67 14.887 0.00223
NP_440747.1_10 Forward -70 -58 7.4138 0.00422
NP_440747.1_10 Reverse -247 -259 -4.28759 0.0903
NP_440747.1_10 Forward -262 -250 -11.9574 0.178
NP_441847.1_6 Forward -369 -350 12.9791 0.0924
NP_441130.1_10 Reverse -56 -70 7.57108 0.155
NP_441486.1_1 Reverse -360 -374 6.3911 0.0344
NP_441486.1_1 Forward -70 -56 6.09611 0.0344
NP_441486.1_1 Forward -375 -361 5.89945 0.0344
NP_441486.1_1 Forward -262 -248 2.06454 0.0918
NP_441486.1_1 Reverse -55 -69 -2.45868 0.175
NP_441486.1_1 Reverse -247 -261 -5.90027 0.266
NP_442634.1_4 Forward -69 -55 -1.8687 0.149
NP_440403.1_4 Forward -76 -57 3.24438 0.126
NP_442848.1_1 Forward -73 -59 -0.983719 0.263
NP_442848.1_1 Reverse -357 -371 -1.5737 0.263
NP_442848.1_5 Forward -61 -43 2.47742 0.276
NP_442848.1_5 Forward -260 -242 -1.65248 0.276
NP_441012.1_4 Forward -75 -62 5.42749 0.297
NP_443018.1_3 Forward -371 -364 14.8871 0.0123
NP_443018.1_3 Reverse -364 -371 14.8871 0.0123
NP_443018.1_3 Forward -66 -59 14.8871 0.0123
NP_443018.1_3 Reverse -59 -66 14.8871 0.0123
NP_443018.1_3 Reverse -251 -258 4.26735 0.267
NP_443018.1_3 Forward -258 -251 4.16902 0.278
NP_441634.1_8 Reverse -115 -129 0.0979218 0.241
NP_441634.1_8 Reverse -228 -242 -2.26202 0.295
NP_441634.1_8 Reverse -248 -262 -2.75368 0.295
NP_441634.1_8 Reverse -361 -375 -3.147 0.295
NP_441634.1_8 Reverse -56 -70 -3.93365 0.295
NP_441634.1_9 Forward -215 -196 9.53674 0.275
NP_440376.1_1 Forward -372 -363 19.4693 0.000692
NP_440376.1_1 Reverse -363 -372 19.4693 0.000692
NP_440376.1_1 Forward -67 -58 19.4693 0.000692
NP_440376.1_1 Reverse -58 -67 19.4693 0.000692
NP_440376.1_1 Reverse -250 -259 14.356 0.01
NP_440376.1_1 Forward -259 -250 0.393051 0.279
NP_441588.1_4 Forward -65 -55 15.9097 0.0369
NP_441588.1_4 Reverse -365 -375 15.9097 0.0369
NP_441588.1_4 Forward -257 -247 6.37155 0.2
NP_442687.1_7 Forward -260 -250 11.6814 0.0994
NP_442687.1_7 Forward -68 -58 9.02648 0.0994
NP_442687.1_7 Forward -373 -363 8.92815 0.0994
NP_442687.1_7 Reverse -362 -372 8.92815 0.0994
NP_442687.1_7 Reverse -57 -67 8.92815 0.0994
NP_442687.1_7 Forward -195 -185 4.20827 0.262
NP_442485.1_3 Reverse -346 -365 4.03102 0.192
NP_442485.1_3 Forward -227 -208 -1.96717 0.261
NP_441846.1_10 Reverse -295 -314 -23.2067 0.279
NP_440642.1_10 Reverse -49 -63 15.5352 0.119
NP_440642.1_10 Reverse -147 -161 6.58715 0.225
NP_441013.1_2 Reverse -352 -370 14.0805 0.0862
NP_441013.1_2 Forward -78 -60 -4.79907 0.299
NP_441422.1_7 Forward -374 -357 -2.71443 0.221
NP_441950.1_8 Forward -36 -22 4.52282 0.292
NP_442296.1_9 Forward -251 -232 -3.3438 0.249
NP_440360.1_10 Reverse -171 -185 3.8345 0.227
NP_442658.1_1 Forward -69 -59 14.2375 0.0237
NP_442658.1_1 Reverse -361 -371 7.94438 0.199
NP_442658.1_1 Reverse -56 -66 6.76441 0.214
NP_442658.1_1 Forward -374 -364 6.76441 0.214
NP_440141.1_8 Forward -387 -368 7.17762 0.246
NP_441855.2_4 Reverse -50 -69 8.94462 0.296
NP_442782.1_2 Forward -372 -358 2.2612 0.275
NP_442496.1_5 Reverse -268 -286 4.44404 0.289
NP_442205.1_9 Forward -73 -57 5.76173 0.128
NP_440656.1_8 Forward -78 -59 9.93088 0.0548
NP_441414.1_6 Forward -397 -378 6.09597 0.13
NP_441414.1_9 Forward -67 -48 4.916 0.0504
NP_441414.1_9 Reverse -363 -382 -3.54046 0.138
NP_441414.1_9 Forward -372 -353 -10.7186 0.293
NP_440184.1_5 Reverse -353 -372 11.1109 0.156
NP_441487.1_9 Reverse -57 -76 -1.47551 0.28
NP_441487.1_9 Forward -36 -17 -2.26216 0.293
NP_441487.1_9 Reverse -362 -381 -2.55715 0.293
NP_442937.1_5 Forward -377 -358 19.6656 0.019
NP_442937.1_5 Reverse -358 -377 11.1109 0.145
NP_442937.1_5 Forward -284 -265 8.84924 0.209
NP_441958.1_5 Forward -68 -58 21.2195 0.000805
NP_441958.1_5 Forward -373 -363 12.2714 0.00183
NP_441958.1_5 Reverse -362 -372 12.2714 0.00183
NP_441958.1_5 Reverse -57 -67 12.2714 0.00183
NP_441127.1_1 Reverse -357 -371 7.86607 0.3
NP_442836.1_10 Reverse -118 -128 16.4013 0.208
NP_442816.1_9 Forward -371 -352 18.6815 0.163
NP_439905.1_1 Reverse -251 -264 11.4257 0.204
NP_443001.1_7 Reverse -46 -65 2.94938 0.279
NP_440984.1_7 Reverse -53 -67 11.3077 0.122
NP_440984.1_7 Forward -264 -250 10.226 0.126
NP_440984.1_7 Forward -72 -58 8.55439 0.142
NP_440984.1_7 Forward -377 -363 7.57108 0.166
NP_439990.1_5 Reverse -358 -371 13.884 0.0889
NP_439990.1_5 Reverse -53 -66 10.934 0.128
NP_442911.1_2 Reverse -48 -67 5.30933 0.0341
NP_442911.1_2 Forward -382 -363 -9.44032 0.257
NP_442911.1_2 Reverse -353 -372 -11.1119 0.299
NP_440153.1_5 Reverse -59 -73 20.1574 0.034
NP_440153.1_5 Forward -371 -357 1.67122 0.245
NP_440153.1_8 Reverse -23 -36 -2.93064 0.268
NP_440369.1_6 Forward -224 -205 11.0125 0.25
NP_441941.1_9 Reverse -214 -233 3.53937 0.236
NP_442064.1_4 Reverse -353 -372 13.5683 0.147
NP_443055.1_3 Forward -76 -57 24.0139 0.00271
NP_443055.1_6 Reverse -370 -388 8.76983 0.141
NP_443055.1_6 Forward -380 -362 5.91824 0.172
NP_443055.1_6 Reverse -277 -295 2.08335 0.22
NP_440993.1_3 Reverse -48 -67 14.8466 0.0527
NP_440993.1_4 Reverse -207 -224 7.80699 0.225
NP_440471.1_6 Forward -193 -174 19.174 0.165
NP_440602.1_2 Reverse -53 -72 1.57275 0.263
NP_440138.1_6 Forward -371 -352 2.06362 0.273
NP_441099.1_5 Reverse -353 -372 13.9625 0.0166
NP_441099.1_5 Forward -232 -213 -10.6203 0.258
NP_441294.1_7 Forward -71 -57 17.0257 0.0103
NP_441294.1_7 Forward -376 -362 9.82656 0.223
NP_441294.1_7 Reverse -25 -39 8.77068 0.281
NP_441646.1_1 Reverse -51 -70 11.1109 0.105
NP_441646.1_1 Forward -379 -360 3.83436 0.204
NP_442438.1_10 Reverse -358 -372 10.0294 0.0581
NP_442438.1_10 Reverse -53 -67 0.0979218 0.239
NP_441000.1_6 Reverse -57 -71 4.32615 0.0957
NP_440484.1_3 Forward -69 -55 12.1926 0.242
NP_440484.1_3 Reverse -361 -375 11.2093 0.242
NP_440147.1_4 Forward -374 -361 18.9972 0.00328
NP_440147.1_4 Reverse -56 -69 18.4072 0.00407
NP_440147.1_4 Forward -69 -56 10.344 0.0355
NP_440147.1_4 Reverse -361 -374 8.77074 0.0465
NP_441295.1_4 Reverse -53 -72 6.4893 0.29
NP_441550.1_8 Forward -69 -59 15.8108 0.0132
NP_441550.1_8 Reverse -361 -371 15.1225 0.0132
NP_441550.1_8 Reverse -56 -66 14.6309 0.0132
NP_441550.1_8 Forward -374 -364 14.6309 0.0132
NP_441916.1_7 Reverse -58 -68 18.9579 0.00144
NP_441916.1_7 Forward -372 -362 10.3048 0.0261
NP_441916.1_7 Reverse -363 -373 10.3048 0.0261
NP_441916.1_7 Forward -67 -57 10.3048 0.0261
NP_441916.1_7 Reverse -250 -260 6.17489 0.105
NP_441916.1_10 Reverse -355 -374 1.0811 0.27
NP_440206.1_4 Reverse -353 -372 5.70185 0.242
NP_440465.1_10 Reverse -166 -185 0.982764 0.284
NP_441041.1_4 Forward -372 -353 0.982764 0.0818
NP_441041.1_7 Reverse -360 -372 7.51478 0.162
NP_441041.1_7 Forward -70 -58 7.32042 0.169
NP_441041.1_7 Reverse -182 -194 5.08534 0.278
NP_442396.1_5 Forward -376 -363 12.2123 0.0913
NP_442396.1_5 Reverse -54 -67 12.114 0.0913
NP_440569.1_6 Forward -50 -31 11.6025 0.135
NP_442004.1_6 Forward -372 -358 9.2427 0.14
NP_441725.1_4 Reverse -358 -372 12.6836 0.0693
NP_441725.1_4 Forward -72 -58 3.8339 0.278
NP_441725.1_5 Forward -371 -361 2.04498 0.115
NP_441725.1_5 Forward -66 -56 2.04498 0.115
NP_441725.1_5 Reverse -364 -374 2.04498 0.115
NP_441725.1_5 Reverse -59 -69 1.94665 0.115
NP_439966.1_7 Reverse -361 -371 15.3192 0.0152
NP_439966.1_7 Forward -69 -59 14.3359 0.0203
NP_439966.1_7 Forward -128 -118 10.796 0.0811
NP_439966.1_7 Reverse -56 -66 7.25606 0.15
NP_439966.1_7 Forward -374 -364 7.25606 0.15
NP_439966.1_7 Forward -261 -251 4.99446 0.248
NP_442941.1_3 Forward -371 -361 19.2529 0.00262
NP_442941.1_3 Reverse -59 -69 19.2529 0.00262
NP_442941.1_3 Forward -66 -56 11.0914 0.0116
NP_442941.1_3 Reverse -364 -374 11.0914 0.0116
NP_440289.1_2 Forward -70 -57 3.26421 0.0811
NP_440289.1_2 Reverse -360 -373 3.06754 0.0811
NP_440289.1_2 Forward -375 -362 -4.9956 0.294
NP_440983.1_5 Forward -372 -353 -4.32711 0.257
NP_440983.1_9 Reverse -354 -373 11.8975 0.202
NP_440260.1_8 Reverse -354 -372 2.67408 0.182
NP_440260.1_8 Forward -381 -363 1.98577 0.182
NP_440260.1_8 Reverse -49 -67 -5.29072 0.273
NP_442281.1_1 Reverse -358 -372 15.2402 0.0132
NP_442281.1_1 Forward -377 -363 9.93039 0.0648
NP_442281.1_1 Forward -72 -58 8.94708 0.0747
NP_442281.1_1 Reverse -53 -67 8.84875 0.075
NP_442281.1_1 Forward -154 -140 3.44058 0.231
NP_441334.1_7 Forward -374 -355 -19.9617 0.275
NP_442575.1_8 Reverse -7 -26 -3.44213 0.251
NP_440177.1_9 Forward -380 -361 13.0775 0.228
NP_442256.1_2 Forward -69 -51 2.28076 0.107
NP_442256.1_2 Reverse -361 -379 -9.22396 0.254
NP_442256.1_2 Reverse -56 -74 -9.91228 0.299
NP_442012.1_1 Forward -330 -311 7.86593 0.108
NP_441556.1_10 Forward -264 -250 14.7966 0.161
NP_441556.1_10 Reverse -358 -372 13.2393 0.182
NP_440375.1_8 Reverse -251 -270 3.14605 0.22
NP_443030.1_4 Forward -246 -227 -7.27704 0.294
NP_441644.1_6 Reverse -58 -68 19.0557 0.000803
NP_441644.1_6 Forward -372 -362 17.3841 0.00127
NP_441644.1_6 Reverse -363 -373 17.3841 0.00127
NP_441644.1_6 Forward -67 -57 17.3841 0.00127
NP_441644.1_6 Forward -259 -249 6.17443 0.165
NP_441644.1_6 Reverse -207 -217 4.7978 0.224
NP_443049.1_6 Reverse -266 -276 11.8361 0.24
NP_442215.1_2 Forward -374 -358 6.54838 0.0702
NP_442215.1_2 Forward -261 -245 2.8118 0.108
NP_442215.1_2 Forward -69 -53 -0.334789 0.166
NP_442215.1_2 Reverse -241 -257 -4.75968 0.239
NP_442029.1_6 Forward -377 -358 7.27595 0.224
NP_442029.1_6 Reverse -69 -88 4.71934 0.265
NP_442029.1_6 Reverse -251 -270 4.52268 0.268
NP_442029.1_6 Reverse -53 -72 2.75272 0.289
NP_442029.1_10 Forward -276 -257 9.0459 0.239
NP_440253.1_2 Reverse -363 -381 -1.35749 0.238
NP_440929.1_8 Forward -372 -363 19.2726 0.000701
NP_440929.1_8 Reverse -363 -372 19.2726 0.000701
NP_440929.1_8 Forward -67 -58 19.2726 0.000701
NP_440929.1_8 Reverse -58 -67 19.2726 0.000701
NP_440929.1_8 Forward -259 -250 6.68623 0.0887
NP_440469.1_3 Forward -380 -361 17.0107 0.251
NP_440469.1_8 Reverse -205 -224 8.75091 0.295
NP_442933.1_10 Forward -372 -363 17.601 0.00325
NP_442933.1_10 Reverse -363 -372 17.601 0.00325
NP_442933.1_10 Forward -67 -58 17.601 0.00325
NP_442933.1_10 Reverse -58 -67 17.601 0.00325
NP_442933.1_10 Reverse -250 -259 5.01461 0.204
NP_441751.2_8 Forward -371 -357 14.9459 0.0119
NP_441751.2_8 Reverse -364 -378 -0.590395 0.129
NP_441751.2_8 Reverse -59 -73 -3.147 0.134
NP_441751.2_8 Reverse -316 -330 -5.70361 0.231
NP_442554.1_8 Reverse -59 -69 17.2863 0.00543
NP_442554.1_8 Forward -371 -361 16.2046 0.0065
NP_442554.1_8 Forward -66 -56 15.3197 0.00882
NP_442554.1_8 Reverse -364 -374 15.3197 0.00882
NP_442554.1_8 Forward -258 -248 4.79825 0.173
NP_442554.1_8 Reverse -251 -261 3.51995 0.222
NP_442554.1_8 Forward -365 -355 2.53664 0.268
NP_441586.1_6 Forward -69 -50 4.32602 0.277
NP_441762.1_7 Forward -68 -56 0.530633 0.0747
NP_441762.1_7 Reverse -362 -374 0.432302 0.0747
NP_441762.1_7 Forward -334 -322 -6.2542 0.284
NP_441762.1_7 Forward -373 -361 -6.74586 0.284
NP_441762.1_7 Reverse -57 -69 -6.84419 0.284
NP_442313.1_3 Forward -297 -278 6.98095 0.25
NP_442142.1_4 Reverse -360 -373 13.49 0.0348
NP_442142.1_4 Forward -369 -356 8.86849 0.106
NP_442142.1_4 Forward -219 -206 5.72191 0.186
NP_442142.1_4 Forward -70 -57 3.7553 0.246
NP_442142.1_4 Reverse -55 -68 3.55864 0.251
NP_442142.1_4 Forward -375 -362 2.96866 0.269
NP_442142.1_4 Reverse -247 -260 2.67367 0.281
NP_442292.1_1 Forward -371 -362 18.486 0.00229
NP_442292.1_1 Forward -66 -57 18.486 0.00229
NP_442292.1_1 Reverse -364 -373 18.486 0.00229
NP_442292.1_1 Reverse -59 -68 17.5026 0.00435
NP_442292.1_1 Forward -258 -249 6.09625 0.116
NP_442292.1_5 Forward -383 -364 5.50599 0.222
NP_442292.1_5 Reverse -12 -31 -2.65548 0.296
NP_442476.1_6 Reverse -251 -265 5.1128 0.139
NP_442476.1_6 Forward -371 -357 0.687908 0.247
NP_442476.1_6 Reverse -59 -73 0.589577 0.252
NP_442476.1_6 Reverse -166 -180 0.196253 0.269
NP_440895.1_6 Reverse -357 -370 17.6205 0.0643
NP_440421.1_1 Reverse -49 -63 13.9626 0.285
NP_442381.1_8 Reverse -360 -379 -8.16202 0.214
NP_443009.1_5 Reverse -57 -68 14.5128 0.02
NP_443009.1_5 Forward -68 -57 10.1862 0.0792
NP_443009.1_5 Reverse -5 -16 9.69459 0.0913
NP_443009.1_5 Reverse -362 -373 8.90795 0.0965
NP_443009.1_5 Forward -373 -362 8.90795 0.0965
NP_442408.2_1 Reverse -58 -77 -6.58872 0.282
NP_442092.1_6 Forward -254 -235 14.8466 0.195
NP_441715.1_4 Forward -371 -361 17.3846 0.0106
NP_441715.1_4 Reverse -59 -69 16.7946 0.0106
NP_441715.1_4 Reverse -364 -374 7.94484 0.107
NP_441715.1_4 Forward -66 -56 7.94484 0.107
NP_440357.1_3 Reverse -313 -332 3.53937 0.242
NP_441088.1_1 Reverse -58 -77 7.37428 0.243
NP_441448.1_2 Forward -257 -238 -0.492971 0.258
NP_441448.1_7 Forward -141 -122 6.09597 0.273
NP_441198.1_5 Forward -65 -52 14.67 0.206
NP_441198.1_5 Reverse -365 -378 13.6867 0.206
NP_441198.1_8 Reverse -313 -323 12.2947 0.144
NP_441198.1_8 Forward -326 -316 10.2438 0.289
NP_440379.1_5 Reverse -348 -367 -11.1119 0.288
NP_440464.1_10 Forward -66 -56 13.0082 0.169
NP_440464.1_10 Reverse -364 -374 13.0082 0.169
NP_441468.1_1 Forward -371 -364 15.8704 0.0124
NP_441468.1_1 Reverse -364 -371 15.8704 0.0124
NP_441468.1_1 Forward -66 -59 15.8704 0.0124
NP_441468.1_1 Reverse -59 -66 15.8704 0.0124
NP_441468.1_1 Reverse -251 -258 4.36568 0.237
NP_441015.1_10 Forward -72 -53 2.3594 0.151
NP_441015.1_10 Forward -307 -288 -6.78538 0.256
NP_441015.1_10 Reverse -358 -377 -7.4737 0.267
NP_441015.1_10 Forward -371 -352 -8.752 0.277
NP_441015.1_10 Reverse -251 -270 -10.9153 0.289
NP_441673.1_1 Forward -372 -363 20.8459 0.000698
NP_441673.1_1 Reverse -363 -372 20.8459 0.000698
NP_441673.1_1 Forward -67 -58 20.8459 0.000698
NP_441673.1_1 Reverse -58 -67 20.8459 0.000698
NP_441673.1_1 Forward -259 -250 1.57302 0.0764
NP_441673.1_1 Reverse -250 -259 1.57302 0.0764
NP_441673.1_1 Reverse -26 -35 -7.86675 0.187
NP_441673.1_1 Forward -35 -26 -7.96508 0.206
NP_441731.1_3 Forward -173 -154 -2.55715 0.284
NP_441731.1_7 Reverse -349 -368 5.70265 0.245
NP_442253.1_5 Reverse -166 -183 -6.84433 0.298
NP_441956.1_9 Reverse -356 -375 5.99764 0.274
NP_441826.1_2 Reverse -357 -371 6.88276 0.0899
NP_441826.1_2 Reverse -52 -66 -1.47537 0.248
NP_441826.1_2 Forward -378 -364 -4.4253 0.296
NP_441330.1_1 Forward -72 -53 -1.86883 0.0791
NP_441330.1_1 Forward -377 -358 -13.2752 0.183
NP_442868.1_6 Reverse -361 -371 19.2529 0.00563
NP_442868.1_6 Forward -69 -59 10.4031 0.038
NP_442868.1_6 Forward -374 -364 9.81313 0.038
NP_442868.1_6 Reverse -56 -66 9.81313 0.038
NP_442719.1_2 Reverse -363 -381 -8.63467 0.252
NP_442719.1_2 Reverse -270 -288 -10.7979 0.283
NP_441056.1_1 Forward -372 -353 1.57275 0.145
NP_441517.1_8 Reverse -201 -220 16.4207 0.258
NP_441612.1_2 Reverse -363 -373 8.54929 0.21
NP_441612.1_2 Forward -372 -362 8.54929 0.21
NP_441612.1_2 Forward -67 -57 8.54929 0.21
NP_442361.1_3 Reverse -52 -65 9.36073 0.276
NP_442427.1_5 Forward -259 -240 10.4225 0.148
NP_442808.1_1 Forward -260 -250 14.6309 0.0371
NP_442808.1_1 Forward -68 -58 8.73102 0.0481
NP_442808.1_1 Reverse -362 -372 8.63269 0.0481
NP_442808.1_1 Reverse -57 -67 8.63269 0.0481
NP_442808.1_1 Forward -373 -363 8.63269 0.0481
NP_442808.1_1 Forward -78 -68 3.32285 0.244
NP_441101.1_10 Reverse -359 -378 -5.31042 0.281
NP_440145.1_3 Forward -382 -363 1.57275 0.126
NP_440145.1_3 Forward -77 -58 1.27776 0.129
NP_440145.1_3 Reverse -353 -372 0.0977854 0.138
NP_440145.1_4 Forward -269 -259 13.6475 0.299
NP_441906.1_5 Reverse -31 -50 12.1917 0.173
NP_442050.1_5 Forward -69 -59 15.9091 0.0091
NP_442050.1_5 Reverse -361 -371 14.3359 0.0206
NP_442050.1_5 Forward -374 -364 7.64939 0.243
NP_442050.1_5 Reverse -56 -66 7.64939 0.243
NP_440558.1_2 Reverse -354 -373 10.7175 0.0935
NP_440558.1_2 Forward -311 -292 4.32602 0.152
NP_440558.1_2 Forward -225 -206 0.982764 0.185
NP_440558.1_2 Reverse -166 -185 -4.6221 0.247
NP_441048.1_3 Reverse -370 -389 10.0292 0.154
NP_442792.1_6 Forward -390 -371 6.09597 0.251
NP_441878.1_6 Forward -68 -58 10.5014 0.0176
NP_441878.1_6 Forward -373 -363 10.4031 0.0176
NP_441878.1_6 Reverse -362 -372 10.4031 0.0176
NP_441878.1_6 Reverse -57 -67 10.4031 0.0176
NP_441878.1_6 Reverse -249 -259 2.43831 0.0379
NP_441878.1_6 Reverse -124 -134 0.57002 0.14
NP_441878.1_6 Reverse -356 -366 -0.0199663 0.163
NP_441878.1_6 Forward -260 -250 -0.0199663 0.163
NP_441878.1_6 Forward -309 -299 -0.118297 0.167
NP_441878.1_6 Reverse -25 -35 -7.88644 0.278
NP_441036.1_8 Forward -68 -58 15.713 0.00724
NP_441036.1_8 Forward -373 -363 8.33817 0.174
NP_441036.1_8 Reverse -362 -372 8.33817 0.174
NP_441036.1_8 Reverse -57 -67 8.33817 0.174
NP_442650.1_2 Forward -372 -358 9.2427 0.13
NP_441557.1_5 Forward -372 -363 19.9609 0.000699
NP_441557.1_5 Reverse -363 -372 19.9609 0.000699
NP_441557.1_5 Forward -67 -58 19.9609 0.000699
NP_441557.1_5 Reverse -58 -67 19.9609 0.000699
NP_441557.1_5 Forward -259 -250 0.688044 0.128
NP_441557.1_5 Reverse -250 -259 0.688044 0.128
NP_441557.1_8 Forward -269 -259 12.2709 0.236
NP_441445.1_1 Forward -76 -57 0.491109 0.275
NP_442267.1_4 Forward -299 -280 -0.197208 0.287
NP_442066.2_4 Forward -372 -353 -6.98204 0.259
NP_442419.1_2 Reverse -358 -377 -0.787193 0.246
NP_441739.1_2 Forward -103 -87 2.41781 0.288
NP_441458.1_10 Reverse -354 -373 6.98095 0.196
NP_441458.1_10 Reverse -49 -68 4.81767 0.226
NP_442183.1_1 Reverse -363 -377 8.25939 0.119
NP_442183.1_1 Reverse -58 -72 7.66941 0.134
NP_442183.1_1 Forward -372 -358 5.21113 0.226
NP_441655.1_10 Forward -384 -366 27.1585 0.00271
NP_441574.1_1 Reverse -46 -65 -5.11376 0.26
NP_442347.1_2 Forward -371 -362 12.4878 0.056
NP_442347.1_2 Reverse -364 -373 12.4878 0.056
NP_442347.1_2 Forward -66 -57 12.4878 0.056
NP_442347.1_2 Forward -275 -266 8.06287 0.116
NP_442347.1_2 Reverse -59 -68 3.34298 0.284
NP_442645.1_2 Reverse -355 -374 -5.9004 0.0766
NP_442645.1_2 Forward -380 -361 -14.6519 0.177
NP_442645.1_2 Forward -75 -56 -21.7317 0.29
NP_442645.1_2 Reverse -242 -261 -21.9284 0.29
NP_442888.1_9 Reverse -201 -220 12.9791 0.295
NP_441037.1_4 Forward -374 -364 7.9999 0.237
NP_441037.1_4 Reverse -56 -66 7.9999 0.237
NP_441037.1_4 Forward -69 -59 7.22024 0.237
NP_442594.1_7 Reverse -41 -60 7.4718 0.196
NP_442594.1_10 Forward -322 -303 11.3067 0.252
NP_442317.1_6 Forward -329 -310 8.06259 0.216
NP_441633.1_3 Reverse -361 -374 3.46087 0.0699
NP_441633.1_3 Forward -374 -361 1.19926 0.109
NP_441633.1_3 Reverse -56 -69 1.10092 0.109
NP_441633.1_3 Forward -37 -24 -0.865694 0.15
NP_441633.1_3 Forward -69 -56 -3.71729 0.177
NP_442764.1_6 Forward -65 -47 3.06741 0.234
NP_440136.1_2 Forward -371 -364 15.9687 0.0123
NP_440136.1_2 Reverse -364 -371 15.9687 0.0123
NP_440136.1_2 Forward -66 -59 15.9687 0.0123
NP_440136.1_2 Reverse -59 -66 15.9687 0.0123
NP_442998.1_10 Forward -370 -363 15.5754 0.0102
NP_442998.1_10 Reverse -365 -372 15.5754 0.0102
NP_442998.1_10 Forward -65 -58 15.5754 0.0102
NP_442998.1_10 Reverse -60 -67 15.5754 0.0102
NP_440731.1_2 Reverse -231 -250 10.9142 0.275
NP_440899.1_1 Reverse -219 -238 8.99299 0.229
NP_440899.1_1 Forward -227 -208 7.23634 0.261
NP_440899.1_8 Reverse -328 -347 2.16274 0.132
NP_440299.1_1 Reverse -54 -67 22.7331 0.000547
NP_440299.1_1 Reverse -359 -372 20.2748 0.00128
NP_440299.1_1 Forward -376 -363 13.0967 0.0319
NP_440299.1_1 Forward -220 -207 3.55864 0.241
NP_441799.1_1 Forward -71 -57 16.2235 0.0153
NP_441799.1_1 Forward -376 -362 13.5686 0.0311
NP_441799.1_1 Reverse -54 -68 7.96378 0.128
NP_441799.1_1 Forward -263 -249 6.78381 0.162
NP_441799.1_1 Reverse -359 -373 6.58715 0.167
NP_441799.1_1 Reverse -246 -260 3.8339 0.279
NP_442802.1_6 Forward -68 -49 0.491109 0.204
NP_441007.1_10 Reverse -358 -371 1.29759 0.203
NP_441007.1_10 Forward -72 -59 1.10092 0.209
NP_441007.1_10 Reverse -53 -66 -0.964025 0.296
NP_442334.1_2 Forward -382 -365 -13.0392 0.297
NP_442201.1_10 Reverse -47 -66 2.55606 0.1
NP_442201.1_10 Forward -383 -364 -12.3902 0.268
NP_442201.1_10 Forward -78 -59 -14.5535 0.283
NP_440256.1_1 Reverse -55 -74 14.6508 0.00807
NP_440256.1_1 Forward -70 -51 0.982764 0.0791
NP_440256.1_1 Forward -305 -286 -3.73712 0.138
NP_440256.1_1 Forward -375 -356 -8.16202 0.253
NP_440256.1_1 Reverse -360 -379 -9.24366 0.275
NP_440087.1_1 Forward -76 -57 -7.17871 0.27
NP_440087.1_1 Forward -381 -362 -8.26035 0.278
NP_441512.1_4 Forward -71 -52 10.4225 0.237
NP_440456.1_9 Forward -286 -267 12.3892 0.126
NP_441559.1_8 Reverse -358 -372 3.04785 0.143
NP_441559.1_8 Reverse -63 -77 3.04785 0.143
NP_441559.1_8 Forward -72 -58 1.57289 0.155
NP_441559.1_8 Forward -308 -294 -5.80194 0.27
NP_440915.1_6 Reverse -54 -68 12.4876 0.0208
NP_440915.1_6 Reverse -359 -373 10.6193 0.0301
NP_440717.1_1 Forward -66 -47 10.0292 0.24
NP_442785.1_7 Forward -69 -55 10.7177 0.228
NP_441704.1_8 Reverse -352 -371 6.58682 0.258
NP_441464.1_8 Forward -35 -21 5.99778 0.248
NP_441464.1_8 Reverse -363 -377 3.93283 0.283
NP_441939.1_3 Forward -371 -352 5.30933 0.28
NP_442993.1_1 Reverse -363 -379 -7.0213 0.146
NP_442386.1_9 Reverse -362 -371 13.8639 0.0289
NP_442386.1_9 Reverse -57 -66 13.8639 0.0289
NP_442386.1_9 Forward -373 -364 13.8639 0.0289
NP_442386.1_9 Forward -260 -251 12.1923 0.0704
NP_442386.1_9 Forward -127 -118 7.37413 0.219
NP_442386.1_9 Forward -136 -127 7.2758 0.219
NP_442386.1_9 Forward -68 -59 6.39082 0.219
NP_441340.1_5 Forward -371 -364 15.6737 0.0124
NP_441340.1_5 Reverse -364 -371 15.6737 0.0124
NP_441340.1_5 Forward -66 -59 15.6737 0.0124
NP_441340.1_5 Reverse -59 -66 15.6737 0.0124
NP_441340.1_5 Forward -258 -251 4.07068 0.239
NP_441947.1_7 Reverse -166 -185 5.70265 0.295
NP_441947.1_10 Forward -374 -356 0.805796 0.276
NP_442484.1_2 Reverse -47 -66 14.9458 0.0412
NP_440327.1_6 Reverse -47 -66 2.16274 0.299
NP_440586.1_8 Forward -371 -364 13.2151 0.026
NP_440586.1_8 Forward -66 -59 13.2151 0.026
NP_440586.1_8 Reverse -364 -371 13.2151 0.026
NP_440586.1_8 Reverse -59 -66 13.2151 0.026
NP_440586.1_8 Forward -258 -251 7.70858 0.227
NP_440586.1_8 Reverse -208 -215 5.8403 0.283
NP_442251.1_6 Forward -371 -364 15.2804 0.0124
NP_442251.1_6 Reverse -364 -371 15.2804 0.0124
NP_442251.1_6 Forward -66 -59 15.2804 0.0124
NP_442251.1_6 Reverse -59 -66 15.2804 0.0124
NP_440684.1_9 Forward -378 -364 21.6324 0.00406
NP_440684.1_9 Forward -41 -27 9.43936 0.221
NP_441262.1_3 Reverse -363 -370 14.7888 0.0223
NP_441262.1_3 Reverse -58 -65 14.7888 0.0223
NP_441262.1_3 Forward -372 -365 14.7888 0.0223
NP_441262.1_3 Forward -67 -60 14.7888 0.0223
NP_440027.1_3 Forward -77 -59 11.1298 0.159
NP_440027.1_3 Forward -269 -251 8.6715 0.191
NP_440027.1_3 Reverse -289 -307 4.04996 0.262
NP_440027.1_3 Forward -372 -354 2.57501 0.289
NP_440027.1_8 Forward -273 -254 7.17681 0.269
NP_443051.1_1 Forward -68 -59 19.5676 0.00335
NP_443051.1_1 Reverse -362 -371 10.4228 0.00754
NP_443051.1_1 Reverse -57 -66 10.4228 0.00754
NP_443051.1_1 Forward -373 -364 10.4228 0.00754
NP_441595.1_5 Reverse -308 -326 4.05072 0.292
NP_440408.1_7 Reverse -298 -317 11.2092 0.229
NP_440408.1_7 Forward -372 -353 11.1109 0.232
NP_440439.1_1 Forward -70 -57 13.1956 0.0211
NP_440439.1_1 Reverse -360 -373 1.9859 0.138
NP_442239.1_8 Forward -77 -58 4.62101 0.296
NP_439943.1_7 Forward -377 -358 10.6192 0.162
NP_440372.1_2 Forward -371 -364 16.3621 0.0124
NP_440372.1_2 Reverse -364 -371 16.3621 0.0124
NP_440372.1_2 Forward -66 -59 16.3621 0.0124
NP_440372.1_2 Reverse -59 -66 16.3621 0.0124
NP_441181.1_4 Reverse -125 -144 15.3382 0.271
NP_440316.1_10 Reverse -356 -366 15.418 0.168
NP_439977.1_5 Reverse -195 -214 -3.24547 0.298
NP_440267.1_2 Forward -72 -58 12.9786 0.125
NP_442887.1_5 Reverse -217 -236 7.47261 0.264
NP_442384.1_10 Forward -372 -359 20.8655 0.00194
NP_442384.1_10 Forward -67 -54 17.7189 0.00567
NP_442384.1_10 Reverse -58 -71 11.524 0.0348
NP_442384.1_10 Reverse -363 -376 8.77074 0.0608
NP_442384.1_10 Reverse -250 -263 8.57408 0.0641
NP_442384.1_10 Reverse -293 -306 3.95252 0.172
NP_440948.1_6 Forward -301 -282 15.2408 0.298
NP_440693.1_8 Forward -72 -53 13.1758 0.26
NP_440364.1_6 Reverse -356 -369 13.785 0.275
NP_441877.1_7 Forward -72 -53 4.22689 0.218
NP_442713.1_3 Forward -218 -199 1.76941 0.284
NP_441018.1_7 Reverse -353 -372 10.9142 0.194
NP_441018.1_7 Forward -376 -357 9.83255 0.218
NP_441018.1_7 Forward -48 -29 7.86593 0.263
NP_442790.1_4 Reverse -49 -68 -0.39387 0.0942
NP_442790.1_4 Forward -381 -362 -6.29373 0.144
NP_442790.1_4 Reverse -354 -373 -8.26035 0.166
NP_442790.1_4 Forward -76 -57 -15.1435 0.288
NP_442262.1_10 Forward -371 -364 14.1988 0.0123
NP_442262.1_10 Reverse -364 -371 14.1988 0.0123
NP_442262.1_10 Forward -66 -59 14.1988 0.0123
NP_442262.1_10 Reverse -59 -66 14.1988 0.0123
NP_441689.1_5 Forward -69 -59 8.3377 0.132
NP_441689.1_5 Forward -374 -364 5.78111 0.197
NP_441689.1_5 Reverse -361 -371 5.78111 0.197
NP_441689.1_5 Reverse -56 -66 5.78111 0.197
NP_440163.1_10 Reverse -204 -214 10.7964 0.193
NP_440344.1_10 Reverse -356 -373 -7.33598 0.116
NP_440344.1_10 Reverse -51 -68 -8.71262 0.132
NP_440344.1_10 Forward -84 -67 -9.3026 0.143
NP_440282.1_10 Reverse -347 -366 -10.227 0.295
NP_440531.1_6 Forward -75 -56 12.4875 0.0505
NP_440531.1_6 Reverse -355 -374 7.07928 0.102
NP_440531.1_6 Forward -267 -248 5.11266 0.118
NP_440531.1_6 Reverse -349 -368 0.884433 0.185
NP_442917.1_4 Reverse -87 -106 7.86593 0.235
NP_442910.1_1 Forward -141 -122 -4.52377 0.254
NP_442910.1_1 Reverse -51 -70 -7.17871 0.254
NP_442910.1_1 Reverse -356 -375 -7.27704 0.254
NP_441965.1_3 Reverse -353 -372 3.73603 0.181
NP_441965.1_10 Forward -369 -353 5.46674 0.204
NP_441965.1_10 Forward -375 -359 4.18844 0.247
NP_441640.1_8 Reverse -69 -88 -5.80207 0.289
NP_442693.1_7 Forward -373 -354 18.584 0.202
NP_440297.1_9 Forward -371 -361 -0.118297 0.282
NP_440297.1_9 Reverse -364 -374 -0.118297 0.282
NP_440297.1_9 Forward -66 -56 -0.118297 0.282
NP_440297.1_9 Reverse -208 -218 -0.216628 0.282
NP_440297.1_9 Reverse -59 -69 -0.216628 0.282
NP_440350.1_1 Forward -304 -285 -2.26216 0.235
NP_442280.1_10 Forward -307 -289 12.9543 0.163
NP_442280.1_10 Reverse -59 -77 6.72063 0.268
NP_442280.1_10 Forward -312 -294 6.03883 0.28
NP_442280.1_10 Reverse -64 -82 5.06482 0.291
NP_441592.1_4 Forward -372 -353 9.63589 0.124
NP_441592.1_4 Forward -134 -115 2.55606 0.196
NP_441592.1_4 Reverse -363 -382 -3.04881 0.274
NP_440990.1_7 Reverse -46 -65 4.03102 0.292
NP_440894.1_10 Forward -328 -309 6.4893 0.215
NP_440999.1_9 Reverse -359 -373 10.1277 0.055
NP_440999.1_9 Forward -263 -249 5.21113 0.113
NP_440999.1_9 Forward -71 -57 -0.295402 0.203
NP_440888.1_2 Forward -372 -358 16.0269 0.00832
NP_440888.1_2 Forward -67 -53 13.372 0.0297
NP_440888.1_2 Reverse -58 -72 12.5853 0.0424
NP_440888.1_2 Forward -302 -288 8.65209 0.152
NP_440888.1_2 Reverse -363 -377 8.06211 0.172
NP_440888.1_2 Forward -184 -170 6.48882 0.232
NP_440792.1_5 Reverse -364 -383 13.8641 0.12
NP_440600.1_4 Forward -75 -57 18.5054 0.0557
NP_440600.1_4 Reverse -50 -68 7.19731 0.0919
NP_440600.1_4 Forward -380 -362 -1.06249 0.162
NP_440600.1_4 Reverse -355 -373 -1.75081 0.174
NP_440491.1_1 Forward -70 -51 8.28142 0.246
NP_440052.1_5 Reverse -47 -66 -4.13045 0.249
NP_440052.1_8 Reverse -208 -227 8.06259 0.296
NP_439969.1_3 Reverse -53 -72 1.57275 0.257
NP_442033.1_10 Forward -79 -60 -14.4552 0.298
NP_441543.1_2 Forward -371 -362 16.9127 0.00359
NP_441543.1_2 Forward -66 -57 16.9127 0.00359
NP_441543.1_2 Reverse -364 -373 16.9127 0.00359
NP_441543.1_2 Reverse -59 -68 15.9293 0.00518
NP_441543.1_2 Forward -258 -249 5.21127 0.209
NP_442845.1_2 Forward -378 -364 12.586 0.107
NP_442845.1_2 Reverse -357 -371 9.43936 0.174
NP_442845.1_2 Forward -372 -358 6.98109 0.199
NP_442845.1_2 Reverse -52 -66 6.19444 0.215
NP_441319.1_8 Reverse -52 -70 7.78729 0.243
NP_441469.1_8 Forward -68 -59 6.5879 0.227
NP_441469.1_8 Forward -373 -364 6.48957 0.227
NP_441469.1_8 Reverse -362 -371 6.48957 0.227
NP_441469.1_8 Reverse -57 -66 6.48957 0.227
NP_441469.1_8 Forward -260 -251 5.40793 0.272
NP_443064.1_6 Forward -372 -362 12.5669 0.0796
NP_443064.1_6 Reverse -363 -373 12.5669 0.0796
NP_443064.1_6 Forward -67 -57 12.5669 0.0796
NP_443064.1_6 Reverse -58 -68 10.8217 0.13
NP_442578.1_7 Forward -371 -364 14.5921 0.026
NP_442578.1_7 Forward -66 -59 14.5921 0.026
NP_442578.1_7 Reverse -364 -371 14.5921 0.026
NP_442578.1_7 Reverse -59 -66 14.5921 0.026
NP_440710.1_1 Forward -75 -57 7.29564 0.113
NP_442286.1_1 Reverse -58 -77 13.6675 0.138
NP_441462.1_2 Reverse -58 -68 20.2362 0.000805
NP_441462.1_2 Forward -372 -362 11.5831 0.00406
NP_441462.1_2 Reverse -363 -373 11.5831 0.00406
NP_441462.1_2 Forward -67 -57 11.5831 0.00406
NP_441462.1_2 Forward -35 -25 -0.609952 0.24
NP_441621.1_7 Reverse -313 -327 -6.49025 0.295
NP_442822.1_1 Forward -78 -59 4.62101 0.17
NP_443062.1_1 Forward -67 -49 8.05839 0.16
NP_443062.1_1 Forward -372 -354 6.20575 0.206
NP_443062.1_1 Reverse -363 -381 4.93815 0.244
NP_443062.1_6 Reverse -242 -261 10.9142 0.11
NP_442204.1_1 Reverse -359 -370 11.5634 0.0565
NP_442204.1_1 Forward -71 -60 9.59678 0.0736
NP_440255.1_8 Forward -379 -360 15.2069 0.28
NP_440516.1_8 Forward -372 -363 16.9127 0.00442
NP_440516.1_8 Reverse -363 -372 16.9127 0.00442
NP_440516.1_8 Forward -67 -58 16.9127 0.00442
NP_440516.1_8 Reverse -58 -67 16.9127 0.00442
NP_442080.1_7 Reverse -53 -72 -3.83545 0.291
NP_441033.1_2 Reverse -48 -67 -7.37537 0.293
NP_441033.1_2 Forward -382 -363 -8.26035 0.293
NP_442428.1_5 Forward -371 -364 15.8704 0.0124
NP_442428.1_5 Reverse -364 -371 15.8704 0.0124
NP_442428.1_5 Forward -66 -59 15.8704 0.0124
NP_442428.1_5 Reverse -59 -66 15.8704 0.0124
NP_442428.1_5 Reverse -251 -258 4.66067 0.244
NP_440783.1_3 Reverse -370 -389 -0.590531 0.276
NP_442120.1_10 Forward -60 -41 -15.1435 0.289
NP_441867.1_2 Reverse -296 -315 -20.2567 0.291
NP_440673.1_3 Forward -370 -363 12.4288 0.0426
NP_440673.1_3 Forward -65 -58 12.4288 0.0426
NP_440673.1_3 Reverse -365 -372 12.4288 0.0426
NP_440673.1_3 Reverse -60 -67 12.4288 0.0426
NP_440673.1_7 Forward -65 -46 10.9142 0.111
NP_441052.1_2 Forward -372 -362 19.9412 0.00106
NP_441052.1_2 Reverse -363 -373 19.9412 0.00106
NP_441052.1_2 Forward -67 -57 19.9412 0.00106
NP_441052.1_2 Reverse -58 -68 10.4031 0.0285
NP_441052.1_2 Forward -259 -249 7.45319 0.0712
NP_442219.1_8 Forward -382 -363 9.9065 0.219
NP_442219.1_8 Forward -212 -193 7.29741 0.271
NP_442219.1_9 Forward -371 -362 17.7976 0.00718
NP_442219.1_9 Forward -66 -57 17.7976 0.00718
NP_442219.1_9 Reverse -364 -373 17.7976 0.00718
NP_442219.1_9 Reverse -59 -68 8.25953 0.0681
NP_440436.1_4 Forward -371 -362 17.2072 0.00233
NP_440436.1_4 Forward -66 -57 17.2072 0.00233
NP_440436.1_4 Reverse -364 -373 17.2072 0.00233
NP_440436.1_4 Reverse -59 -68 9.24241 0.0871
NP_440436.1_4 Forward -258 -249 4.81753 0.239
NP_441884.1_8 Reverse -57 -76 -2.16383 0.139
NP_441884.1_8 Forward -373 -354 -7.17871 0.247
NP_441884.1_9 Forward -70 -51 -22.42 0.278
NP_442864.1_3 Reverse -52 -71 22.4189 0.0641
NP_440314.1_9 Reverse -364 -383 18.7807 0.00653
NP_440314.1_9 Reverse -59 -78 -8.85033 0.254
NP_440314.1_9 Forward -66 -47 -10.227 0.291
NP_442907.1_2 Reverse -370 -388 7.39397 0.286
NP_441719.1_4 Forward -371 -364 16.3621 0.0124
NP_441719.1_4 Reverse -364 -371 16.3621 0.0124
NP_441719.1_4 Forward -66 -59 16.3621 0.0124
NP_441719.1_4 Reverse -59 -66 16.3621 0.0124
NP_441004.1_1 Forward -378 -359 -14.6519 0.269
NP_442813.1_4 Reverse -50 -69 -4.6221 0.299
NP_442813.1_4 Reverse -43 -62 -8.06369 0.299
NP_442366.1_3 Forward -68 -50 5.42735 0.0878
NP_442366.1_5 Reverse -55 -65 15.4175 0.0374
NP_442366.1_5 Forward -375 -365 15.4175 0.0374
NP_442873.1_3 Reverse -380 -399 5.40686 0.256
NP_441115.1_4 Forward -68 -50 16.7346 0.0252
NP_441115.1_4 Reverse -298 -316 7.98318 0.266
NP_442206.1_10 Reverse -231 -246 1.84819 0.215
NP_442854.1_6 Reverse -58 -77 11.0125 0.193
NP_440328.1_4 Reverse -52 -71 11.9958 0.0607
NP_443054.1_2 Forward -136 -122 3.53951 0.24
NP_443054.1_2 Reverse -361 -375 -0.393733 0.294
NP_443054.1_2 Forward -69 -55 -0.393733 0.294
NP_442430.1_10 Reverse -353 -372 11.2084 0.249
NP_442308.1_8 Forward -265 -246 9.93088 0.231
NP_441851.1_10 Forward -373 -363 15.8113 0.00552
NP_441851.1_10 Reverse -362 -372 15.8113 0.00552
NP_441851.1_10 Reverse -57 -67 15.8113 0.00552
NP_441851.1_10 Forward -68 -58 8.53483 0.114
NP_441851.1_10 Reverse -249 -259 4.79825 0.247
NP_442208.1_5 Forward -395 -376 -5.31042 0.261
NP_442622.1_1 Reverse -347 -366 -13.1769 0.29
NP_442622.1_8 Reverse -58 -76 0.314141 0.0762
NP_442622.1_8 Forward -372 -354 -8.63398 0.102
NP_442011.1_1 Reverse -362 -381 -1.18052 0.268
NP_442856.1_7 Reverse -354 -373 14.8474 0.0463
NP_441668.1_4 Forward -382 -363 13.4708 0.0687
NP_441668.1_4 Reverse -48 -67 11.1109 0.103
NP_442515.1_1 Reverse -362 -376 12.0943 0.0355
NP_442515.1_1 Reverse -57 -71 10.0294 0.0568
NP_442515.1_1 Reverse -25 -39 3.04785 0.125
NP_442515.1_1 Forward -373 -359 2.16287 0.141
NP_442515.1_1 Forward -68 -54 -4.22864 0.298
NP_442515.1_1 Forward -36 -22 -4.52363 0.298
NP_440593.1_3 Forward -377 -358 -2.75381 0.228
NP_440463.1_8 Reverse -347 -366 7.59671 0.264
NP_440165.1_5 Forward -68 -49 -5.80207 0.227
NP_441349.1_10 Forward -77 -58 16.9124 0.00983
NP_441349.1_10 Forward -382 -363 9.24257 0.0248
NP_441349.1_10 Reverse -240 -259 3.93269 0.0612
NP_441349.1_10 Reverse -353 -372 0.884433 0.0864
NP_441349.1_10 Reverse -48 -67 -6.68705 0.235
NP_442314.1_1 Forward -368 -350 -4.8974 0.272
NP_440389.1_3 Reverse -17 -36 12.1925 0.269
NP_440432.1_9 Reverse -59 -74 13.9429 0.017
NP_442843.1_1 Forward -387 -368 1.37609 0.167
NP_442843.1_1 Reverse -59 -78 -9.63698 0.267
NP_439960.1_4 Reverse -356 -375 12.29 0.291
NP_439960.1_10 Reverse -356 -374 12.5072 0.0769
NP_440431.1_3 Forward -68 -49 -3.83545 0.178
NP_442450.1_5 Reverse -56 -66 7.55152 0.13
NP_442450.1_5 Forward -374 -364 7.55152 0.13
NP_440588.1_2 Forward -375 -356 1.27776 0.138
NP_440588.1_2 Reverse -354 -373 -1.7705 0.157
NP_439950.1_1 Reverse -312 -321 12.5861 0.279
NP_442006.1_2 Forward -366 -349 -7.23765 0.171
NP_442006.1_2 Forward -388 -371 -18.1524 0.288
NP_441003.1_7 Forward -27 -8 22.2223 0.0841
NP_443047.1_7 Reverse -59 -78 12.4875 0.122
NP_442243.1_1 Reverse -357 -375 5.62325 0.18
NP_442243.1_1 Forward -265 -247 3.45998 0.204
NP_442243.1_1 Forward -73 -55 0.608397 0.231
NP_441570.1_1 Reverse -58 -76 19.587 0.00322
NP_441570.1_1 Forward -372 -354 10.6389 0.0086
NP_441570.1_1 Forward -67 -49 -10.3056 0.166
NP_440078.1_10 Forward -372 -353 15.5357 0.123
NP_441078.1_4 Forward -372 -363 19.6659 0.0007
NP_441078.1_4 Reverse -363 -372 19.6659 0.0007
NP_441078.1_4 Forward -67 -58 19.6659 0.0007
NP_441078.1_4 Reverse -58 -67 19.6659 0.0007
NP_441078.1_4 Reverse -250 -259 7.86621 0.0432
NP_441078.1_4 Forward -259 -250 0.884706 0.154
NP_441078.1_10 Forward -129 -110 15.8299 0.167
NP_442729.1_8 Reverse -54 -67 9.36073 0.125
NP_440707.1_6 Forward -267 -248 10.3234 0.285
NP_442443.1_1 Forward -387 -368 -4.52377 0.272
NP_440526.1_3 Forward -371 -360 8.02298 0.126
NP_440526.1_3 Reverse -364 -375 1.04151 0.267
NP_440526.1_3 Forward -66 -55 1.04151 0.267
NP_440526.1_3 Forward -258 -247 0.844851 0.267
NP_441432.1_8 Reverse -362 -371 16.8143 0.00595
NP_441432.1_8 Reverse -57 -66 16.8143 0.00595
NP_441432.1_8 Forward -373 -364 16.8143 0.00595
NP_441432.1_8 Forward -68 -59 16.8143 0.00595
NP_441432.1_8 Reverse -249 -258 11.3078 0.0569
NP_443024.1_2 Reverse -370 -383 15.4566 0.228
NP_443024.1_3 Reverse -313 -323 10.3048 0.289
NP_442320.1_8 Reverse -52 -66 4.22782 0.0522
NP_442320.1_8 Forward -378 -364 3.73617 0.0578
NP_442320.1_8 Reverse -357 -371 -2.26202 0.0871
NP_442344.1_7 Reverse -364 -383 3.34271 0.0638
NP_442344.1_7 Forward -66 -47 -6.39206 0.171
NP_441732.1_2 Reverse -359 -375 -6.52964 0.0495
NP_441732.1_2 Reverse -54 -70 -6.62797 0.0495
NP_441732.1_2 Forward -71 -55 -6.7263 0.0495
NP_441732.1_2 Forward -376 -360 -16.5594 0.174
NP_442003.1_4 Reverse -251 -270 12.8808 0.257
NP_440760.1_1 Forward -372 -353 4.03102 0.017
NP_440760.1_1 Forward -67 -48 -5.60541 0.0503
NP_440760.1_1 Reverse -363 -382 -13.1769 0.0989
NP_442797.1_2 Forward -72 -54 13.045 0.239
NP_442797.1_7 Reverse -356 -374 1.29745 0.262
NP_440578.1_8 Reverse -243 -262 14.2574 0.217
NP_441057.1_4 Reverse -139 -157 2.0841 0.253
NP_442353.1_4 Reverse -52 -71 2.45694 0.229
NP_441072.1_2 Reverse -352 -371 14.1591 0.154
NP_441072.1_2 Forward -383 -364 5.70265 0.296
NP_440713.1_4 Reverse -353 -372 22.2223 0.00964
NP_442489.1_2 Forward -88 -69 7.17762 0.172
NP_442489.1_7 Forward -372 -363 20.1576 0.000695
NP_442489.1_7 Reverse -363 -372 20.1576 0.000695
NP_442489.1_7 Forward -67 -58 20.1576 0.000695
NP_442489.1_7 Reverse -58 -67 20.1576 0.000695
NP_442489.1_7 Reverse -250 -259 8.35786 0.0225
NP_442489.1_7 Forward -259 -250 0.884706 0.145
NP_440565.1_7 Reverse -12 -31 -0.688862 0.278
NP_440559.1_1 Forward -371 -362 17.4043 0.00658
NP_440559.1_1 Forward -66 -57 17.4043 0.00658
NP_440559.1_1 Reverse -364 -373 17.4043 0.00658
NP_440559.1_1 Reverse -59 -68 8.65285 0.0586
NP_441659.2_8 Reverse -58 -68 20.9245 0.000805
NP_441659.2_8 Forward -372 -362 18.1713 0.00133
NP_441659.2_8 Reverse -363 -373 18.1713 0.00133
NP_441659.2_8 Forward -67 -57 18.1713 0.00133
NP_441659.2_8 Forward -259 -249 6.76487 0.0678
NP_441022.1_1 Reverse -35 -44 11.4503 0.284
NP_442913.1_10 Reverse -49 -68 11.8975 0.0414
NP_442913.1_10 Forward -381 -362 -1.37718 0.17
NP_442913.1_10 Forward -76 -57 -2.65548 0.19
NP_441040.1_5 Reverse -288 -307 9.14423 0.226
NP_441040.1_5 Reverse -352 -371 4.62101 0.246
NP_442776.1_1 Reverse -352 -371 10.5209 0.17
NP_442776.1_1 Forward -82 -63 4.62101 0.274
NP_442346.1_5 Forward -373 -363 16.6963 0.00248
NP_442346.1_5 Reverse -362 -372 16.6963 0.00248
NP_442346.1_5 Reverse -57 -67 16.6963 0.00248
NP_442346.1_5 Forward -68 -58 16.303 0.00248
NP_442346.1_5 Reverse -206 -216 9.91146 0.114
NP_442346.1_5 Reverse -249 -259 6.37155 0.205
NP_442346.1_10 Reverse -346 -365 -2.45882 0.294
NP_440352.1_5 Forward -392 -373 10.417 0.275
NP_440545.1_3 Reverse -54 -71 3.57876 0.0817
NP_440545.1_3 Forward -376 -359 2.69378 0.0961
NP_440545.1_3 Reverse -246 -263 -0.649475 0.157
NP_440545.1_3 Reverse -311 -328 -5.66436 0.256
NP_441856.1_6 Forward -367 -353 14.2576 0.284
NP_440831.1_3 Reverse -354 -373 10.9498 0.166
NP_440831.1_3 Reverse -49 -68 7.16376 0.263
NP_440555.1_1 Forward -383 -364 2.55606 0.294
NP_441923.1_6 Reverse -208 -222 8.65272 0.278
NP_440486.1_9 Reverse -353 -367 18.5841 0.109
NP_440459.1_2 Forward -69 -52 10.7569 0.192
NP_440459.1_2 Forward -243 -226 10.2653 0.204
NP_440459.1_2 Reverse -241 -258 7.31533 0.296
NP_440010.1_4 Reverse -353 -372 6.09517 0.199
NP_440010.1_10 Forward -384 -365 6.58763 0.226
NP_442551.1_4 Reverse -167 -182 -2.47838 0.265
NP_440847.1_3 Reverse -371 -385 10.422 0.294
NP_442603.1_7 Forward -67 -53 13.2736 0.0897
NP_442603.1_7 Forward -372 -358 10.717 0.125
NP_441888.1_7 Forward -72 -58 3.93283 0.225
NP_441888.1_7 Reverse -358 -372 3.8345 0.225
NP_441888.1_7 Forward -20 -6 1.08123 0.267
NP_441888.1_7 Reverse -180 -194 0.687908 0.287
NP_440449.1_6 Reverse -50 -68 15.356 0.0907
NP_441593.1_5 Reverse -33 -49 16.8724 0.156
NP_441948.1_4 Reverse -51 -69 -4.50408 0.231
NP_441047.1_2 Forward -371 -352 18.7807 0.0488
NP_441047.1_2 Forward -82 -63 1.57275 0.239
NP_441502.1_3 Forward -69 -50 10.5209 0.21
NP_441833.1_4 Forward -371 -364 15.9687 0.0124
NP_441833.1_4 Reverse -364 -371 15.9687 0.0124
NP_441833.1_4 Forward -66 -59 15.9687 0.0124
NP_441833.1_4 Reverse -59 -66 15.9687 0.0124
NP_442799.1_8 Reverse -261 -280 6.91701 0.296
NP_442162.1_9 Forward -371 -364 16.2637 0.0124
NP_442162.1_9 Reverse -364 -371 16.2637 0.0124
NP_442162.1_9 Forward -66 -59 16.2637 0.0124
NP_442162.1_9 Reverse -59 -66 16.2637 0.0124
NP_440671.1_4 Reverse -357 -371 12.586 0.105
NP_440671.1_4 Reverse -230 -244 10.226 0.163
NP_440772.1_8 Forward -378 -359 8.35759 0.259
NP_442073.1_6 Reverse -354 -373 -1.27885 0.271
NP_442140.1_3 Forward -66 -56 12.2714 0.0632
NP_442140.1_3 Reverse -364 -374 12.2714 0.0632
NP_442140.1_3 Forward -371 -361 10.3048 0.0902
NP_442140.1_3 Reverse -59 -69 4.69992 0.238
NP_442140.1_3 Reverse -251 -261 3.71661 0.283
NP_442021.1_3 Forward -378 -359 -4.72043 0.251
NP_441671.1_1 Forward -368 -349 3.34271 0.263
NP_440875.1_9 Reverse -60 -70 13.5309 0.0677
NP_440875.1_9 Forward -364 -354 12.1682 0.13
NP_440875.1_9 Reverse -252 -262 10.3188 0.222
NP_440875.1_9 Forward -370 -360 8.37203 0.233
NP_441813.1_5 Reverse -361 -371 18.1713 0.00743
NP_441813.1_5 Forward -69 -59 18.1713 0.00743
NP_441813.1_5 Reverse -56 -66 8.63316 0.0367
NP_441813.1_5 Forward -374 -364 8.63316 0.0367
NP_441813.1_5 Forward -261 -251 0.176696 0.215
NP_440590.1_4 Forward -66 -53 17.6205 0.00882
NP_440590.1_4 Forward -371 -358 12.8023 0.013
NP_440590.1_4 Reverse -364 -377 0.707601 0.144
NP_440590.1_4 Reverse -59 -72 -3.91395 0.256
NP_440567.1_1 Forward -66 -52 11.7993 0.0267
NP_440567.1_1 Forward -371 -357 6.88276 0.08
NP_440567.1_1 Reverse -364 -378 2.5562 0.17
NP_442497.1_10 Reverse -59 -68 17.601 0.00813
NP_442497.1_10 Forward -371 -362 10.4228 0.0087
NP_442497.1_10 Forward -66 -57 10.4228 0.0087
NP_442497.1_10 Reverse -364 -373 10.4228 0.0087
NP_440821.1_4 Reverse -361 -371 9.41981 0.0286
NP_440821.1_4 Reverse -56 -66 9.41981 0.0286
NP_440821.1_4 Forward -374 -364 9.41981 0.0286
NP_440821.1_4 Forward -69 -59 2.24165 0.131
NP_441239.1_9 Forward -69 -57 13.0187 0.0389
NP_441239.1_9 Forward -261 -249 5.34885 0.223
NP_441239.1_9 Reverse -361 -373 5.25052 0.223
NP_441239.1_9 Reverse -355 -367 3.77555 0.276
NP_441239.1_9 Forward -310 -298 3.77555 0.276
NP_441239.1_9 Forward -137 -125 3.67722 0.279
NP_441239.1_9 Forward -374 -362 3.38223 0.285
NP_441239.1_9 Reverse -56 -68 3.38223 0.285
NP_441892.1_1 Forward -76 -59 11.1502 0.0574
NP_441892.1_1 Reverse -354 -371 7.90532 0.0857
NP_441892.1_1 Reverse -160 -177 1.02215 0.158
NP_440796.1_3 Forward -379 -361 9.45814 0.234
NP_442270.1_9 Reverse -47 -66 -9.24366 0.228
NP_442643.1_3 Forward -200 -181 2.26107 0.166
NP_442216.1_4 Reverse -391 -399 8.1805 0.255
NP_442216.1_4 Reverse -373 -381 8.1805 0.255
NP_440949.1_7 Forward -134 -115 12.4867 0.214
NP_442138.1_10 Reverse -58 -77 3.24438 0.115
NP_442138.1_10 Forward -372 -353 -3.63879 0.242
NP_440391.1_5 Reverse -369 -388 6.4893 0.279
NP_441782.1_5 Reverse -355 -374 9.14423 0.256
NP_442809.1_6 Reverse -293 -312 3.93269 0.256
NP_440546.1_4 Reverse -58 -68 13.5365 0.0459
NP_440546.1_4 Forward -372 -362 10.046 0.109
NP_440546.1_4 Reverse -363 -373 10.046 0.109
NP_440546.1_4 Forward -67 -57 10.046 0.109
NP_440675.1_3 Reverse -324 -343 8.55425 0.203
NP_440462.1_6 Forward -69 -59 18.7612 0.00454
NP_440462.1_6 Reverse -361 -371 9.61647 0.0429
NP_440462.1_6 Reverse -56 -66 1.35667 0.294
NP_440462.1_6 Forward -374 -364 1.35667 0.294
NP_440868.1_4 Forward -71 -59 17.3452 0.0124
NP_440868.1_4 Reverse -359 -371 8.00379 0.0602
NP_440868.1_4 Forward -376 -364 5.84051 0.0879
NP_440868.1_4 Forward -263 -251 2.89058 0.145
NP_440868.1_4 Reverse -54 -66 -0.944332 0.284
NP_440868.1_7 Forward -20 -1 13.9616 0.291
NP_442402.1_10 Reverse -374 -384 10.5993 0.287
NP_441848.1_4 Forward -22 -6 7.26419 0.292
NP_441084.1_6 Forward -69 -55 17.1007 0.0523
NP_440653.1_10 Forward -66 -47 5.01433 0.236
NP_440696.1_3 Reverse -58 -76 21.4553 0.0259
NP_440696.1_3 Reverse -64 -82 1.29745 0.217
NP_440696.1_3 Reverse -250 -268 1.10079 0.22
NP_440696.1_3 Reverse -240 -258 -0.374176 0.243
NP_440696.1_3 Forward -308 -290 -1.94747 0.269
NP_442039.1_4 Forward -371 -364 15.1821 0.0124
NP_442039.1_4 Reverse -364 -371 15.1821 0.0124
NP_442039.1_4 Forward -66 -59 15.1821 0.0124
NP_442039.1_4 Reverse -59 -66 15.1821 0.0124
NP_442039.1_7 Forward -386 -376 7.05986 0.283
NP_442039.1_7 Reverse -227 -237 6.8632 0.292
NP_442679.1_1 Forward -347 -328 -4.52377 0.281
NP_441926.1_3 Reverse -363 -379 6.64671 0.17
NP_440825.1_7 Reverse -364 -374 12.9096 0.152
NP_440825.1_7 Forward -66 -56 12.9096 0.152
NP_442696.1_6 Forward -139 -120 -13.9635 0.295
NP_442837.1_3 Forward -371 -364 15.7721 0.0124
NP_442837.1_3 Reverse -364 -371 15.7721 0.0124
NP_442837.1_3 Forward -66 -59 15.7721 0.0124
NP_442837.1_3 Reverse -59 -66 15.7721 0.0124
NP_442837.1_8 Reverse -319 -337 15.0638 0.261
NP_440160.1_9 Forward -372 -353 12.3892 0.216
NP_442053.1_1 Forward -372 -363 18.3876 0.0007
NP_442053.1_1 Reverse -363 -372 18.3876 0.0007
NP_442053.1_1 Forward -67 -58 18.3876 0.0007
NP_442053.1_1 Reverse -58 -67 18.3876 0.0007
NP_442053.1_1 Reverse -250 -259 5.3096 0.197
NP_440505.1_3 Reverse -361 -371 18.3679 0.00213
NP_440505.1_3 Forward -69 -59 17.188 0.00332
NP_440505.1_3 Forward -374 -364 9.22315 0.122
NP_440505.1_3 Reverse -56 -66 9.22315 0.122
NP_440505.1_7 Reverse -51 -70 0.392778 0.259
NP_440505.1_7 Forward -379 -360 0.294447 0.259
NP_441203.1_1 Forward -66 -47 -14.6519 0.197
NP_440013.1_2 Reverse -51 -65 11.996 0.298
NP_442532.1_7 Reverse -58 -72 1.96621 0.258
NP_441408.2_7 Forward -69 -50 11.2092 0.0915
NP_440914.1_1 Forward -372 -362 17.5935 0.000537
NP_440914.1_1 Reverse -363 -373 17.5935 0.000537
NP_440914.1_1 Forward -67 -57 17.5935 0.000537
NP_440914.1_1 Reverse -58 -68 16.3248 0.00196
NP_440914.1_1 Forward -149 -139 9.20065 0.186
NP_440914.1_1 Forward -126 -116 8.32233 0.197
NP_441011.1_8 Reverse -59 -68 16.6177 0.00602
NP_441011.1_8 Forward -371 -362 8.25953 0.144
NP_441011.1_8 Reverse -364 -373 8.25953 0.144
NP_441011.1_8 Forward -66 -57 8.25953 0.144
NP_442533.1_1 Forward -397 -378 -9.24366 0.221
NP_442533.1_6 Forward -372 -363 17.2076 0.00137
NP_442533.1_6 Reverse -363 -372 17.2076 0.00137
NP_442533.1_6 Forward -67 -58 17.2076 0.00137
NP_442533.1_6 Reverse -58 -67 17.2076 0.00137
NP_442533.1_6 Forward -259 -250 8.25953 0.0776
NP_442533.1_6 Reverse -250 -259 6.8829 0.101
NP_442533.1_6 Forward -134 -125 4.32629 0.184
NP_442533.1_6 Forward -366 -357 4.0313 0.194
NP_442533.1_6 Forward -32 -23 2.75299 0.241
NP_442533.1_6 Reverse -26 -35 2.65466 0.246
NP_442541.1_10 Reverse -125 -139 1.96562 0.27
NP_443050.1_2 Forward -370 -351 13.7658 0.147
NP_442232.1_3 Forward -374 -355 -15.4385 0.291
NP_443016.1_1 Forward -378 -359 1.17943 0.181
NP_441482.1_7 Reverse -357 -371 8.84938 0.0162
NP_441482.1_7 Forward -73 -59 4.91614 0.0431
NP_441482.1_7 Reverse -52 -66 -10.4235 0.209
NP_439944.1_9 Forward -371 -361 10.5014 0.0887
NP_439944.1_9 Reverse -364 -374 10.5014 0.0887
NP_439944.1_9 Forward -66 -56 10.5014 0.0887
NP_439944.1_9 Reverse -59 -69 9.12481 0.1
NP_441028.1_6 Forward -275 -265 5.48612 0.255
NP_440116.1_8 Forward -66 -47 7.57094 0.0436
NP_440116.1_8 Reverse -364 -383 -8.85033 0.261
NP_440115.1_6 Reverse -360 -370 16.008 0.0325
NP_440115.1_6 Forward -70 -60 13.0581 0.0818
NP_440007.1_9 Reverse -359 -373 8.25939 0.18
NP_440007.1_9 Reverse -257 -271 3.93283 0.267
NP_441680.1_4 Forward -371 -352 -0.0988766 0.246
NP_441347.1_5 Reverse -357 -371 9.04542 0.278
NP_441972.1_5 Forward -66 -47 9.0459 0.0678
NP_441972.1_5 Forward -82 -63 -1.37718 0.177
NP_441972.1_5 Reverse -176 -195 -7.76869 0.252
NP_441972.1_5 Forward -371 -352 -9.14533 0.281
NP_441106.1_1 Forward -68 -59 18.486 0.0028
NP_441106.1_1 Forward -373 -364 9.63616 0.0311
NP_441106.1_1 Reverse -362 -371 9.63616 0.0311
NP_441106.1_1 Reverse -57 -66 9.63616 0.0311
NP_440429.1_2 Forward -82 -63 7.17762 0.29
NP_439903.1_6 Forward -70 -51 -0.689632 0.284
NP_001035870.1_3 Reverse -47 -66 -2.95047 0.26
NP_442306.1_10 Forward -72 -53 -18.4868 0.197
NP_440797.1_2 Reverse -352 -371 13.4464 0.224
NP_441286.1_1 Forward -373 -361 12.9203 0.00815
NP_441286.1_1 Reverse -362 -374 12.9203 0.00815
NP_441286.1_1 Reverse -57 -69 5.93884 0.0258
NP_441286.1_1 Forward -68 -56 3.48056 0.0467
NP_441286.1_1 Forward -36 -24 -4.58258 0.165
NP_442674.1_3 Reverse -355 -374 12.0933 0.174
NP_440670.1_8 Forward -372 -363 18.3876 0.000699
NP_440670.1_8 Reverse -363 -372 18.3876 0.000699
NP_440670.1_8 Forward -67 -58 18.3876 0.000699
NP_440670.1_8 Reverse -58 -67 18.3876 0.000699
NP_440670.1_8 Reverse -243 -252 3.14632 0.296
NP_441705.1_4 Reverse -345 -364 9.53756 0.256
NP_440886.1_7 Forward -253 -243 9.41933 0.0805
NP_440886.1_7 Forward -260 -250 8.53436 0.0805
NP_440886.1_7 Forward -68 -58 8.04271 0.0805
NP_440886.1_7 Forward -373 -363 7.94438 0.0805
NP_440886.1_7 Reverse -362 -372 7.94438 0.0805
NP_440886.1_7 Reverse -57 -67 7.94438 0.0805
NP_440886.1_7 Reverse -323 -333 3.91283 0.26
NP_442614.1_2 Forward -259 -245 8.55439 0.255
NP_442614.1_2 Forward -372 -358 8.06273 0.255
NP_440907.2_8 Reverse -59 -69 9.616 0.103
NP_440907.2_8 Forward -66 -56 7.64939 0.117
NP_440907.2_8 Reverse -364 -374 7.64939 0.117
NP_441021.1_8 Forward -338 -320 4.24738 0.223
NP_440841.1_4 Forward -69 -50 -2.75381 0.174
NP_441463.1_6 Reverse -205 -219 6.51256 0.269
NP_441626.1_2 Forward -371 -364 15.7721 0.0124
NP_441626.1_2 Reverse -364 -371 15.7721 0.0124
NP_441626.1_2 Forward -66 -59 15.7721 0.0124
NP_441626.1_2 Reverse -59 -66 15.7721 0.0124
NP_442365.1_7 Reverse -359 -378 8.35759 0.0843
NP_442365.1_7 Reverse -54 -73 -0.197208 0.177
NP_442362.1_7 Forward -364 -346 11.2289 0.251
NP_442794.1_1 Reverse -359 -371 20.0002 0.00523
NP_442794.1_1 Reverse -54 -66 19.1152 0.00716
NP_442794.1_1 Forward -376 -364 9.38042 0.0795
NP_442615.1_1 Reverse -49 -67 18.112 0.00569
NP_442615.1_1 Forward -381 -363 5.91901 0.0371
NP_442615.1_1 Reverse -241 -259 0.707465 0.0979
NP_441962.1_4 Reverse -358 -377 -0.000545616 0.117
NP_441962.1_4 Forward -371 -352 -9.34199 0.215
NP_440387.1_1 Reverse -363 -379 16.2831 0.0047
NP_440387.1_1 Forward -67 -51 6.05672 0.0293
NP_440387.1_1 Forward -372 -356 5.6634 0.0311
NP_440387.1_1 Reverse -58 -74 -1.3181 0.142
NP_440855.1_5 Reverse -355 -374 17.5015 0.085
NP_441431.1_2 Forward -262 -248 16.6169 0.0341
NP_441431.1_2 Forward -70 -56 15.6336 0.045
NP_441431.1_2 Reverse -360 -374 10.422 0.159
NP_441488.1_8 Reverse -53 -67 10.9137 0.146
NP_441488.1_8 Reverse -358 -372 10.0287 0.146
NP_441836.1_1 Reverse -352 -371 12.0837 0.269
NP_441836.1_2 Forward -180 -161 0.786102 0.197
NP_441836.1_2 Forward -378 -359 -4.72043 0.262
NP_440634.1_1 Forward -261 -242 11.5042 0.287
NP_441993.1_1 Forward -378 -359 10.5229 0.125
NP_441993.1_1 Forward -372 -353 9.54836 0.135
NP_441993.1_1 Reverse -119 -138 5.55261 0.2
NP_441993.1_1 Reverse -52 -71 4.18821 0.223
NP_441993.1_1 Reverse -250 -269 2.04414 0.265
NP_441993.1_1 Reverse -357 -376 0.972113 0.288
NP_441993.1_4 Reverse -58 -77 12.4867 0.244
NP_442224.1_1 Forward -374 -355 -4.42544 0.233
NP_441174.1_4 Reverse -265 -275 10.4031 0.288
NP_440358.1_2 Reverse -345 -362 8.19958 0.294
NP_440114.1_10 Reverse -58 -72 17.2075 0.0116
NP_440114.1_10 Reverse -363 -377 5.80112 0.292
NP_441817.1_3 Forward -78 -59 19.0757 0.0383
NP_441272.1_7 Forward -41 -31 17.5813 0.175
NP_440293.1_3 Forward -332 -313 -4.81876 0.265
NP_441237.1_9 Forward -66 -56 14.828 0.0242
NP_441237.1_9 Reverse -364 -374 14.828 0.0242
NP_441237.1_9 Forward -258 -248 11.2881 0.189
NP_441311.1_2 Reverse -52 -66 13.8636 0.229
NP_442867.1_8 Reverse -60 -79 6.68596 0.257
NP_442867.1_8 Forward -305 -286 5.211 0.276
NP_442867.1_8 Reverse -350 -369 4.12936 0.291
NP_440457.1_1 Reverse -359 -371 7.61046 0.101
NP_440457.1_1 Forward -71 -59 1.31728 0.241
NP_440457.1_1 Reverse -257 -269 0.333971 0.25
NP_442940.1_2 Forward -372 -353 5.01433 0.239
NP_440798.1_6 Reverse -59 -72 2.96921 0.158
NP_440801.1_8 Reverse -362 -381 15.1424 0.116
NP_442561.1_9 Forward -66 -47 19.4681 0.197
NP_441984.1_3 Forward -71 -53 21.062 0.0547
NP_441332.1_6 Forward -127 -117 11.9372 0.239
NP_440473.1_1 Reverse -360 -379 17.1382 0.0887
NP_440473.1_9 Forward -78 -59 -3.3438 0.165
NP_440473.1_9 Forward -383 -364 -5.31042 0.212
NP_442509.1_9 Forward -372 -362 8.14104 0.192
NP_442509.1_9 Reverse -363 -373 8.14104 0.192
NP_442509.1_9 Forward -67 -57 8.14104 0.192
NP_442509.1_9 Reverse -58 -68 8.04271 0.192
NP_440554.1_4 Reverse -59 -69 17.9746 0.0131
NP_440554.1_4 Forward -371 -361 8.92815 0.0646
NP_442737.1_5 Forward -373 -354 11.0368 0.294
NP_441885.1_5 Forward -372 -362 20.9245 0.000538
NP_441885.1_5 Reverse -363 -373 20.9245 0.000538
NP_441885.1_5 Forward -67 -57 20.9245 0.000538
NP_441885.1_5 Reverse -58 -68 11.3864 0.00668
NP_441885.1_5 Forward -259 -249 2.24165 0.0822
NP_440478.1_10 Forward -374 -360 7.9644 0.257
NP_440478.1_10 Reverse -56 -70 7.76774 0.257
NP_442341.1_7 Forward -373 -359 9.2427 0.0751
NP_442341.1_7 Forward -68 -54 8.94771 0.0801
NP_442341.1_7 Reverse -362 -376 7.66941 0.0994
NP_442341.1_9 Forward -261 -247 14.4536 0.068
NP_442341.1_9 Forward -69 -55 12.6836 0.0984
NP_441756.1_5 Forward -317 -298 -2.0655 0.267
NP_442395.2_4 Forward -373 -354 4.22689 0.186
NP_440423.1_6 Forward -380 -361 -12.9802 0.204
NP_440423.1_6 Reverse -355 -374 -15.6352 0.229
NP_440423.1_6 Forward -75 -56 -15.6352 0.229
NP_443000.1_3 Forward -361 -342 11.8134 0.255
NP_443000.1_7 Forward -69 -59 20.3345 0.00223
NP_443000.1_7 Reverse -361 -371 19.9412 0.00223
NP_443000.1_7 Forward -374 -364 10.3048 0.0345
NP_443000.1_7 Reverse -56 -66 10.3048 0.0345
NP_440507.2_3 Forward -381 -362 8.55343 0.252
NP_441842.1_10 Reverse -51 -65 16.3225 0.0311
NP_440275.1_3 Forward -69 -59 16.1063 0.0155
NP_440275.1_3 Reverse -361 -371 15.123 0.0182
NP_440275.1_3 Forward -374 -364 8.04317 0.0602
NP_440275.1_3 Reverse -56 -66 8.04317 0.0602
NP_442932.1_9 Forward -385 -366 7.7676 0.241
NP_440091.1_1 Forward -376 -364 -0.452677 0.273
NP_442354.1_7 Reverse -360 -379 6.98095 0.216
NP_440679.1_5 Forward -369 -350 12.4875 0.221
NP_441359.1_5 Forward -31 -12 1.27776 0.29
NP_442451.1_2 Reverse -355 -374 -8.85033 0.254
NP_440175.1_4 Forward -374 -355 -10.227 0.171
NP_440149.1_8 Forward -372 -353 1.86774 0.117
NP_440149.1_8 Reverse -58 -77 -7.86702 0.294
NP_441105.1_3 Reverse -352 -371 9.0459 0.0472
NP_441105.1_3 Reverse -47 -66 6.58763 0.0592
NP_441105.1_3 Forward -377 -358 -2.26216 0.159
NP_441105.1_3 Forward -78 -59 -9.53865 0.29
NP_440216.1_1 Reverse -58 -72 16.1259 0.00307
NP_440216.1_1 Forward -372 -358 -0.590395 0.0284
NP_440216.1_1 Forward -67 -53 -0.787057 0.0284
NP_440216.1_1 Reverse -250 -264 -0.885388 0.0286
NP_440216.1_1 Reverse -363 -377 -2.75368 0.0574
NP_440216.1_9 Reverse -227 -236 6.09625 0.289
NP_440172.1_1 Reverse -58 -68 17.5813 0.00421
NP_440172.1_1 Forward -372 -362 15.0247 0.00945
NP_440172.1_1 Reverse -363 -373 15.0247 0.00945
NP_440172.1_1 Forward -67 -57 15.0247 0.00945
NP_442371.1_1 Forward -384 -374 13.4509 0.206
NP_440167.1_3 Forward -77 -58 12.2908 0.199
NP_442015.1_10 Reverse -359 -372 21.1604 0.00329
NP_442015.1_10 Reverse -54 -67 11.229 0.0372
NP_442015.1_10 Forward -71 -58 4.14919 0.178
NP_442015.1_10 Reverse -64 -77 2.18257 0.199
NP_442015.1_10 Forward -376 -363 1.49425 0.204
NP_442015.1_10 Forward -263 -250 -0.37404 0.264
NP_441226.1_7 Forward -371 -364 14.4934 0.0123
NP_441226.1_7 Reverse -364 -371 14.4934 0.0123
NP_441226.1_7 Forward -66 -59 14.4934 0.0123
NP_441226.1_7 Reverse -59 -66 14.4934 0.0123
NP_441226.1_7 Forward -258 -251 11.2485 0.0971
NP_442834.1_9 Forward -236 -217 7.96426 0.194
NP_441757.1_6 Forward -365 -346 16.1257 0.0689
NP_441111.1_7 Forward -371 -363 18.7023 0.00294
NP_441111.1_7 Forward -66 -58 18.7023 0.00294
NP_441111.1_7 Reverse -364 -372 18.7023 0.00294
NP_441111.1_7 Reverse -59 -67 18.7023 0.00294
NP_441111.1_7 Forward -258 -250 -0.570565 0.233
NP_441111.1_7 Reverse -251 -259 -0.570565 0.233
NP_441766.1_2 Forward -372 -363 17.5026 0.00297
NP_441766.1_2 Reverse -363 -372 17.5026 0.00297
NP_441766.1_2 Forward -67 -58 17.5026 0.00297
NP_441766.1_2 Reverse -58 -67 17.5026 0.00297
NP_441766.1_2 Reverse -381 -390 2.16301 0.262
NP_441766.1_9 Reverse -349 -368 -3.04881 0.291
NP_442417.1_5 Forward -67 -53 9.14437 0.138
NP_440416.1_1 Forward -372 -353 -14.1602 0.284
NP_440416.1_9 Reverse -51 -70 11.5042 0.0202
NP_440416.1_9 Reverse -356 -375 -15.0452 0.184
NP_440416.1_9 Forward -373 -354 -17.8968 0.248
NP_440416.1_9 Forward -223 -204 -19.9617 0.281
NP_440416.1_9 Reverse -346 -365 -20.3551 0.284
NP_440416.1_9 Forward -309 -290 -21.9284 0.298
NP_443052.1_8 Reverse -16 -35 -0.885524 0.075
NP_443052.1_8 Reverse -305 -324 -2.75381 0.0942
NP_443052.1_8 Forward -77 -58 -9.83364 0.197
NP_443052.1_8 Forward -382 -363 -10.6203 0.212
NP_443052.1_9 Reverse -346 -365 -6.88371 0.289
NP_440591.1_9 Forward -373 -355 11.0322 0.11
NP_440591.1_9 Forward -379 -361 4.54237 0.275
NP_440261.1_5 Reverse -251 -264 3.5592 0.06
NP_440261.1_5 Forward -371 -358 -2.63565 0.0924
NP_440261.1_5 Reverse -59 -72 -4.40561 0.147
NP_440261.1_5 Forward -365 -352 -6.47056 0.201
NP_440261.1_5 Forward -66 -53 -10.3055 0.201
NP_440988.1_10 Forward -374 -360 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGGACTTAAGCGACCTGGGGGAATTTGGCGATCGCCAGGGCCGGGAAGGACGGAACAATCAAACGGATGATCGAGGCTATTCCTCCCTGGTGCCCTGGTCTTCCCTGGACGGGGACTTTGGTCTTAATCCCCATCTGCCGGCCAACGCCAATCATCAACCGGCTTGCCAAGGTTGTCAGCATTACCATGGCTATGTGTACAACGGGCAACTGTTGGTGTGTGCCATGCATCCCTACGGTTGGGAAACGGAACAATGTCCAGACTGGCAAGGCCCCAATCCCAATTAATTGTTTCTGCTAACTTCCAACAACTCTTTTCAACGGCCAAAGCAGGCGATCGCCAAAGGGAACTGCTAAGGTTTTTGGTGGCCGCCCCTTAACTCCAGCAATTCTCCCCCT

CDS

ATGTTTGGTTTCCTCAATCTCCATAAACCTCTGCACCTCACTTCCCATGATTGTGTGGCCAAGGTGCGTCGTCTATTAAGGCAAAAACGGGTGGGGCACGGAGGCACCCTAGATCCTTTGGCGGAGGGAGTATTGCCCCTGGCGGTGGGGTCGGCTACCCGTTTACTGCCCTACTTACCTGGGGCAAAGCAATATCAAGCCCTTATTCGCTTTGGGGTACGTACCGACAGCGATGACCTAGCTGGGGAGGTATTAGAGAGTAAAAATGTTAGTTATTTAACCCTTGCCGCCGTTGAACAGATTTTACCGACTTTTTTGGGGGAAATTGAGCAAATTCCCCCTCAATACAGCGCTATTCAGGTTAATGGTAAGCGTTTGTATGAATTGGCCAGGGCTGGCATTCCCCAAGCAGTGCCCAGTCGCATGGTGACTATTAATGATTTGAAAATACTCGGTTGGCGATCGGGGAATCAGCCGGAATTAGATTTACAAGTTACCTGTGGGGAAGGAACCTACATTCGAGCCTTAGCCAGGGACCTTGGCGATCGCCTGGGAACAGGGGCAACGTTGGCGGGCTTGGTACGGCAACAGAGTGGGGGCATGGCCCTGGATAATAGCGTTGGTTTAACCGCCCTGGAAAAAATCGTGGCGGAGGAGGAGCATATTCCTCTCATTCCTCCCCAGGAAGCGTTAAGCCATTTACCCACAGTTCAACTGAATAGCGAATTGGAAAAAAGGTGGTTCCACGGCCAAAGATTGCTCTTGCCAGATCTACCCGTGGGAGTGGTACTAATCACATCGGAGCTAGGCCCAGTAAAATGCTTGGGCGTTGCCCTGGTGACTCCAGAAGACCATGGCACGGTGTTACGGCCAAAAGTTGTGCTGAATTAA

Protein

MFGFLNLHKPLHLTSHDCVAKVRRLLRQKRVGHGGTLDPLAEGVLPLAVGSATRLLPYLPGAKQYQALIRFGVRTDSDDLAGEVLESKNVSYLTLAAVEQILPTFLGEIEQIPPQYSAIQVNGKRLYELARAGIPQAVPSRMVTINDLKILGWRSGNQPELDLQVTCGEGTYIRALARDLGDRLGTGATLAGLVRQQSGGMALDNSVGLTALEKIVAEEEHIPLIPPQEALSHLPTVQLNSELEKRWFHGQRLLLPDLPVGVVLITSELGPVKCLGVALVTPEDHGTVLRPKVVLN