Your browser is old and dusty. Try Google Chrome!

Details for slr0456

ORF slr0456
Accession NP_443001.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -193 -179 -1.47537 0.262
NP_441061.1_2 Forward -394 -380 -2.55701 0.296
NP_440795.1_7 Forward -262 -255 14.6904 0.0123
NP_440795.1_7 Reverse -255 -262 14.6904 0.0123
NP_441418.1_6 Forward -263 -244 -9.63698 0.0288
NP_441418.1_6 Reverse -178 -197 -29.2048 0.219
NP_440897.1_6 Forward -263 -244 -0.39464 0.182
NP_441453.1_4 Reverse -254 -262 16.539 0.00633
NP_441453.1_4 Forward -263 -255 16.539 0.00633
NP_441453.1_7 Reverse -266 -273 11.6422 0.298
NP_441623.1_1 Reverse -247 -265 -5.78238 0.299
NP_442151.1_6 Forward -263 -249 18.2892 0.00782
NP_442151.1_6 Reverse -254 -268 5.89945 0.256
NP_440561.1_4 Forward -265 -246 14.0859 0.229
NP_441818.1_1 Forward -262 -251 8.51463 0.288
NP_441818.1_9 Reverse -173 -192 -0.39387 0.196
NP_440226.1_1 Reverse -254 -273 18.289 0.0157
NP_442169.1_1 Forward -339 -320 -2.26216 0.274
NP_441630.1_3 Reverse -246 -265 12.9791 0.0615
NP_440259.1_4 Reverse -7 -21 16.252 0.14
NP_440348.1_3 Reverse -167 -186 15.8307 0.248
NP_442287.1_5 Forward -251 -241 14.0414 0.228
NP_442655.1_10 Reverse -175 -194 -18.7818 0.276
NP_442173.1_1 Forward -262 -254 15.4574 0.00633
NP_442173.1_1 Reverse -255 -263 15.4574 0.00633
NP_442752.1_4 Reverse -178 -185 15.0838 0.0199
NP_442752.1_4 Forward -263 -256 13.8055 0.0199
NP_442752.1_4 Reverse -254 -261 13.8055 0.0199
NP_442752.1_4 Reverse -173 -180 8.20058 0.127
NP_442752.1_4 Forward -268 -261 6.52896 0.154
NP_443027.1_4 Forward -265 -255 15.3197 0.0437
NP_442975.1_10 Reverse -250 -264 11.307 0.0508
NP_442975.1_10 Forward -191 -177 10.6187 0.0541
NP_442975.1_10 Forward -267 -253 2.65393 0.269
NP_440784.1_7 Forward -262 -255 15.9687 0.0123
NP_440784.1_7 Reverse -255 -262 15.9687 0.0123
NP_442909.1_7 Reverse -255 -269 12.782 0.129
NP_442289.1_4 Forward -271 -255 13.8249 0.203
NP_440061.1_9 Reverse -252 -266 5.01387 0.298
NP_441476.1_5 Reverse -249 -268 -3.04881 0.231
NP_440878.1_9 Reverse -244 -263 4.12936 0.174
NP_442062.1_8 Forward -263 -253 17.6796 0.00193
NP_442062.1_8 Reverse -254 -264 10.3048 0.0493
NP_440304.1_4 Forward -265 -255 18.9579 0.00406
NP_440304.1_4 Reverse -252 -262 9.91146 0.051
NP_442242.1_4 Forward -262 -255 14.3954 0.0124
NP_442242.1_4 Reverse -255 -262 14.3954 0.0124
NP_440044.1_8 Forward -262 -243 6.78429 0.0881
NP_440044.1_8 Reverse -255 -274 3.34271 0.132
NP_441781.1_7 Reverse -253 -272 4.52268 0.186
NP_441781.1_7 Reverse -340 -359 3.14605 0.194
NP_441781.1_7 Reverse -254 -273 -2.55715 0.289
NP_441620.1_3 Forward -270 -251 17.404 0.19
NP_441208.1_9 Reverse -251 -265 16.1259 0.0671
NP_441594.1_6 Reverse -355 -374 3.04771 0.238
NP_442196.1_10 Forward -265 -246 14.8474 0.156
NP_440370.1_10 Forward -272 -253 9.0459 0.234
NP_442110.1_7 Reverse -254 -268 8.84938 0.0807
NP_442110.1_7 Forward -263 -249 2.5562 0.222
NP_441925.1_4 Forward -181 -162 -8.75273 0.212
NP_440856.1_4 Forward -189 -170 -2.55715 0.214
NP_441083.1_5 Forward -263 -253 19.3512 0.000718
NP_441083.1_5 Reverse -254 -264 11.2881 0.0159
NP_441083.1_5 Forward -187 -177 6.46988 0.0838
NP_442827.1_8 Reverse -246 -265 7.4718 0.0962
NP_442827.1_8 Forward -271 -252 4.42355 0.135
NP_441434.1_7 Forward -261 -247 4.71948 0.225
NP_441738.1_2 Forward -261 -254 15.28 0.0102
NP_441738.1_2 Reverse -256 -263 15.28 0.0102
NP_441738.1_2 Forward -185 -178 11.7401 0.0647
NP_441558.1_5 Forward -265 -246 11.5042 0.0801
NP_441558.1_5 Forward -196 -177 6.58763 0.21
NP_441558.1_5 Reverse -252 -271 5.11266 0.26
NP_440209.1_1 Reverse -254 -262 18.1123 0.00295
NP_440209.1_1 Forward -263 -255 18.1123 0.00295
NP_442889.1_8 Forward -397 -383 4.22722 0.27
NP_441713.1_1 Reverse -248 -267 -11.9969 0.24
NP_441713.1_2 Forward -370 -351 17.109 0.291
NP_440178.1_7 Reverse -253 -272 26.0572 0.000238
NP_440178.1_7 Reverse -184 -203 -11.3086 0.0909
NP_440178.1_7 Reverse -106 -125 -22.6167 0.268
NP_442059.1_4 Reverse -254 -273 7.47261 0.193
NP_442570.1_3 Reverse -143 -162 0.294447 0.208
NP_442570.1_3 Reverse -377 -396 -9.34199 0.298
NP_441792.1_5 Forward -187 -171 11.8583 0.19
NP_441716.1_1 Reverse -254 -268 4.42448 0.256
NP_441327.1_5 Forward -245 -236 14.356 0.192
NP_442111.1_4 Reverse -253 -267 15.7325 0.0201
NP_442111.1_4 Forward -264 -250 8.55439 0.0729
NP_442111.1_4 Forward -188 -174 1.67122 0.296
NP_441163.1_1 Forward -321 -304 4.46302 0.287
NP_440343.1_3 Forward -193 -175 8.17984 0.197
NP_440906.1_5 Forward -262 -255 15.8704 0.0124
NP_440906.1_5 Reverse -255 -262 15.8704 0.0124
NP_440747.1_10 Reverse -251 -263 5.54551 0.0128
NP_440747.1_10 Forward -266 -254 -1.92764 0.0192
NP_441130.1_10 Reverse -252 -266 7.57108 0.155
NP_442973.1_5 Reverse -245 -264 19.0757 0.0477
NP_441486.1_1 Forward -266 -252 6.48943 0.0344
NP_441486.1_1 Reverse -251 -265 -2.75368 0.175
NP_442634.1_4 Reverse -252 -266 4.52282 0.0764
NP_442634.1_4 Forward -265 -251 -3.63866 0.161
NP_441265.1_3 Reverse -248 -262 2.94952 0.181
NP_440403.1_10 Forward -310 -291 5.211 0.249
NP_440057.1_4 Forward -160 -141 15.5524 0.184
NP_441014.1_5 Reverse -249 -267 8.86894 0.299
NP_442848.1_1 Forward -269 -255 14.1593 0.0211
NP_442848.1_5 Forward -177 -159 4.54237 0.276
NP_442848.1_9 Reverse -248 -267 3.73603 0.216
NP_443018.1_3 Forward -262 -255 14.8871 0.0123
NP_443018.1_3 Reverse -255 -262 14.8871 0.0123
NP_441316.1_7 Reverse -252 -267 -2.28172 0.248
NP_441316.1_7 Forward -189 -174 -2.47838 0.255
NP_441316.1_7 Reverse -171 -186 -3.65835 0.286
NP_441634.1_8 Reverse -40 -54 0.88457 0.215
NP_441634.1_8 Reverse -252 -266 -3.63866 0.295
NP_441634.1_9 Reverse -63 -82 8.35677 0.294
NP_441182.1_5 Reverse -377 -396 10.0292 0.215
NP_440376.1_1 Forward -263 -254 19.4693 0.000692
NP_440376.1_1 Reverse -254 -263 19.4693 0.000692
NP_440376.1_1 Reverse -178 -187 3.44131 0.203
NP_440376.1_1 Reverse -185 -194 1.96635 0.236
NP_440376.1_1 Reverse -298 -307 0.491382 0.273
NP_441857.1_2 Reverse -265 -284 17.243 0.281
NP_441588.1_4 Forward -261 -251 9.22315 0.14
NP_442730.1_8 Reverse -263 -282 4.91521 0.268
NP_442687.1_7 Reverse -253 -263 18.5646 0.0028
NP_442687.1_7 Forward -264 -254 9.02648 0.0994
NP_442687.1_7 Forward -59 -49 5.78156 0.188
NP_441846.1_10 Reverse -172 -191 -22.0267 0.257
NP_441846.1_10 Forward -260 -241 -23.01 0.275
NP_441846.1_10 Reverse -174 -193 -23.4033 0.285
NP_442958.1_3 Forward -274 -255 -2.95047 0.299
NP_442958.1_10 Forward -39 -20 14.2574 0.258
NP_440642.1_10 Reverse -238 -252 13.4703 0.131
NP_441422.1_7 Reverse -252 -269 4.16874 0.107
NP_441422.1_7 Forward -189 -172 3.48043 0.111
NP_441763.1_10 Forward -274 -255 10.0284 0.174
NP_442658.1_1 Forward -265 -255 15.9091 0.00966
NP_442658.1_1 Reverse -252 -262 14.8275 0.0188
NP_440446.1_8 Forward -208 -189 8.84924 0.226
NP_440617.1_3 Forward -190 -171 4.42435 0.261
NP_441855.2_4 Reverse -246 -265 12.9937 0.174
NP_440662.1_10 Forward -217 -198 18.289 0.175
NP_442205.1_9 Forward -269 -253 15.9882 0.0259
NP_442544.1_2 Reverse -143 -157 -1.47537 0.287
NP_441414.1_9 Reverse -254 -273 -9.34199 0.259
NP_440184.1_9 Reverse -104 -123 7.47261 0.17
NP_441487.1_6 Forward -271 -252 -1.37718 0.285
NP_441487.1_9 Reverse -106 -125 -2.85214 0.296
NP_442321.1_1 Forward -265 -246 5.70265 0.102
NP_441317.1_4 Reverse -11 -25 9.94142 0.29
NP_441958.1_5 Forward -264 -254 21.2195 0.000805
NP_441958.1_5 Reverse -253 -263 20.5312 0.000966
NP_441958.1_5 Reverse -177 -187 0.0783647 0.168
NP_442486.1_4 Reverse -256 -275 11.8975 0.167
NP_439905.1_1 Reverse -255 -268 9.55739 0.216
NP_443001.1_1 Forward -313 -294 27.3355 0.00217
NP_443001.1_2 Forward -220 -201 25.3688 0.00775
NP_443001.1_3 Forward -292 -273 25.4672 0.00888
NP_443001.1_4 Forward -340 -321 23.3039 0.0344
NP_443001.1_5 Forward -106 -87 25.0739 0.00999
NP_443001.1_6 Forward -376 -357 21.8289 0.0863
NP_443001.1_7 Forward -262 -243 21.5339 0.0385
NP_440984.1_7 Reverse -249 -263 8.75105 0.137
NP_442376.1_2 Forward -268 -249 -13.1769 0.286
NP_442911.1_2 Forward -273 -254 -2.55715 0.0995
NP_441580.1_6 Forward -274 -255 3.24438 0.117
NP_440153.1_5 Reverse -255 -269 14.0609 0.0551
NP_442064.1_4 Reverse -375 -394 9.14342 0.212
NP_442536.1_4 Reverse -356 -374 13.2938 0.139
NP_440993.1_2 Reverse -249 -265 4.0901 0.256
NP_440993.1_2 Forward -268 -252 3.89344 0.256
NP_440993.1_2 Forward -187 -171 3.59845 0.256
NP_439975.1_2 Reverse -74 -92 4.14905 0.3
NP_440850.1_4 Reverse -91 -110 17.5024 0.138
NP_441099.1_5 Reverse -244 -263 -3.24547 0.131
NP_441099.1_5 Forward -273 -254 -8.45701 0.194
NP_442002.1_9 Reverse -253 -260 14.1004 0.074
NP_442598.1_2 Reverse -11 -20 14.2577 0.252
NP_441294.1_7 Reverse -250 -264 15.0099 0.0328
NP_441294.1_7 Forward -267 -253 14.338 0.0446
NP_441646.1_1 Reverse -247 -266 -0.295539 0.26
NP_441646.1_7 Reverse -105 -119 16.9125 0.229
NP_442438.1_10 Forward -268 -254 14.2576 0.0314
NP_442438.1_10 Forward -223 -209 7.9644 0.0849
NP_442438.1_10 Reverse -249 -263 -0.787057 0.279
NP_441398.1_9 Forward -273 -254 11.11 0.288
NP_441000.1_6 Reverse -253 -267 4.03116 0.0995
NP_440147.1_4 Reverse -252 -265 22.0454 0.00117
NP_440147.1_4 Forward -265 -252 4.05085 0.173
NP_441550.1_8 Reverse -252 -262 17.6791 0.00754
NP_441550.1_8 Forward -265 -255 17.4824 0.00754
NP_441550.1_8 Reverse -176 -186 6.76441 0.192
NP_441550.1_8 Forward -184 -174 5.68278 0.236
NP_441916.1_7 Reverse -254 -264 18.9579 0.00144
NP_441916.1_7 Forward -263 -253 16.893 0.00407
NP_441916.1_7 Reverse -298 -308 5.68323 0.124
NP_440206.1_4 Forward -192 -173 19.4681 0.0591
NP_440465.1_10 Forward -266 -247 -1.57384 0.295
NP_441041.1_4 Reverse -254 -273 -2.85214 0.117
NP_441041.1_4 Reverse -173 -192 -9.44032 0.216
NP_441041.1_4 Reverse -178 -197 -13.3736 0.285
NP_441041.1_7 Reverse -251 -263 21.314 0.00104
NP_441041.1_7 Forward -266 -254 8.97244 0.125
NP_441547.1_2 Reverse -167 -185 5.03403 0.231
NP_442004.1_6 Reverse -254 -268 16.4209 0.0577
NP_442004.1_6 Forward -187 -173 5.1128 0.197
NP_441725.1_5 Forward -262 -252 11.7798 0.0247
NP_441725.1_5 Reverse -255 -265 8.92815 0.0553
NP_439966.1_7 Forward -189 -179 15.6142 0.0147
NP_439966.1_7 Forward -265 -255 13.8442 0.0234
NP_439966.1_9 Forward -265 -256 0.983037 0.253
NP_442941.1_3 Reverse -255 -265 10.9931 0.0116
NP_442941.1_3 Forward -262 -252 2.53664 0.14
NP_440289.1_2 Reverse -251 -264 7.09911 0.0586
NP_440289.1_2 Forward -266 -253 5.13249 0.0636
NP_439908.1_5 Reverse -239 -258 11.1109 0.298
NP_442281.1_1 Reverse -249 -263 20.9434 0.00192
NP_442281.1_1 Forward -192 -178 6.19383 0.133
NP_442281.1_1 Forward -393 -379 1.5723 0.296
NP_441334.1_7 Forward -265 -246 -10.227 0.12
NP_441334.1_7 Reverse -252 -271 -11.8986 0.13
NP_442256.1_2 Forward -265 -247 -6.37237 0.214
NP_440437.1_1 Reverse -248 -267 1.76941 0.143
NP_442500.1_8 Forward -20 -6 10.082 0.272
NP_442012.1_1 Forward -269 -250 11.0125 0.0769
NP_440498.1_1 Forward -272 -254 -1.75081 0.231
NP_441644.1_6 Reverse -254 -264 19.0557 0.000803
NP_441644.1_6 Forward -263 -253 15.7125 0.0048
NP_441644.1_6 Forward -187 -177 6.46942 0.157
NP_441644.1_6 Forward -307 -297 3.22451 0.293
NP_443049.1_6 Reverse -177 -187 11.7385 0.24
NP_442215.1_2 Forward -265 -249 17.3648 0.0139
NP_442215.1_2 Reverse -238 -254 1.43517 0.134
NP_442215.1_2 Reverse -377 -393 -0.629782 0.17
NP_442177.1_5 Reverse -169 -183 8.45605 0.276
NP_442247.1_8 Reverse -252 -266 7.76774 0.294
NP_440929.1_8 Forward -263 -254 19.2726 0.000701
NP_440929.1_8 Reverse -254 -263 19.2726 0.000701
NP_440929.1_8 Forward -182 -173 3.53964 0.225
NP_442933.1_1 Reverse -7 -26 12.0793 0.242
NP_442933.1_10 Forward -263 -254 17.601 0.00325
NP_442933.1_10 Reverse -254 -263 17.601 0.00325
NP_441310.1_10 Forward -247 -237 15.7909 0.131
NP_441751.2_8 Forward -186 -172 5.01447 0.0448
NP_441751.2_8 Reverse -255 -269 5.01447 0.0448
NP_442554.1_8 Reverse -255 -265 19.1546 0.00369
NP_442554.1_8 Forward -262 -252 14.238 0.0144
NP_442554.1_8 Reverse -299 -309 4.0116 0.2
NP_442554.1_8 Reverse -174 -184 2.92996 0.249
NP_442075.1_10 Reverse -178 -197 14.3558 0.282
NP_441762.1_7 Reverse -253 -265 11.1504 0.0142
NP_441762.1_7 Forward -264 -252 0.432302 0.0747
NP_442313.1_5 Reverse -261 -280 11.3075 0.185
NP_442142.1_4 Reverse -251 -264 11.2284 0.0603
NP_442142.1_4 Reverse -219 -232 2.18201 0.299
NP_442292.1_1 Reverse -255 -264 17.5026 0.00435
NP_442292.1_1 Forward -262 -253 9.53783 0.0183
NP_442292.1_5 Forward -267 -248 0.58944 0.257
NP_441525.1_1 Forward -371 -358 18.9972 0.0967
NP_442143.1_8 Reverse -246 -265 12.0933 0.223
NP_442476.1_6 Reverse -255 -269 10.3243 0.0704
NP_440895.1_10 Reverse -136 -153 -3.8944 0.187
NP_443009.1_5 Forward -264 -253 17.0694 0.00659
NP_443009.1_5 Reverse -253 -264 16.7744 0.00677
NP_442408.2_1 Forward -263 -244 -1.37718 0.234
NP_441715.1_4 Reverse -255 -265 7.25653 0.108
NP_440881.1_4 Forward -348 -329 -1.08219 0.275
NP_440015.1_9 Reverse -254 -272 9.85225 0.099
NP_440183.1_1 Reverse -255 -274 6.19431 0.278
NP_441198.1_8 Forward -265 -255 15.4199 0.0427
NP_441198.1_8 Reverse -252 -262 12.5877 0.12
NP_441198.1_8 Reverse -176 -186 11.3181 0.211
NP_441468.1_1 Forward -262 -255 15.8704 0.0124
NP_441468.1_1 Reverse -255 -262 15.8704 0.0124
NP_442099.1_1 Forward -262 -244 15.0638 0.274
NP_439939.1_5 Reverse -249 -268 12.7825 0.282
NP_441020.2_6 Forward -265 -248 18.7217 0.0111
NP_441020.2_7 Forward -193 -174 7.27514 0.269
NP_441015.1_9 Forward -172 -159 16.7349 0.246
NP_441015.1_10 Forward -268 -249 -1.27885 0.172
NP_441015.1_10 Reverse -173 -192 -3.04881 0.184
NP_441015.1_10 Forward -279 -260 -9.44032 0.282
NP_441015.1_10 Forward -340 -321 -11.0136 0.29
NP_441673.1_1 Forward -263 -254 20.8459 0.000698
NP_441673.1_1 Reverse -254 -263 20.8459 0.000698
NP_441876.1_9 Reverse -323 -333 12.9592 0.267
NP_441826.1_2 Reverse -248 -262 6.09611 0.0946
NP_441826.1_2 Forward -269 -255 1.96621 0.137
NP_441826.1_2 Forward -193 -179 1.86788 0.14
NP_442868.1_6 Reverse -252 -262 9.12481 0.0539
NP_442868.1_6 Forward -265 -255 8.63316 0.0555
NP_442227.1_6 Forward -190 -171 18.7798 0.228
NP_443058.1_7 Reverse -367 -386 1.67108 0.295
NP_442361.1_3 Reverse -248 -261 10.2457 0.272
NP_442361.1_3 Forward -152 -139 8.77074 0.285
NP_442808.1_1 Forward -188 -178 16.8925 0.00954
NP_442808.1_1 Reverse -253 -263 8.73102 0.0481
NP_442808.1_1 Forward -264 -254 8.73102 0.0481
NP_442808.1_1 Forward -140 -130 1.5529 0.282
NP_440145.1_3 Forward -273 -254 0.491109 0.136
NP_440145.1_3 Forward -204 -185 -2.26216 0.166
NP_442820.1_3 Reverse -361 -371 12.7626 0.289
NP_442542.1_9 Reverse -247 -261 4.62054 0.292
NP_442113.1_5 Forward -189 -170 4.91521 0.294
NP_442050.1_5 Forward -265 -255 17.1874 0.00812
NP_442050.1_5 Reverse -252 -262 6.96107 0.27
NP_442903.1_2 Forward -25 -6 12.0793 0.163
NP_442342.1_9 Forward -265 -249 4.18844 0.251
NP_440601.1_1 Reverse -189 -208 19.469 0.155
NP_441878.1_6 Reverse -253 -263 20.2362 0.0046
NP_441878.1_6 Forward -264 -254 10.5014 0.0176
NP_441878.1_6 Reverse -172 -182 -7.68978 0.255
NP_441036.1_8 Forward -264 -254 15.713 0.00724
NP_441036.1_8 Reverse -253 -263 8.4365 0.174
NP_441534.1_5 Reverse -362 -381 2.0644 0.293
NP_441557.1_5 Forward -263 -254 19.9609 0.000699
NP_441557.1_5 Reverse -254 -263 19.9609 0.000699
NP_441445.1_1 Forward -272 -253 0.196116 0.281
NP_441590.1_4 Forward -186 -167 2.6536 0.293
NP_442267.1_4 Reverse -150 -169 0.58944 0.285
NP_442066.2_4 Forward -263 -244 -3.83545 0.223
NP_442066.2_4 Reverse -254 -273 -9.14533 0.296
NP_441433.1_8 Forward -255 -236 11.0125 0.147
NP_441308.1_8 Reverse -176 -186 13.0581 0.218
NP_441308.1_8 Forward -265 -255 12.4681 0.218
NP_440101.1_3 Forward -268 -249 17.3057 0.0483
NP_440101.1_3 Reverse -173 -192 6.68596 0.181
NP_442183.1_1 Reverse -254 -268 7.86607 0.131
NP_442183.1_1 Reverse -178 -192 5.60446 0.21
NP_441574.1_1 Reverse -46 -65 -6.78538 0.28
NP_440276.1_8 Reverse -142 -161 7.96426 0.27
NP_442444.1_6 Forward -271 -253 12.5337 0.272
NP_441549.1_9 Reverse -250 -268 0.21581 0.126
NP_442347.1_2 Forward -186 -177 4.42462 0.284
NP_442347.1_2 Forward -262 -253 3.34298 0.284
NP_442347.1_2 Reverse -255 -264 3.34298 0.284
NP_442645.1_2 Forward -271 -252 -1.37718 0.0487
NP_442645.1_2 Reverse -176 -195 -20.2567 0.288
NP_442645.1_2 Forward -265 -246 -21.0434 0.29
NP_442645.1_2 Forward -202 -183 -21.24 0.29
NP_442965.1_2 Forward -248 -229 -6.39206 0.257
NP_441037.1_4 Reverse -252 -262 17.3558 0.0127
NP_441037.1_4 Forward -265 -255 16.5761 0.0168
NP_442594.1_8 Reverse -170 -189 8.84924 0.201
NP_442594.1_8 Reverse -67 -86 3.04771 0.289
NP_441633.1_3 Reverse -252 -265 3.65753 0.0699
NP_441633.1_3 Forward -265 -252 -3.71729 0.177
NP_442014.1_4 Reverse -187 -206 22.2909 0.0734
NP_440136.1_2 Forward -262 -255 15.9687 0.0123
NP_440136.1_2 Reverse -255 -262 15.9687 0.0123
NP_440136.1_2 Reverse -179 -186 3.97235 0.288
NP_442998.1_10 Forward -261 -254 15.5754 0.0102
NP_442998.1_10 Reverse -256 -263 15.5754 0.0102
NP_442998.1_10 Forward -185 -178 5.74231 0.255
NP_440899.1_8 Reverse -308 -327 0.982764 0.174
NP_440299.1_1 Reverse -250 -263 10.8351 0.0529
NP_440299.1_1 Forward -267 -254 6.60689 0.136
NP_441799.1_1 Forward -267 -253 9.93039 0.082
NP_441799.1_1 Reverse -250 -264 8.94708 0.103
NP_440640.1_6 Forward -262 -243 4.12936 0.213
NP_441007.1_10 Forward -268 -255 13.1956 0.0499
NP_441007.1_10 Reverse -249 -262 0.904263 0.212
NP_442333.2_5 Reverse -243 -262 -14.9469 0.286
NP_440256.1_1 Reverse -251 -270 -2.0655 0.112
NP_440256.1_1 Forward -266 -247 -5.70374 0.189
NP_441512.1_4 Forward -267 -248 21.1406 0.0476
NP_441559.1_8 Forward -268 -254 -0.983719 0.18
NP_441559.1_8 Reverse -125 -139 -4.7203 0.236
NP_441559.1_8 Reverse -313 -327 -5.70361 0.27
NP_440915.1_6 Reverse -250 -264 15.3392 0.0183
NP_440915.1_6 Forward -267 -253 10.6193 0.0301
NP_440915.1_6 Reverse -174 -188 6.29277 0.0828
NP_440997.1_6 Forward -202 -183 11.0125 0.262
NP_442855.1_3 Forward -272 -253 11.9958 0.257
NP_442866.1_1 Forward -268 -249 8.94757 0.101
NP_442866.1_1 Reverse -173 -192 -1.86883 0.205
NP_440748.1_5 Forward -191 -172 -2.36049 0.273
NP_441464.1_8 Reverse -254 -268 10.0294 0.186
NP_440787.1_5 Forward -19 -5 17.2075 0.144
NP_441939.1_3 Reverse -255 -274 10.1275 0.129
NP_441199.1_6 Forward -191 -172 10.3242 0.0781
NP_441199.1_6 Reverse -334 -353 3.73603 0.177
NP_441494.1_6 Forward -268 -255 9.85238 0.227
NP_442993.1_1 Reverse -298 -314 -4.36636 0.138
NP_440677.1_1 Forward -67 -48 8.06259 0.218
NP_442386.1_5 Forward -23 -4 9.24175 0.176
NP_442386.1_9 Forward -188 -179 11.1107 0.103
NP_442386.1_9 Forward -264 -255 6.39082 0.219
NP_442386.1_9 Reverse -253 -262 6.39082 0.219
NP_441340.1_5 Forward -262 -255 15.6737 0.0124
NP_441340.1_5 Reverse -255 -262 15.6737 0.0124
NP_441947.1_4 Reverse -243 -262 15.6341 0.147
NP_442484.1_2 Reverse -243 -262 8.75091 0.143
NP_440327.1_6 Reverse -140 -159 2.16274 0.299
NP_442240.1_2 Reverse -255 -274 -5.9004 0.11
NP_442714.1_5 Forward -151 -132 1.47442 0.242
NP_442714.1_5 Forward -334 -315 0.0977854 0.26
NP_442714.1_7 Forward -181 -162 6.98095 0.16
NP_440586.1_8 Forward -262 -255 13.2151 0.026
NP_440586.1_8 Reverse -255 -262 13.2151 0.026
NP_442251.1_6 Forward -262 -255 15.2804 0.0124
NP_442251.1_6 Reverse -255 -262 15.2804 0.0124
NP_441262.1_3 Reverse -254 -261 14.7888 0.0223
NP_441262.1_3 Forward -263 -256 14.7888 0.0223
NP_440027.1_3 Forward -273 -255 13.9813 0.121
NP_440027.1_8 Forward -190 -171 10.0284 0.243
NP_443051.1_1 Forward -264 -255 19.5676 0.00335
NP_443051.1_1 Reverse -253 -262 18.0926 0.00402
NP_443051.1_1 Reverse -177 -186 6.8829 0.066
NP_441232.1_10 Forward -274 -255 11.5042 0.0997
NP_439937.1_9 Reverse -253 -270 -5.07504 0.157
NP_441740.2_1 Forward -196 -177 23.4022 0.0381
NP_440439.1_1 Forward -266 -253 21.7504 0.00844
NP_440439.1_1 Reverse -175 -188 8.08242 0.0559
NP_440921.1_9 Reverse -98 -117 21.0423 0.0712
NP_440372.1_2 Forward -262 -255 16.3621 0.0124
NP_440372.1_2 Reverse -255 -262 16.3621 0.0124
NP_440372.1_2 Reverse -179 -186 4.07068 0.262
NP_440171.1_3 Reverse -175 -194 3.83436 0.284
NP_440316.1_10 Forward -257 -247 5.38824 0.299
NP_441803.1_2 Forward -268 -249 6.09597 0.159
NP_439977.1_5 Forward -269 -250 4.42435 0.153
NP_440210.1_10 Reverse -230 -249 5.89851 0.296
NP_441572.1_7 Reverse -248 -267 1.27776 0.153
NP_441572.1_7 Forward -125 -106 -5.31042 0.257
NP_441572.1_7 Forward -193 -174 -6.09707 0.281
NP_442384.1_10 Forward -263 -250 10.639 0.0428
NP_442384.1_10 Reverse -254 -267 9.95071 0.047
NP_442384.1_10 Forward -367 -354 2.77255 0.213
NP_442114.1_8 Forward -28 -14 11.9953 0.216
NP_441980.1_4 Reverse -168 -187 5.30933 0.206
NP_441604.1_4 Reverse -246 -265 0.294447 0.212
NP_441018.1_7 Reverse -15 -34 7.27595 0.273
NP_442790.1_4 Reverse -245 -264 -15.5368 0.294
NP_442262.1_10 Forward -262 -255 14.1988 0.0123
NP_442262.1_10 Reverse -255 -262 14.1988 0.0123
NP_441689.1_5 Forward -265 -255 8.43603 0.132
NP_441689.1_5 Reverse -176 -186 3.61784 0.3
NP_442244.1_3 Reverse -181 -200 2.65439 0.299
NP_440163.1_10 Reverse -295 -305 9.7148 0.226
NP_440344.1_10 Reverse -247 -264 6.52869 0.0178
NP_440531.1_6 Forward -271 -252 -4.91709 0.29
NP_440531.1_8 Reverse -91 -110 2.0644 0.298
NP_442910.1_1 Reverse -247 -266 -4.72043 0.254
NP_441965.1_3 Forward -273 -254 -1.57384 0.286
NP_440297.1_9 Forward -262 -252 9.61647 0.0917
NP_440297.1_9 Reverse -255 -265 -0.314959 0.282
NP_440350.1_5 Reverse -3 -22 -1.7705 0.21
NP_442280.1_10 Reverse -237 -255 7.11023 0.268
NP_441896.1_3 Reverse -245 -264 -1.86883 0.268
NP_441103.1_9 Reverse -237 -247 15.3217 0.192
NP_440894.1_10 Forward -192 -173 5.80098 0.227
NP_440894.1_10 Reverse -249 -268 4.81767 0.243
NP_442553.1_6 Reverse -341 -360 12.5858 0.258
NP_440999.1_9 Reverse -250 -264 1.76955 0.158
NP_440999.1_9 Forward -267 -253 0.196253 0.191
NP_440999.1_9 Reverse -313 -327 -2.95034 0.281
NP_440888.1_2 Reverse -254 -268 17.1085 0.00462
NP_440888.1_2 Reverse -241 -255 11.2087 0.0729
NP_440888.1_2 Forward -187 -173 9.53707 0.123
NP_440873.1_1 Forward -34 -15 6.58763 0.235
NP_440491.1_1 Forward -266 -247 9.15853 0.219
NP_440052.1_5 Reverse -243 -262 0.196116 0.175
NP_442277.1_4 Reverse -245 -264 15.4366 0.037
NP_442033.1_10 Reverse -252 -271 -7.76869 0.186
NP_441543.1_2 Reverse -255 -264 15.9293 0.00518
NP_441543.1_2 Forward -262 -253 9.34117 0.0818
NP_441543.1_2 Reverse -43 -52 4.12963 0.279
NP_442845.1_2 Reverse -172 -186 16.7159 0.0608
NP_442845.1_2 Forward -269 -255 7.86607 0.195
NP_442845.1_2 Forward -256 -242 7.07942 0.199
NP_442845.1_2 Forward -274 -260 3.24451 0.298
NP_441319.1_8 Forward -132 -114 5.91901 0.273
NP_440982.1_1 Forward -187 -168 15.6332 0.0853
NP_441469.1_8 Reverse -253 -262 13.3727 0.073
NP_441469.1_8 Forward -264 -255 6.5879 0.227
NP_441469.1_8 Forward -188 -179 5.40793 0.272
NP_443064.1_6 Forward -263 -253 13.8273 0.0796
NP_443064.1_6 Reverse -254 -264 10.8217 0.13
NP_442337.1_8 Reverse -140 -159 -2.16383 0.295
NP_442578.1_7 Forward -262 -255 14.5921 0.026
NP_442578.1_7 Reverse -255 -262 14.5921 0.026
NP_442578.1_7 Reverse -43 -50 8.79057 0.163
NP_440710.1_1 Forward -271 -253 8.57394 0.101
NP_440710.1_1 Forward -127 -109 -6.56903 0.225
NP_441462.1_2 Reverse -254 -264 20.2362 0.000805
NP_441462.1_2 Forward -263 -253 20.1379 0.000967
NP_441462.1_5 Forward -339 -320 0.196116 0.297
NP_441621.1_7 Reverse -252 -266 2.5562 0.123
NP_441621.1_7 Forward -189 -175 -5.60527 0.256
NP_443062.1_1 Reverse -254 -272 7.08331 0.185
NP_443062.1_6 Reverse -378 -397 0.884433 0.286
NP_443062.1_6 Reverse -246 -265 0.58944 0.292
NP_441410.1_4 Reverse -376 -395 11.405 0.246
NP_442204.1_1 Forward -267 -256 0.451995 0.281
NP_442204.1_5 Reverse -244 -263 1.86774 0.225
NP_441560.1_10 Reverse -246 -265 5.50599 0.292
NP_440516.1_8 Forward -263 -254 16.9127 0.00442
NP_440516.1_8 Reverse -254 -263 16.9127 0.00442
NP_440516.1_8 Reverse -178 -187 9.24284 0.0264
NP_442428.1_4 Reverse -172 -191 9.24257 0.158
NP_442428.1_5 Forward -262 -255 15.8704 0.0124
NP_442428.1_5 Reverse -255 -262 15.8704 0.0124
NP_441443.1_1 Forward -251 -232 0.196116 0.225
NP_441443.1_1 Forward -336 -317 -3.3438 0.287
NP_442859.1_2 Reverse -255 -274 17.3057 0.068
NP_442823.1_8 Forward -268 -249 12.1925 0.275
NP_440673.1_2 Reverse -244 -263 14.4868 0.0986
NP_440673.1_3 Forward -261 -254 12.4288 0.0426
NP_440673.1_3 Reverse -256 -263 12.4288 0.0426
NP_440673.1_3 Forward -305 -298 10.4622 0.139
NP_440673.1_7 Reverse -243 -262 4.42435 0.185
NP_440865.1_9 Forward -269 -250 -6.78538 0.232
NP_441052.1_2 Forward -263 -253 10.4031 0.0285
NP_441052.1_2 Reverse -254 -264 10.4031 0.0285
NP_441052.1_2 Forward -187 -177 -0.708283 0.294
NP_442219.1_9 Forward -262 -253 8.25953 0.0681
NP_442219.1_9 Reverse -255 -264 8.25953 0.0681
NP_440436.1_4 Forward -262 -253 15.9289 0.00508
NP_440436.1_4 Reverse -255 -264 9.24241 0.0871
NP_441884.1_8 Reverse -253 -272 8.84924 0.0541
NP_441884.1_9 Forward -266 -247 -12.4886 0.138
NP_441884.1_9 Reverse -323 -342 -22.8133 0.284
NP_441884.1_9 Forward -268 -249 -23.01 0.284
NP_441884.1_9 Reverse -251 -270 -23.305 0.284
NP_441719.1_4 Forward -262 -255 16.3621 0.0124
NP_441719.1_4 Reverse -255 -262 16.3621 0.0124
NP_441719.1_6 Reverse -237 -256 6.88182 0.269
NP_441733.1_10 Reverse -175 -188 15.3589 0.06
NP_441733.1_10 Forward -266 -253 7.29578 0.156
NP_441004.1_1 Reverse -173 -192 -16.2252 0.283
NP_442813.1_4 Reverse -239 -258 -7.17871 0.299
NP_442366.1_3 Forward -264 -246 -1.16082 0.207
NP_442366.1_5 Reverse -251 -261 14.8275 0.0375
NP_440296.1_10 Forward -266 -247 -13.6686 0.269
NP_441115.1_4 Forward -264 -246 10.5398 0.173
NP_442206.1_10 Reverse -173 -188 4.99478 0.178
NP_442854.1_6 Reverse -254 -273 11.2092 0.189
NP_440328.1_4 Reverse -248 -267 13.8641 0.0413
NP_443054.1_2 Forward -265 -251 9.04604 0.102
NP_441851.1_10 Reverse -253 -263 17.4829 0.0027
NP_441851.1_10 Forward -264 -254 8.53483 0.114
NP_441851.1_10 Reverse -184 -194 4.89658 0.24
NP_442208.1_5 Forward -60 -41 -9.34199 0.293
NP_441668.1_3 Reverse -348 -367 8.45592 0.234
NP_442515.1_1 Reverse -253 -267 4.42448 0.107
NP_442515.1_1 Forward -395 -381 -4.81863 0.298
NP_441683.1_7 Forward -338 -319 -10.9153 0.284
NP_440593.1_3 Reverse -249 -268 -2.0655 0.221
NP_440593.1_3 Forward -121 -102 -6.58872 0.278
NP_442689.1_8 Reverse -4 -21 -4.18939 0.263
NP_441349.1_10 Forward -273 -254 -0.4922 0.0947
NP_441349.1_10 Reverse -32 -51 -1.67217 0.106
NP_440432.1_9 Forward -262 -247 8.73135 0.0427
NP_440432.1_9 Reverse -255 -270 -3.56002 0.183
NP_442843.1_4 Reverse -97 -115 17.5221 0.159
NP_440474.1_8 Reverse -255 -269 8.16044 0.189
NP_440431.1_3 Forward -183 -164 -9.14533 0.241
NP_442450.1_5 Reverse -252 -262 17.3846 0.0267
NP_442168.1_5 Reverse -255 -274 7.57094 0.161
NP_440588.1_2 Reverse -169 -188 0.294447 0.148
NP_440588.1_2 Forward -272 -253 -6.88371 0.294
NP_442006.1_2 Forward -257 -240 10.3636 0.0599
NP_442006.1_2 Forward -275 -258 -6.64766 0.167
NP_442006.1_2 Forward -335 -318 -10.5809 0.197
NP_442006.1_2 Forward -362 -345 -14.3175 0.203
NP_442006.1_2 Forward -256 -239 -17.6607 0.279
NP_442006.1_2 Forward -110 -93 -17.8574 0.283
NP_442006.1_2 Forward -161 -144 -17.9557 0.285
NP_443047.1_7 Reverse -255 -274 5.11266 0.246
NP_442243.1_1 Forward -269 -251 0.411736 0.231
NP_441450.1_3 Reverse -5 -24 6.39016 0.271
NP_441570.1_1 Reverse -254 -272 11.8189 0.00719
NP_441570.1_1 Forward -263 -245 -9.42063 0.137
NP_440078.1_4 Reverse -96 -115 12.3892 0.206
NP_441078.1_4 Forward -263 -254 19.6659 0.0007
NP_441078.1_4 Reverse -254 -263 19.6659 0.0007
NP_442443.1_4 Forward -25 -15 14.7292 0.216
NP_440526.1_3 Forward -262 -251 10.9729 0.0646
NP_440526.1_3 Reverse -255 -266 2.31981 0.267
NP_441432.1_8 Forward -264 -255 16.8143 0.00595
NP_441432.1_8 Reverse -253 -262 8.35786 0.0755
NP_441432.1_8 Reverse -177 -186 4.32629 0.223
NP_441432.1_9 Reverse -6 -19 12.2827 0.217
NP_442320.1_8 Reverse -248 -262 -3.63866 0.126
NP_441732.1_2 Reverse -250 -266 3.30346 0.0141
NP_441732.1_2 Reverse -103 -119 -15.8711 0.163
NP_441732.1_2 Forward -267 -251 -16.2644 0.165
NP_441030.1_6 Reverse -252 -271 19.3015 0.155
NP_442003.1_4 Forward -158 -139 12.9791 0.257
NP_442003.1_4 Forward -262 -243 12.3892 0.27
NP_440685.1_5 Forward -184 -165 9.53756 0.296
NP_440760.1_1 Reverse -254 -273 -10.9153 0.0849
NP_440760.1_1 Forward -263 -244 -14.8485 0.137
NP_442797.1_7 Reverse -246 -264 -0.0791831 0.281
NP_441131.1_10 Reverse -95 -114 17.109 0.142
NP_441945.1_10 Forward -308 -289 10.8159 0.244
NP_440913.1_1 Forward -265 -247 11.7205 0.168
NP_441072.1_2 Forward -267 -248 7.07928 0.259
NP_440713.1_4 Forward -273 -254 15.5357 0.0791
NP_440713.1_4 Reverse -168 -187 6.39097 0.19
NP_442489.1_2 Reverse -287 -306 2.85105 0.254
NP_442489.1_7 Forward -263 -254 20.1576 0.000695
NP_442489.1_7 Reverse -254 -263 20.1576 0.000695
NP_440559.1_1 Forward -262 -253 17.306 0.00658
NP_440559.1_1 Reverse -255 -264 8.65285 0.0586
NP_441659.2_8 Reverse -254 -264 20.9245 0.000805
NP_441659.2_8 Forward -263 -253 19.3512 0.000966
NP_442913.1_10 Reverse -245 -264 6.68596 0.058
NP_442913.1_10 Forward -272 -253 0.884433 0.15
NP_441040.1_2 Reverse -41 -60 -14.4552 0.286
NP_442008.1_2 Forward -118 -99 3.14605 0.262
NP_441800.1_7 Reverse -108 -126 -3.6191 0.279
NP_440315.1_3 Forward -60 -41 14.1591 0.294
NP_440779.1_5 Forward -263 -246 4.26707 0.0558
NP_442346.1_2 Forward -274 -255 17.7974 0.149
NP_442346.1_5 Reverse -253 -263 17.9746 0.00128
NP_442346.1_5 Forward -264 -254 16.303 0.00248
NP_440352.1_5 Forward -254 -235 12.7531 0.223
NP_440352.1_5 Forward -339 -320 12.2664 0.229
NP_440545.1_3 Reverse -250 -267 14.8868 0.0141
NP_440545.1_3 Forward -267 -250 11.3469 0.0266
NP_441629.1_3 Forward -174 -155 -1.47628 0.263
NP_441786.1_10 Forward -272 -253 7.27595 0.268
NP_440486.1_6 Reverse -165 -184 5.40766 0.297
NP_440459.1_1 Forward -62 -43 15.6341 0.271
NP_440459.1_2 Reverse -245 -262 11.8386 0.166
NP_440459.1_2 Reverse -176 -193 7.41366 0.291
NP_442828.1_7 Forward -339 -320 -4.91709 0.276
NP_441888.1_7 Forward -166 -152 2.35953 0.225
NP_440449.1_6 Reverse -246 -264 15.0643 0.0907
NP_440449.1_6 Forward -195 -177 6.99141 0.236
NP_440449.1_6 Forward -271 -253 5.53247 0.276
NP_441948.1_4 Reverse -247 -265 7.00065 0.063
NP_440170.1_6 Forward -268 -249 15.9291 0.157
NP_441833.1_4 Forward -262 -255 15.9687 0.0124
NP_441833.1_4 Reverse -255 -262 15.9687 0.0124
NP_442799.1_2 Reverse -239 -258 0.294447 0.276
NP_442162.1_9 Forward -262 -255 16.2637 0.0124
NP_442162.1_9 Reverse -255 -262 16.2637 0.0124
NP_440671.1_4 Forward -193 -179 5.50613 0.281
NP_442140.1_3 Forward -262 -252 13.5497 0.0542
NP_442140.1_3 Reverse -255 -265 7.94484 0.124
NP_441696.1_6 Reverse -255 -274 0.58944 0.294
NP_440875.1_9 Reverse -256 -266 14.5042 0.0411
NP_440875.1_9 Forward -185 -175 13.7256 0.0616
NP_441813.1_5 Reverse -252 -262 8.82982 0.0367
NP_441813.1_5 Forward -265 -255 8.73149 0.0367
NP_441813.1_5 Forward -189 -179 4.20827 0.163
NP_440594.1_8 Reverse -255 -268 9.36014 0.186
NP_440590.1_4 Forward -262 -249 10.8357 0.0239
NP_440590.1_4 Reverse -255 -268 3.16588 0.0756
NP_440590.1_4 Reverse -179 -192 1.69091 0.115
NP_440567.1_1 Reverse -255 -269 14.2576 0.0187
NP_440567.1_1 Forward -262 -248 12.9793 0.0213
NP_440567.1_1 Forward -186 -172 -0.0987402 0.264
NP_442497.1_10 Forward -262 -253 19.8626 0.00532
NP_442497.1_10 Reverse -255 -264 17.601 0.00813
NP_440821.1_4 Reverse -252 -262 10.9931 0.0146
NP_440821.1_4 Forward -265 -255 10.7964 0.0146
NP_441239.1_9 Forward -265 -253 18.4269 0.0114
NP_441239.1_9 Forward -184 -172 16.7552 0.0157
NP_441239.1_9 Reverse -252 -264 10.7571 0.0723
NP_442691.1_2 Forward -168 -149 11.2092 0.127
NP_442568.1_8 Forward -18 -4 8.25939 0.289
NP_441727.1_3 Reverse -247 -266 4.42435 0.262
NP_440400.1_1 Forward -191 -172 -1.37794 0.285
NP_441892.1_1 Reverse -245 -262 7.31533 0.0915
NP_441892.1_1 Forward -272 -255 3.97208 0.117
NP_440665.1_1 Reverse -286 -305 -12.8819 0.254
NP_442325.1_6 Forward -191 -172 -1.86883 0.282
NP_442193.1_8 Forward -190 -171 13.9616 0.211
NP_442270.1_9 Reverse -243 -262 10.4225 0.0824
NP_441017.1_8 Forward -266 -251 10.993 0.188
NP_441874.1_1 Reverse -168 -182 15.4376 0.165
NP_441526.1_6 Reverse -170 -189 5.89931 0.265
NP_440354.1_7 Forward -269 -251 8.57394 0.236
NP_442138.1_9 Forward -200 -181 15.1416 0.202
NP_442052.1_8 Reverse -252 -262 12.7631 0.253
NP_440546.1_4 Reverse -254 -264 13.5365 0.0459
NP_440546.1_4 Forward -263 -253 12.8578 0.0572
NP_440546.1_4 Reverse -178 -188 10.7247 0.108
NP_440546.1_4 Forward -256 -246 7.33119 0.246
NP_441230.1_5 Forward -268 -249 -0.0988766 0.277
NP_440675.1_1 Forward -353 -334 3.34271 0.252
NP_440462.1_6 Forward -265 -255 19.4496 0.00371
NP_440462.1_6 Reverse -176 -186 8.1415 0.0699
NP_440462.1_6 Forward -189 -179 1.65166 0.294
NP_440462.1_6 Reverse -252 -262 1.455 0.294
NP_442611.1_1 Reverse -173 -192 -1.86883 0.283
NP_440868.1_4 Forward -267 -255 17.0502 0.0124
NP_440868.1_4 Reverse -174 -186 2.20226 0.161
NP_441474.1_1 Reverse -258 -277 1.37531 0.247
NP_441474.1_1 Forward -192 -173 -1.37794 0.261
NP_441474.1_1 Forward -176 -157 -2.26292 0.273
NP_441474.1_1 Reverse -325 -344 -3.44288 0.299
NP_442402.1_4 Reverse -332 -351 6.48849 0.131
NP_441848.1_7 Reverse -369 -388 0.392004 0.228
NP_442258.1_2 Reverse -242 -261 -4.91709 0.273
NP_440696.1_3 Reverse -254 -272 8.96727 0.149
NP_440696.1_3 Reverse -185 -203 -2.14413 0.274
NP_440696.1_3 Forward -267 -249 -4.20908 0.298
NP_442023.1_3 Forward -34 -15 12.29 0.261
NP_442039.1_4 Forward -262 -255 15.1821 0.0124
NP_442039.1_4 Reverse -255 -262 15.1821 0.0124
NP_441811.1_8 Forward -269 -255 9.43936 0.227
NP_441811.1_8 Reverse -203 -217 6.78443 0.263
NP_442829.1_2 Forward -19 -3 10.6536 0.287
NP_440825.1_7 Forward -262 -252 11.8361 0.2
NP_442837.1_3 Forward -262 -255 15.7721 0.0124
NP_442837.1_3 Reverse -255 -262 15.7721 0.0124
NP_442053.1_1 Forward -263 -254 18.3876 0.0007
NP_442053.1_1 Reverse -254 -263 18.3876 0.0007
NP_442053.1_1 Forward -187 -178 4.71961 0.228
NP_442053.1_1 Reverse -178 -187 4.52295 0.242
NP_440505.1_3 Forward -265 -255 15.418 0.0114
NP_440505.1_3 Reverse -176 -186 13.0581 0.0387
NP_441203.1_1 Forward -262 -243 -19.7651 0.297
NP_442532.1_7 Reverse -254 -268 6.48943 0.171
NP_441408.2_7 Forward -265 -246 0.294447 0.228
NP_440914.1_1 Reverse -254 -264 16.3248 0.00196
NP_440914.1_1 Forward -187 -177 11.2501 0.103
NP_440914.1_1 Forward -263 -253 8.51751 0.186
NP_441011.1_8 Reverse -255 -264 16.6177 0.00602
NP_441011.1_8 Forward -262 -253 14.356 0.0249
NP_442533.1_1 Reverse -163 -182 -17.3068 0.285
NP_442533.1_6 Forward -263 -254 17.2076 0.00137
NP_442533.1_6 Reverse -254 -263 17.2076 0.00137
NP_442533.1_6 Forward -307 -298 9.83282 0.06
NP_442533.1_6 Forward -187 -178 3.7363 0.204
NP_442533.1_6 Reverse -110 -119 2.94966 0.232
NP_442533.1_6 Forward -160 -151 1.96635 0.28
NP_442232.1_3 Reverse -170 -189 -4.22878 0.163
NP_442232.1_3 Forward -271 -252 -4.32711 0.163
NP_442322.1_4 Forward -190 -173 -0.748498 0.225
NP_442322.1_4 Forward -174 -157 -9.40158 0.295
NP_442229.1_1 Forward -265 -251 17.2068 0.0765
NP_441482.1_7 Forward -269 -255 -0.983719 0.0612
NP_441482.1_7 Reverse -248 -262 -8.45687 0.193
NP_439944.1_9 Reverse -255 -265 17.7779 0.00341
NP_439944.1_9 Forward -262 -252 8.82982 0.101
NP_441028.1_6 Reverse -322 -332 8.23937 0.216
NP_441028.1_6 Reverse -53 -63 7.45273 0.229
NP_441028.1_6 Reverse -330 -340 5.78111 0.243
NP_440116.1_8 Forward -262 -243 1.0811 0.0926
NP_441527.1_4 Forward -25 -6 -8.83343 0.251
NP_441527.1_4 Forward -28 -9 -12.1756 0.285
NP_441527.1_7 Reverse -8 -27 7.37347 0.29
NP_440115.1_6 Forward -266 -256 16.008 0.0325
NP_440115.1_6 Reverse -175 -185 7.25653 0.152
NP_440007.1_9 Reverse -250 -264 4.22782 0.267
NP_440007.1_9 Forward -272 -258 2.94952 0.277
NP_441680.1_4 Forward -131 -112 -0.885524 0.256
NP_441347.1_5 Reverse -172 -186 9.73373 0.269
NP_441059.1_10 Forward -252 -239 12.6056 0.226
NP_441602.1_3 Forward -268 -249 -0.983855 0.226
NP_441170.1_4 Reverse -142 -160 7.4923 0.194
NP_441972.1_5 Forward -262 -243 3.53937 0.117
NP_441972.1_5 Reverse -255 -274 -3.93378 0.201
NP_441106.1_1 Forward -264 -255 18.486 0.0028
NP_441106.1_1 Reverse -253 -262 9.73449 0.0311
NP_439903.1_6 Forward -266 -247 3.14526 0.213
NP_442588.1_6 Reverse -154 -173 7.7676 0.173
NP_001035870.1_10 Forward -154 -135 19.9497 0.0795
NP_442306.1_10 Forward -268 -249 -21.4367 0.27
NP_441286.1_1 Forward -264 -252 6.03717 0.0258
NP_441286.1_1 Reverse -253 -265 5.25052 0.0259
NP_440670.1_8 Forward -263 -254 18.3876 0.000699
NP_440670.1_8 Reverse -254 -263 18.3876 0.000699
NP_440886.1_7 Forward -188 -178 13.8442 0.0642
NP_440886.1_7 Forward -264 -254 8.04271 0.0805
NP_440886.1_7 Reverse -253 -263 8.04271 0.0805
NP_440828.1_1 Reverse -256 -275 8.84842 0.197
NP_442614.1_2 Forward -274 -260 7.27608 0.275
NP_442614.1_2 Forward -244 -230 7.07942 0.275
NP_442614.1_2 Forward -263 -249 5.99778 0.295
NP_440767.1_2 Forward -346 -327 -5.01543 0.297
NP_442072.1_9 Reverse -253 -271 5.91901 0.0153
NP_442072.1_9 Reverse -177 -195 -5.68405 0.067
NP_442072.1_9 Reverse -172 -190 -12.8622 0.0926
NP_442072.1_9 Forward -264 -246 -21.417 0.208
NP_441808.1_8 Forward -119 -100 6.98095 0.283
NP_440907.2_8 Reverse -255 -265 19.1541 0.00362
NP_440907.2_8 Forward -186 -176 16.4008 0.0139
NP_440907.2_8 Forward -262 -252 16.2041 0.0161
NP_440907.2_8 Reverse -341 -351 5.48612 0.198
NP_441021.1_1 Forward -262 -243 -6.68705 0.18
NP_441021.1_1 Reverse -255 -274 -8.06369 0.193
NP_441021.1_8 Reverse -249 -267 5.52568 0.215
NP_441021.1_8 Reverse -180 -198 2.0841 0.253
NP_440841.1_4 Forward -252 -233 -9.63698 0.26
NP_441463.1_3 Forward -273 -254 2.85105 0.111
NP_441463.1_3 Reverse -375 -394 -2.85214 0.162
NP_441626.1_2 Forward -262 -255 15.7721 0.0124
NP_441626.1_2 Reverse -255 -262 15.7721 0.0124
NP_442365.1_7 Reverse -250 -269 -3.44213 0.22
NP_441460.1_2 Reverse -238 -251 13.195 0.289
NP_442794.1_1 Reverse -250 -262 2.98891 0.286
NP_442615.1_1 Reverse -245 -263 5.62401 0.0376
NP_442615.1_1 Reverse -169 -187 4.24738 0.048
NP_442615.1_1 Reverse -176 -194 -5.88071 0.227
NP_441962.1_4 Forward -268 -249 -10.6203 0.232
NP_440387.1_1 Reverse -254 -270 23.1663 0.00163
NP_440387.1_1 Reverse -340 -356 -6.33298 0.279
NP_441431.1_2 Forward -266 -252 17.2068 0.0303
NP_441431.1_2 Reverse -251 -265 9.6354 0.181
NP_441488.1_8 Reverse -249 -263 10.6187 0.146
NP_441836.1_2 Forward -373 -354 7.7676 0.104
NP_441993.1_1 Reverse -254 -273 6.62464 0.178
NP_440114.1_10 Reverse -254 -268 17.4042 0.0104
NP_440114.1_10 Forward -263 -249 8.94771 0.19
NP_440114.1_10 Reverse -298 -312 5.89945 0.292
NP_442437.1_8 Forward -274 -255 6.98095 0.242
NP_442698.1_10 Forward -252 -233 -0.590531 0.297
NP_441510.2_7 Reverse -292 -306 13.6669 0.28
NP_441510.2_7 Forward -193 -179 9.93039 0.281
NP_440287.1_5 Reverse -320 -339 9.34008 0.286
NP_441272.1_4 Reverse -169 -188 2.85105 0.233
NP_440293.1_3 Reverse -144 -163 -3.44213 0.244
NP_440766.1_4 Forward -267 -253 4.12949 0.135
NP_440766.1_4 Reverse -174 -188 1.57289 0.226
NP_439988.1_3 Reverse -261 -275 15.0442 0.185
NP_441237.1_9 Forward -262 -252 17.188 0.00445
NP_442743.1_1 Forward -185 -166 4.22689 0.296
NP_442743.1_4 Forward -262 -243 -0.000545616 0.174
NP_439910.1_2 Forward -239 -222 -14.3175 0.183
NP_439910.1_2 Forward -195 -178 -22.0856 0.207
NP_440457.1_1 Forward -267 -255 9.87208 0.092
NP_440457.1_1 Reverse -174 -186 8.9871 0.0988
NP_440457.1_1 Reverse -250 -262 8.10212 0.101
NP_440798.1_6 Reverse -255 -268 10.4424 0.0754
NP_440798.1_6 Forward -262 -249 5.23083 0.14
NP_441984.1_3 Forward -267 -249 12.4089 0.167
NP_441332.1_6 Forward -160 -150 12.4212 0.23
NP_442509.1_9 Forward -263 -253 17.3841 0.00128
NP_442509.1_9 Reverse -178 -188 10.4026 0.179
NP_442509.1_9 Reverse -254 -264 8.04271 0.192
NP_442514.1_5 Reverse -239 -258 6.09517 0.134
NP_441159.1_4 Forward -274 -255 4.22769 0.254
NP_440554.1_4 Reverse -255 -265 15.418 0.0199
NP_440554.1_4 Forward -186 -176 2.63497 0.258
NP_441885.1_5 Forward -263 -253 11.3864 0.00668
NP_441885.1_5 Reverse -254 -264 11.3864 0.00668
NP_442703.1_4 Forward -187 -168 2.26028 0.283
NP_442341.1_7 Forward -264 -250 8.35772 0.0881
NP_442341.1_9 Forward -265 -251 11.602 0.122
NP_442341.1_9 Forward -258 -244 4.91554 0.287
NP_442395.2_4 Forward -188 -169 10.6184 0.096
NP_440191.1_4 Reverse -322 -332 13.342 0.282
NP_443000.1_7 Forward -265 -255 10.7964 0.0345
NP_443000.1_7 Reverse -252 -262 2.04498 0.226
NP_441842.1_10 Reverse -247 -261 16.9125 0.0273
NP_440275.1_3 Forward -265 -255 18.6629 0.0082
NP_440275.1_3 Reverse -252 -262 9.91146 0.046
NP_440275.1_3 Reverse -176 -186 6.37155 0.111
NP_440091.1_1 Forward -267 -255 10.2654 0.0498
NP_441307.1_4 Reverse -176 -195 -1.18052 0.278
NP_442354.1_2 Forward -352 -333 8.16093 0.257
NP_442451.1_2 Reverse -246 -265 -9.63698 0.259
NP_439962.1_4 Forward -161 -142 -6.88371 0.285
NP_439962.1_4 Reverse -109 -128 -6.98204 0.286
NP_440175.1_7 Reverse -57 -75 9.36312 0.28
NP_442495.1_4 Reverse -219 -229 12.0747 0.25
NP_440149.1_8 Forward -263 -244 -5.11376 0.219
NP_440149.1_8 Reverse -254 -273 -6.58872 0.255
NP_442373.1_2 Reverse -170 -189 -11.7019 0.297
NP_440216.1_1 Forward -263 -249 8.35772 0.0061
NP_440216.1_1 Reverse -254 -268 7.57108 0.00935
NP_440216.1_1 Reverse -110 -124 -11.6035 0.203
NP_440678.1_7 Forward -20 -1 17.994 0.264
NP_440172.1_1 Reverse -254 -264 17.5813 0.00421
NP_440172.1_1 Forward -263 -253 16.303 0.00854
NP_442015.1_10 Reverse -250 -263 12.2123 0.0372
NP_441226.1_7 Forward -262 -255 14.4934 0.0123
NP_441226.1_7 Reverse -255 -262 14.4934 0.0123
NP_441226.1_7 Forward -306 -299 8.59356 0.197
NP_441226.1_7 Forward -186 -179 8.59356 0.197
NP_441226.1_7 Forward -193 -186 8.29857 0.205
NP_441111.1_7 Forward -262 -254 18.7023 0.00294
NP_441111.1_7 Reverse -255 -263 18.7023 0.00294
NP_442379.1_10 Forward -270 -253 17.9351 0.0226
NP_441766.1_2 Forward -263 -254 17.5026 0.00297
NP_441766.1_2 Reverse -254 -263 17.5026 0.00297
NP_441766.1_2 Forward -187 -178 5.01461 0.148
NP_441766.1_2 Forward -307 -298 1.27803 0.296
NP_440416.1_9 Reverse -247 -266 -15.2418 0.187
NP_440416.1_9 Forward -133 -114 -19.6667 0.276
NP_440416.1_9 Reverse -99 -118 -19.8634 0.279
NP_440416.1_9 Reverse -240 -259 -20.5517 0.286
NP_440416.1_9 Reverse -246 -265 -21.24 0.293
NP_442564.1_10 Forward -182 -168 11.6026 0.245
NP_440261.1_5 Forward -262 -249 -0.669033 0.0655
NP_440261.1_5 Reverse -255 -268 -2.83231 0.0932
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAACAGCCAATAGCAATATCAAAGAATTGGGTAACCATGCCCAGAAGTTAGTGGATACCCTGGTGGAAAGGGGGGAAATGAATGCGGAAGAAGCCCGTCGCTATGTGGATGAATTAATTAGAGAGGCCCAAGGGGAGGCGATCGCCCATGGGGAAGGGGAAAATAAACAGCCCCGGCGCATTGAAATCATCACCGATGAAGAGGAAGCCAACCCCGATCCCCTCGCCCAAAAAACTCCTGCCCAGTCCCAAACGGAGGACGTGGAAGCCCTACGACGACAGGTGGCGGCCCTCCAGGCAGAATTGCAACGTTTGAACCGTCAACCCTAACCTAACCATAGGGGAAACCGTCTACCGCAAGTTGTCAACACTGCAAATAGCAAAAAATAGCAAAACAGTT

CDS

ATGGAAGATTGGGAGAAAAACCTCTGGTTAGCGGTGGAAACCTTGACCACAGCGGTGGAGACTTGGGTGGAAGACATGGAGAACGCCCTAGGGGAAGCAGCCGAAACCATCGAAGAGGAATTGGGCACCGAACTGCAATGGTTCTGGCAGGAATGGTCCACCTTCTGGGAAGACTTGTCAGACTTTGACGGGGACTTAAGCGACCTGGGGGAATTTGGCGATCGCCAGGGCCGGGAAGGACGGAACAATCAAACGGATGATCGAGGCTATTCCTCCCTGGTGCCCTGGTCTTCCCTGGACGGGGACTTTGGTCTTAATCCCCATCTGCCGGCCAACGCCAATCATCAACCGGCTTGCCAAGGTTGTCAGCATTACCATGGCTATGTGTACAACGGGCAACTGTTGGTGTGTGCCATGCATCCCTACGGTTGGGAAACGGAACAATGTCCAGACTGGCAAGGCCCCAATCCCAATTAA

Protein

MEDWEKNLWLAVETLTTAVETWVEDMENALGEAAETIEEELGTELQWFWQEWSTFWEDLSDFDGDLSDLGEFGDRQGREGRNNQTDDRGYSSLVPWSSLDGDFGLNPHLPANANHQPACQGCQHYHGYVYNGQLLVCAMHPYGWETEQCPDWQGPNPN