Your browser is old and dusty. Try Google Chrome!

Details for slr0444

ORF slr0444
Accession NP_441799.1
Symbol aroA
Category Aromatic amino acid family
Definition 3-phosphoshikimate 1-carboxyvinyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -154 -147 14.6904 0.0123
NP_440795.1_7 Reverse -147 -154 14.6904 0.0123
NP_441418.1_6 Forward -344 -325 -12.3902 0.0643
NP_441418.1_6 Forward -331 -312 -22.8133 0.186
NP_441418.1_6 Forward -347 -328 -30.7781 0.296
NP_442291.1_5 Forward -156 -140 -4.66135 0.281
NP_441453.1_1 Forward -162 -144 3.06666 0.278
NP_441453.1_4 Reverse -146 -154 16.539 0.00633
NP_441453.1_4 Forward -155 -147 16.539 0.00633
NP_441453.1_4 Forward -344 -336 3.85433 0.284
NP_441453.1_7 Forward -290 -283 12.1338 0.295
NP_442151.1_6 Forward -155 -141 7.9644 0.184
NP_442151.1_6 Reverse -146 -160 7.47274 0.197
NP_441818.1_1 Forward -154 -143 9.20294 0.25
NP_441818.1_9 Reverse -230 -249 -4.72043 0.242
NP_440226.1_1 Forward -155 -136 17.6007 0.0184
NP_440226.1_1 Reverse -146 -165 10.5209 0.0617
NP_441630.1_3 Forward -352 -333 2.45773 0.223
NP_442287.1_3 Reverse -138 -155 12.4278 0.3
NP_442655.1_1 Reverse -141 -160 0.196116 0.24
NP_441721.1_6 Reverse -356 -375 7.7676 0.281
NP_442173.1_1 Forward -154 -146 15.4574 0.00633
NP_442173.1_1 Reverse -147 -155 15.4574 0.00633
NP_442752.1_4 Forward -155 -148 13.8055 0.0199
NP_442752.1_4 Reverse -146 -153 13.8055 0.0199
NP_443027.1_4 Reverse -144 -154 13.2547 0.0521
NP_443027.1_4 Forward -346 -336 7.74818 0.235
NP_443027.1_4 Forward -157 -147 7.25653 0.24
NP_442975.1_10 Reverse -142 -156 12.487 0.0477
NP_442975.1_10 Reverse -331 -345 2.75226 0.269
NP_442975.1_10 Forward -159 -145 2.06395 0.284
NP_440784.1_7 Forward -154 -147 15.9687 0.0123
NP_440784.1_7 Reverse -147 -154 15.9687 0.0123
NP_442909.1_7 Reverse -242 -256 8.25877 0.184
NP_441934.1_8 Forward -116 -97 14.1591 0.222
NP_441250.1_3 Reverse -62 -81 3.34271 0.266
NP_442062.1_8 Reverse -146 -156 10.3048 0.0493
NP_442062.1_8 Forward -155 -145 10.3048 0.0493
NP_442062.1_8 Forward -344 -334 5.38824 0.172
NP_440304.1_4 Forward -157 -147 10.8948 0.051
NP_440304.1_4 Reverse -144 -154 10.8948 0.051
NP_442242.1_4 Forward -154 -147 14.3954 0.0124
NP_442242.1_4 Reverse -147 -154 14.3954 0.0124
NP_440916.1_1 Forward -15 -1 8.06273 0.28
NP_439918.1_2 Forward -186 -167 1.0811 0.217
NP_439918.1_2 Forward -181 -162 -2.95047 0.251
NP_441619.1_9 Reverse -115 -134 3.44104 0.269
NP_441208.1_9 Forward -158 -144 16.9125 0.0647
NP_441594.1_6 Reverse -15 -34 7.47261 0.172
NP_440370.1_10 Forward -164 -145 10.0292 0.211
NP_442375.1_5 Reverse -316 -330 12.782 0.289
NP_442110.1_7 Reverse -329 -343 5.60446 0.168
NP_442110.1_7 Forward -155 -141 1.86788 0.222
NP_440856.1_4 Reverse -139 -158 -0.983855 0.189
NP_441083.1_5 Forward -155 -145 11.2881 0.0159
NP_441083.1_5 Reverse -146 -156 11.2881 0.0159
NP_442827.1_8 Reverse -327 -346 4.12856 0.139
NP_441738.1_2 Forward -153 -146 15.28 0.0102
NP_441738.1_2 Reverse -148 -155 15.28 0.0102
NP_441558.1_5 Reverse -144 -163 10.2259 0.102
NP_440209.1_1 Reverse -146 -154 18.1123 0.00295
NP_440209.1_1 Forward -155 -147 18.1123 0.00295
NP_440209.1_1 Reverse -335 -343 2.1827 0.254
NP_442889.1_8 Reverse -143 -157 10.8154 0.0775
NP_440447.1_6 Forward -163 -145 3.16574 0.207
NP_440056.1_1 Reverse -161 -180 11.1109 0.191
NP_441713.1_1 Forward -161 -142 1.76941 0.0651
NP_441713.1_1 Reverse -140 -159 -13.6686 0.257
NP_440178.1_7 Forward -156 -137 -22.42 0.265
NP_442570.1_3 Forward -287 -268 -5.9004 0.25
NP_442570.1_3 Forward -331 -312 -8.94866 0.294
NP_441716.1_1 Reverse -146 -160 4.22782 0.256
NP_441598.1_3 Reverse -167 -186 15.979 0.147
NP_442111.1_4 Reverse -145 -159 15.8309 0.0194
NP_441163.1_1 Reverse -327 -344 6.42963 0.257
NP_441163.1_9 Reverse -326 -345 15.7324 0.206
NP_440906.1_5 Forward -154 -147 15.8704 0.0124
NP_440906.1_5 Reverse -147 -154 15.8704 0.0124
NP_440012.1_6 Reverse -230 -249 5.89931 0.299
NP_440747.1_10 Forward -158 -146 15.2803 0.0019
NP_440747.1_10 Reverse -143 -155 7.4138 0.00422
NP_441130.1_10 Reverse -333 -347 7.47274 0.158
NP_442973.1_5 Reverse -137 -156 13.5691 0.167
NP_441486.1_1 Reverse -143 -157 -2.16369 0.175
NP_442634.1_2 Forward -161 -142 4.71934 0.265
NP_442634.1_2 Forward -302 -283 0.687771 0.287
NP_442634.1_4 Reverse -144 -158 17.3058 0.01
NP_442634.1_4 Forward -157 -143 -1.96703 0.149
NP_441265.1_3 Forward -161 -147 4.71948 0.181
NP_441014.1_8 Reverse -56 -75 -9.44032 0.295
NP_442848.1_1 Forward -256 -242 -0.688726 0.263
NP_442848.1_1 Reverse -329 -343 -4.62196 0.298
NP_442848.1_9 Forward -277 -258 2.45773 0.252
NP_443018.1_3 Forward -154 -147 14.8871 0.0123
NP_443018.1_3 Reverse -147 -154 14.8871 0.0123
NP_443018.1_3 Forward -343 -336 11.3472 0.0846
NP_443018.1_3 Reverse -205 -212 7.11894 0.16
NP_443018.1_3 Reverse -336 -343 4.16902 0.278
NP_441316.1_7 Reverse -333 -348 4.79811 0.121
NP_441316.1_7 Reverse -144 -159 2.43817 0.154
NP_441634.1_8 Reverse -224 -238 1.76955 0.181
NP_441634.1_8 Forward -171 -157 -1.96703 0.295
NP_441182.1_5 Forward -331 -312 8.16093 0.258
NP_440376.1_1 Forward -155 -146 19.4693 0.000692
NP_440376.1_1 Reverse -146 -155 19.4693 0.000692
NP_440376.1_1 Reverse -313 -322 0.393051 0.279
NP_441588.1_4 Reverse -148 -158 7.05986 0.178
NP_441588.1_4 Forward -153 -143 6.76487 0.185
NP_442687.1_7 Reverse -121 -131 10.6981 0.0994
NP_442687.1_7 Forward -156 -146 9.02648 0.0994
NP_442687.1_7 Reverse -145 -155 9.02648 0.0994
NP_442485.1_3 Reverse -224 -243 -3.73712 0.277
NP_440642.1_10 Reverse -68 -82 4.03056 0.263
NP_442296.1_9 Reverse -332 -351 -2.16383 0.219
NP_441763.1_10 Reverse -167 -186 5.60352 0.284
NP_440360.1_10 Reverse -337 -351 5.60446 0.227
NP_442658.1_1 Reverse -144 -154 14.2375 0.0237
NP_442658.1_1 Forward -157 -147 13.0576 0.04
NP_442198.1_3 Forward -356 -337 5.11266 0.26
NP_442937.1_5 Forward -69 -50 9.53756 0.187
NP_441958.1_5 Forward -156 -146 21.2195 0.000805
NP_441958.1_5 Reverse -145 -155 21.2195 0.000805
NP_441127.1_1 Forward -57 -43 8.84938 0.284
NP_440203.1_5 Reverse -328 -338 12.4676 0.147
NP_440203.1_5 Reverse -149 -159 9.81266 0.245
NP_439905.1_1 Reverse -221 -234 12.9006 0.178
NP_439905.1_1 Reverse -336 -349 8.37742 0.234
NP_440984.1_7 Reverse -141 -155 15.7325 0.0488
NP_440984.1_7 Forward -349 -335 10.4227 0.126
NP_440984.1_7 Reverse -224 -238 5.01447 0.276
NP_440984.1_7 Reverse -50 -64 4.52282 0.299
NP_439990.1_5 Forward -160 -147 8.08242 0.181
NP_442911.1_2 Forward -339 -320 -6.88371 0.195
NP_442911.1_2 Forward -165 -146 -11.1119 0.299
NP_441580.1_6 Reverse -167 -186 -3.73712 0.235
NP_440153.1_5 Forward -154 -140 4.91614 0.193
NP_442064.1_1 Forward -160 -141 -11.2103 0.259
NP_443055.1_6 Forward -169 -151 -1.45654 0.279
NP_440993.1_2 Reverse -141 -157 2.51681 0.265
NP_440993.1_3 Reverse -136 -155 -1.47628 0.282
NP_440993.1_4 Reverse -110 -127 1.8088 0.3
NP_440602.1_2 Forward -160 -141 2.45773 0.263
NP_442210.1_9 Forward -185 -167 13.8838 0.209
NP_441294.1_7 Reverse -142 -156 12.9942 0.0767
NP_442438.1_10 Reverse -16 -30 -0.393733 0.259
NP_441000.1_6 Forward -156 -142 5.1128 0.0933
NP_440605.1_4 Forward -165 -146 18.5218 0.0577
NP_440484.1_3 Reverse -144 -158 10.1277 0.242
NP_440147.1_4 Forward -157 -144 19.9805 0.00251
NP_440147.1_4 Reverse -144 -157 9.75405 0.0371
NP_441550.1_8 Reverse -144 -154 15.8108 0.0132
NP_441550.1_8 Forward -157 -147 15.3192 0.0132
NP_441550.1_8 Forward -346 -336 5.09279 0.267
NP_441916.1_7 Forward -155 -145 18.9579 0.00144
NP_441916.1_7 Reverse -146 -156 18.9579 0.00144
NP_441916.1_7 Reverse -335 -345 4.69992 0.163
NP_441916.1_7 Reverse -122 -132 2.53664 0.25
NP_440206.1_4 Reverse -330 -349 2.26028 0.289
NP_440206.1_9 Reverse -372 -391 12.0942 0.272
NP_440465.1_10 Forward -347 -328 -1.47551 0.295
NP_441041.1_4 Reverse -329 -348 -12.2919 0.262
NP_441041.1_4 Reverse -146 -165 -13.0786 0.28
NP_441041.1_7 Reverse -143 -155 16.6495 0.0131
NP_441041.1_7 Forward -158 -146 14.4144 0.0348
NP_442004.1_6 Reverse -146 -160 3.44117 0.24
NP_442004.1_6 Reverse -335 -349 1.17956 0.296
NP_441725.1_5 Forward -154 -144 1.94665 0.115
NP_441725.1_5 Reverse -147 -157 1.94665 0.115
NP_439966.1_7 Reverse -144 -154 14.3359 0.0203
NP_439966.1_7 Reverse -333 -343 7.15773 0.154
NP_439966.1_7 Forward -157 -147 6.27276 0.185
NP_440736.1_3 Reverse -144 -163 -0.39387 0.282
NP_442941.1_3 Forward -154 -144 19.2529 0.00262
NP_442941.1_3 Reverse -147 -157 11.0914 0.0116
NP_440289.1_2 Reverse -143 -156 5.91914 0.0605
NP_440260.1_8 Reverse -232 -250 3.16574 0.174
NP_440260.1_8 Forward -164 -146 -5.58572 0.275
NP_441514.1_1 Forward -74 -64 13.2946 0.299
NP_442281.1_1 Reverse -141 -155 16.8135 0.00698
NP_442281.1_1 Reverse -315 -329 4.03056 0.21
NP_442281.1_1 Forward -160 -146 1.5723 0.296
NP_441334.1_7 Reverse -144 -163 -12.9802 0.181
NP_440177.1_9 Forward -72 -53 14.2574 0.213
NP_440647.1_9 Reverse -144 -162 2.37909 0.295
NP_440498.1_1 Forward -164 -146 6.60732 0.0856
NP_442982.1_5 Reverse -136 -155 -1.7705 0.269
NP_442982.1_5 Forward -165 -146 -2.75381 0.289
NP_443030.1_4 Reverse -313 -332 -7.4737 0.295
NP_441644.1_6 Forward -155 -145 19.0557 0.000803
NP_441644.1_6 Reverse -146 -156 19.0557 0.000803
NP_441644.1_6 Reverse -335 -345 5.78111 0.176
NP_441644.1_6 Forward -322 -312 3.71617 0.267
NP_442215.1_2 Forward -331 -315 1.33684 0.136
NP_442215.1_2 Forward -122 -106 -7.41462 0.294
NP_440253.1_2 Forward -155 -137 -2.24246 0.262
NP_440929.1_8 Forward -155 -146 19.2726 0.000701
NP_440929.1_8 Reverse -146 -155 19.2726 0.000701
NP_442933.1_10 Forward -155 -146 17.601 0.00325
NP_442933.1_10 Reverse -146 -155 17.601 0.00325
NP_441751.2_8 Reverse -147 -161 7.07942 0.0341
NP_441751.2_8 Forward -154 -140 -4.52363 0.174
NP_442554.1_8 Forward -154 -144 17.2863 0.00543
NP_442554.1_8 Reverse -147 -157 16.4013 0.0065
NP_442554.1_8 Reverse -336 -346 8.23984 0.0776
NP_441762.1_7 Reverse -145 -157 0.432302 0.0747
NP_441762.1_7 Forward -156 -144 -6.74586 0.284
NP_442142.1_4 Forward -158 -145 12.2117 0.0464
NP_442142.1_4 Reverse -143 -156 12.2117 0.0464
NP_442142.1_4 Reverse -157 -170 3.55864 0.251
NP_442292.1_1 Forward -154 -145 17.5026 0.00435
NP_442292.1_1 Reverse -147 -156 17.5026 0.00435
NP_442292.1_5 Forward -333 -314 0.58944 0.257
NP_442476.1_6 Forward -255 -241 0.589577 0.252
NP_440421.1_1 Reverse -37 -51 13.4709 0.297
NP_443009.1_5 Reverse -145 -156 15.7911 0.0107
NP_443009.1_5 Forward -156 -145 15.7911 0.0107
NP_442301.1_2 Reverse -281 -300 3.9319 0.284
NP_441715.1_4 Forward -154 -144 16.7946 0.0106
NP_441715.1_4 Reverse -147 -157 7.35486 0.108
NP_440158.1_8 Reverse -227 -246 12.9791 0.222
NP_441198.1_8 Forward -157 -147 12.783 0.116
NP_440379.1_5 Forward -184 -165 -10.227 0.276
NP_441468.1_1 Forward -154 -147 15.8704 0.0124
NP_441468.1_1 Reverse -147 -154 15.8704 0.0124
NP_441468.1_1 Reverse -336 -343 3.97235 0.277
NP_441020.2_7 Reverse -167 -186 11.5033 0.22
NP_441015.1_10 Forward -349 -330 -4.42544 0.203
NP_441015.1_10 Forward -75 -56 -7.57203 0.269
NP_441673.1_1 Forward -155 -146 20.8459 0.000698
NP_441673.1_1 Reverse -146 -155 20.8459 0.000698
NP_441826.1_2 Reverse -329 -343 -4.4253 0.296
NP_441330.1_1 Reverse -141 -160 -3.3438 0.0791
NP_441637.1_9 Forward -40 -22 -3.71743 0.296
NP_442868.1_6 Reverse -144 -154 10.4031 0.038
NP_442868.1_6 Reverse -245 -255 6.8632 0.0956
NP_442868.1_6 Forward -157 -147 0.963343 0.205
NP_442427.1_8 Reverse -137 -156 8.84924 0.192
NP_442808.1_1 Reverse -145 -155 8.73102 0.0481
NP_442808.1_1 Forward -156 -146 8.73102 0.0481
NP_442808.1_1 Reverse -334 -344 8.3377 0.0525
NP_442808.1_1 Reverse -346 -356 3.91283 0.218
NP_440145.1_3 Forward -165 -146 25.2705 0.00286
NP_440145.1_3 Forward -74 -55 -2.85214 0.181
NP_442820.1_3 Reverse -48 -58 17.9741 0.187
NP_442050.1_1 Reverse -5 -24 8.35759 0.251
NP_442050.1_5 Reverse -144 -154 15.9091 0.0091
NP_442050.1_5 Forward -157 -147 9.22267 0.193
NP_440558.1_2 Reverse -101 -120 0.491109 0.19
NP_440558.1_2 Forward -58 -39 -0.688862 0.204
NP_440558.1_2 Reverse -157 -176 -0.885524 0.205
NP_442789.1_4 Reverse -1 -20 -4.32711 0.259
NP_440923.1_4 Reverse -153 -172 2.55606 0.225
NP_441878.1_6 Forward -156 -146 10.5014 0.0176
NP_441878.1_6 Reverse -145 -155 10.5014 0.0176
NP_441036.1_8 Forward -156 -146 15.713 0.00724
NP_441036.1_8 Reverse -145 -155 15.713 0.00724
NP_441557.1_5 Forward -155 -146 19.9609 0.000699
NP_441557.1_5 Reverse -146 -155 19.9609 0.000699
NP_441590.1_4 Reverse -167 -186 8.16011 0.249
NP_442066.2_9 Reverse -142 -155 10.2457 0.154
NP_441433.1_8 Forward -218 -199 -3.54046 0.283
NP_442183.1_1 Forward -344 -330 5.1128 0.231
NP_440979.1_6 Forward -129 -110 14.0608 0.27
NP_440276.1_2 Reverse -78 -97 14.5459 0.209
NP_442632.1_2 Forward -277 -258 20.5506 0.153
NP_442632.1_3 Forward -342 -323 -2.55715 0.258
NP_442347.1_2 Forward -154 -145 3.34298 0.284
NP_442347.1_2 Reverse -147 -156 3.34298 0.284
NP_442645.1_2 Forward -346 -327 -10.522 0.144
NP_442645.1_2 Forward -163 -144 -22.3217 0.29
NP_441037.1_4 Forward -157 -147 15.0168 0.028
NP_441037.1_4 Reverse -144 -154 7.22024 0.237
NP_442594.1_8 Forward -75 -56 13.7658 0.146
NP_442594.1_8 Forward -171 -152 2.26107 0.295
NP_442508.1_9 Forward -182 -168 18.8791 0.159
NP_441633.1_3 Reverse -144 -157 -3.81562 0.177
NP_441633.1_3 Forward -157 -144 -6.07724 0.236
NP_440136.1_2 Forward -154 -147 15.9687 0.0123
NP_440136.1_2 Reverse -147 -154 15.9687 0.0123
NP_442590.1_10 Forward -162 -143 6.58763 0.241
NP_442998.1_10 Forward -153 -146 15.5754 0.0102
NP_442998.1_10 Reverse -148 -155 15.5754 0.0102
NP_442998.1_10 Forward -327 -320 7.21728 0.144
NP_442998.1_10 Reverse -337 -344 6.23397 0.157
NP_442998.1_10 Forward -129 -122 4.07068 0.276
NP_440899.1_8 Forward -367 -348 -7.57203 0.246
NP_440299.1_1 Forward -159 -146 9.45847 0.0709
NP_441799.1_1 Forward -159 -145 18.8785 0.00745
NP_441799.1_1 Reverse -142 -156 13.4703 0.032
NP_441799.1_1 Forward -348 -334 8.75042 0.106
NP_441799.1_6 Forward -355 -336 19.6656 0.0984
NP_441007.1_10 Reverse -141 -154 2.67422 0.183
NP_441007.1_10 Forward -349 -336 1.39592 0.203
NP_440256.1_1 Forward -158 -139 22.3206 0.00281
NP_440256.1_1 Reverse -143 -162 -8.16202 0.253
NP_440256.1_1 Forward -347 -328 -9.14533 0.275
NP_440456.1_7 Forward -61 -47 13.8643 0.281
NP_441559.1_8 Forward -160 -146 8.35772 0.0676
NP_441559.1_8 Forward -333 -319 -6.58858 0.279
NP_441559.1_8 Reverse -141 -155 -7.2769 0.289
NP_440915.1_6 Reverse -142 -156 10.816 0.0301
NP_440915.1_6 Forward -159 -145 10.0294 0.0357
NP_442158.1_4 Forward -386 -376 13.0581 0.239
NP_442158.1_4 Forward -383 -373 12.7631 0.242
NP_442158.1_4 Forward -195 -185 11.6814 0.265
NP_442158.1_4 Forward -215 -205 11.4848 0.271
NP_440717.1_1 Reverse -336 -355 10.2259 0.24
NP_442866.1_1 Reverse -224 -243 2.3594 0.158
NP_442866.1_1 Forward -349 -330 -0.295539 0.192
NP_442031.1_9 Forward -341 -322 9.43841 0.264
NP_440306.1_5 Reverse -176 -195 2.16274 0.189
NP_442993.1_1 Reverse -146 -162 -9.28291 0.181
NP_442993.1_1 Forward -155 -139 -9.47957 0.186
NP_442386.1_9 Forward -156 -147 6.39082 0.219
NP_442386.1_9 Reverse -145 -154 6.39082 0.219
NP_442386.1_9 Reverse -334 -343 5.89917 0.233
NP_442386.1_9 Reverse -228 -237 5.40752 0.253
NP_441340.1_5 Forward -154 -147 15.6737 0.0124
NP_441340.1_5 Reverse -147 -154 15.6737 0.0124
NP_441340.1_5 Forward -343 -336 4.07068 0.239
NP_441947.1_4 Reverse -324 -343 11.7992 0.246
NP_442484.1_2 Forward -180 -161 -1.96717 0.3
NP_440586.1_1 Forward -354 -335 -5.70374 0.288
NP_440586.1_8 Forward -154 -147 13.2151 0.026
NP_440586.1_8 Reverse -147 -154 13.2151 0.026
NP_440586.1_8 Forward -343 -336 12.8218 0.0395
NP_442251.1_6 Forward -154 -147 15.2804 0.0124
NP_442251.1_6 Reverse -147 -154 15.2804 0.0124
NP_440684.1_9 Forward -328 -314 7.47274 0.263
NP_441262.1_3 Reverse -146 -153 14.7888 0.0223
NP_441262.1_3 Forward -155 -148 14.7888 0.0223
NP_440523.1_5 Reverse -295 -314 14.1591 0.11
NP_443051.1_1 Reverse -145 -154 19.5676 0.00335
NP_443051.1_1 Forward -156 -147 19.5676 0.00335
NP_443051.1_1 Forward -345 -336 0.196389 0.213
NP_439937.1_8 Forward -346 -327 -3.63879 0.271
NP_439937.1_9 Reverse -145 -162 -14.8098 0.287
NP_440439.1_1 Reverse -143 -156 10.639 0.0362
NP_440439.1_1 Forward -158 -145 8.9674 0.0488
NP_440372.1_2 Forward -154 -147 16.3621 0.0124
NP_440372.1_2 Reverse -147 -154 16.3621 0.0124
NP_442488.1_7 Forward -56 -37 8.35759 0.287
NP_441572.1_7 Reverse -140 -159 12.0942 0.0431
NP_440267.1_2 Reverse -141 -155 20.6484 0.00946
NP_442384.1_10 Reverse -146 -159 14.4739 0.0148
NP_442384.1_10 Forward -155 -142 2.57589 0.22
NP_442262.1_10 Forward -154 -147 14.1988 0.0123
NP_442262.1_10 Reverse -147 -154 14.1988 0.0123
NP_442262.1_10 Forward -343 -336 10.3639 0.153
NP_442262.1_10 Reverse -205 -212 8.20058 0.25
NP_441689.1_5 Reverse -144 -154 8.3377 0.132
NP_441689.1_5 Forward -157 -147 8.3377 0.132
NP_440282.1_10 Forward -354 -335 0.58944 0.188
NP_440282.1_10 Reverse -106 -125 -5.21209 0.25
NP_440531.1_8 Forward -75 -56 4.52268 0.269
NP_440562.1_3 Reverse -147 -164 4.26707 0.199
NP_440562.1_10 Forward -164 -146 11.9172 0.206
NP_441965.1_10 Reverse -143 -159 8.02334 0.135
NP_440297.1_9 Forward -154 -144 -0.216628 0.282
NP_440297.1_9 Reverse -147 -157 -0.216628 0.282
NP_441896.1_5 Forward -187 -180 15.3787 0.268
NP_440894.1_10 Forward -38 -19 8.45592 0.176
NP_441565.1_2 Reverse -290 -309 11.7992 0.268
NP_440999.1_9 Reverse -156 -170 -0.885388 0.22
NP_440999.1_9 Reverse -142 -156 -0.885388 0.22
NP_440999.1_9 Reverse -309 -323 -3.54032 0.296
NP_440888.1_2 Forward -155 -141 15.5352 0.0102
NP_440888.1_2 Forward -30 -16 7.96378 0.175
NP_440888.1_2 Reverse -146 -160 6.39049 0.236
NP_440600.1_4 Reverse -138 -156 -7.84733 0.294
NP_442277.1_4 Reverse -137 -156 10.2251 0.0949
NP_442033.1_10 Reverse -144 -163 -3.44213 0.171
NP_441949.1_4 Reverse -109 -128 5.70265 0.281
NP_441543.1_2 Forward -154 -145 15.9293 0.00518
NP_441543.1_2 Reverse -147 -156 15.9293 0.00518
NP_441543.1_2 Forward -343 -334 4.81794 0.219
NP_442845.1_2 Forward -161 -147 11.0127 0.138
NP_442845.1_2 Forward -262 -248 6.09611 0.217
NP_441918.1_7 Forward -114 -95 1.0811 0.288
NP_442710.1_3 Reverse -354 -373 17.2065 0.222
NP_441469.1_8 Forward -156 -147 6.5879 0.227
NP_441469.1_8 Reverse -145 -154 6.5879 0.227
NP_443064.1_6 Forward -155 -145 10.8217 0.13
NP_443064.1_6 Reverse -146 -156 10.8217 0.13
NP_442578.1_7 Forward -154 -147 14.5921 0.026
NP_442578.1_7 Reverse -147 -154 14.5921 0.026
NP_441462.1_2 Forward -155 -145 20.2362 0.000805
NP_441462.1_2 Reverse -146 -156 20.2362 0.000805
NP_441621.1_7 Reverse -144 -158 -5.11362 0.248
NP_443062.1_1 Forward -155 -137 8.05839 0.16
NP_443062.1_1 Reverse -335 -353 4.93815 0.244
NP_441410.1_3 Reverse -137 -156 16.9124 0.121
NP_442204.1_1 Forward -159 -148 8.51513 0.0919
NP_442204.1_1 Reverse -142 -153 2.02529 0.266
NP_441560.1_8 Forward -334 -315 15.2135 0.119
NP_441560.1_10 Forward -163 -144 11.6025 0.168
NP_440516.1_6 Forward -26 -12 8.65209 0.246
NP_440516.1_8 Forward -155 -146 16.9127 0.00442
NP_440516.1_8 Reverse -146 -155 16.9127 0.00442
NP_440516.1_8 Forward -344 -335 0.688044 0.136
NP_442428.1_5 Forward -154 -147 15.8704 0.0124
NP_442428.1_5 Reverse -147 -154 15.8704 0.0124
NP_442428.1_5 Reverse -336 -343 4.36568 0.271
NP_441443.1_7 Forward -76 -57 2.0644 0.218
NP_442120.1_10 Forward -225 -206 -8.85033 0.239
NP_442120.1_10 Reverse -320 -339 -9.14533 0.242
NP_442120.1_10 Reverse -230 -249 -16.1268 0.296
NP_440673.1_3 Forward -153 -146 12.4288 0.0426
NP_440673.1_3 Reverse -148 -155 12.4288 0.0426
NP_440673.1_3 Reverse -162 -169 8.98723 0.203
NP_440673.1_3 Forward -164 -157 6.3323 0.283
NP_441052.1_2 Forward -155 -145 10.4031 0.0285
NP_441052.1_2 Reverse -146 -156 10.4031 0.0285
NP_442219.1_9 Forward -154 -145 8.25953 0.0681
NP_442219.1_9 Reverse -147 -156 8.25953 0.0681
NP_440436.1_4 Forward -154 -145 9.24241 0.0871
NP_440436.1_4 Reverse -147 -156 9.24241 0.0871
NP_440436.1_4 Reverse -161 -170 7.76745 0.124
NP_442086.1_3 Reverse -147 -166 12.4875 0.166
NP_441321.1_5 Forward -74 -55 6.29264 0.265
NP_440314.1_9 Reverse -147 -166 -7.27704 0.238
NP_441719.1_4 Forward -154 -147 16.3621 0.0124
NP_441719.1_4 Reverse -147 -154 16.3621 0.0124
NP_442813.1_4 Forward -393 -374 -5.60541 0.299
NP_442813.1_4 Forward -392 -373 -7.27704 0.299
NP_442366.1_3 Reverse -312 -330 -4.8974 0.278
NP_442366.1_3 Forward -156 -138 -5.38906 0.287
NP_442366.1_5 Forward -158 -148 14.0409 0.0497
NP_441115.1_4 Forward -156 -138 11.1298 0.151
NP_440328.1_4 Reverse -140 -159 6.4893 0.129
NP_443054.1_2 Forward -171 -157 0.786239 0.254
NP_443054.1_2 Reverse -144 -158 -0.492064 0.295
NP_441851.1_10 Forward -156 -146 8.53483 0.114
NP_441851.1_10 Reverse -145 -155 8.53483 0.114
NP_441851.1_10 Forward -377 -367 7.64985 0.135
NP_441668.1_4 Forward -74 -55 7.07928 0.151
NP_441668.1_4 Forward -73 -54 4.71934 0.173
NP_442515.1_1 Reverse -319 -333 -0.885388 0.239
NP_441396.1_5 Forward -382 -373 9.4395 0.205
NP_441396.1_5 Forward -66 -57 8.55452 0.21
NP_440593.1_3 Forward -255 -236 -5.01543 0.256
NP_441046.1_2 Reverse -7 -26 -0.590531 0.282
NP_441349.1_10 Reverse -136 -155 6.39097 0.0364
NP_441349.1_10 Forward -165 -146 5.99764 0.0388
NP_441409.1_6 Forward -161 -142 12.3892 0.0209
NP_440432.1_9 Forward -154 -139 12.6646 0.0232
NP_440474.1_8 Reverse -336 -350 9.34041 0.162
NP_440474.1_8 Forward -154 -140 5.01387 0.26
NP_440726.1_2 Reverse -328 -347 0.0977854 0.288
NP_440431.1_4 Reverse -84 -103 -9.88384 0.294
NP_442450.1_5 Forward -157 -147 7.64985 0.13
NP_442168.1_5 Reverse -147 -166 -2.36049 0.264
NP_440588.1_2 Forward -164 -145 6.78429 0.0535
NP_441570.1_1 Forward -344 -326 -15.3205 0.229
NP_441078.1_4 Forward -155 -146 19.6659 0.0007
NP_441078.1_4 Reverse -146 -155 19.6659 0.0007
NP_442443.1_2 Reverse -160 -179 18.0924 0.0843
NP_440526.1_3 Forward -112 -101 2.02482 0.267
NP_440526.1_3 Forward -154 -143 1.92649 0.267
NP_441432.1_5 Reverse -365 -379 7.27608 0.272
NP_441432.1_8 Reverse -145 -154 16.8143 0.00595
NP_441432.1_8 Forward -156 -147 16.8143 0.00595
NP_441432.1_8 Forward -170 -161 5.40793 0.158
NP_442320.1_8 Reverse -140 -154 5.60446 0.0334
NP_441732.1_2 Forward -159 -143 -7.80794 0.0935
NP_441732.1_2 Reverse -331 -347 -16.4611 0.167
NP_441072.1_2 Reverse -135 -154 7.57094 0.256
NP_442489.1_7 Forward -155 -146 20.1576 0.000695
NP_442489.1_7 Reverse -146 -155 20.1576 0.000695
NP_442489.1_7 Reverse -335 -344 5.21127 0.077
NP_440559.1_1 Reverse -147 -156 8.65285 0.0586
NP_440559.1_1 Forward -154 -145 8.65285 0.0586
NP_441659.2_8 Forward -155 -145 20.9245 0.000805
NP_441659.2_8 Reverse -146 -156 20.9245 0.000805
NP_441659.2_8 Reverse -55 -65 0.471689 0.264
NP_442913.1_10 Reverse -137 -156 2.85105 0.12
NP_441040.1_2 Forward -324 -305 -15.2418 0.286
NP_442008.1_2 Forward -158 -139 4.42435 0.24
NP_440708.1_5 Reverse -318 -337 10.9142 0.08
NP_440708.1_6 Forward -24 -5 -10.4236 0.278
NP_441800.1_3 Forward -124 -106 13.3922 0.255
NP_440779.1_5 Forward -155 -138 -6.15601 0.164
NP_442346.1_5 Forward -156 -146 16.303 0.00248
NP_442346.1_5 Reverse -145 -155 16.303 0.00248
NP_442346.1_5 Forward -170 -160 11.2881 0.0706
NP_440352.1_5 Forward -84 -65 18.9826 0.0454
NP_440545.1_3 Forward -159 -142 5.74204 0.0597
NP_440545.1_3 Reverse -142 -159 -3.10775 0.199
NP_440545.1_3 Forward -348 -331 -4.77938 0.232
NP_441856.1_3 Reverse -143 -162 8.16093 0.101
NP_441856.1_3 Reverse -119 -138 -0.983855 0.228
NP_440025.1_4 Reverse -38 -57 13.1758 0.222
NP_441629.1_1 Forward -163 -144 7.47261 0.253
NP_440555.1_1 Forward -166 -147 13.5691 0.0901
NP_441923.1_6 Forward -112 -98 9.04604 0.278
NP_440459.1_2 Forward -178 -161 7.61033 0.285
NP_440010.1_10 Reverse -43 -62 1.67108 0.295
NP_440449.1_6 Reverse -138 -156 6.69963 0.241
NP_441833.1_4 Forward -154 -147 15.9687 0.0124
NP_441833.1_4 Reverse -147 -154 15.9687 0.0124
NP_441895.1_2 Reverse -373 -392 -7.76869 0.113
NP_441112.1_6 Reverse -372 -391 -4.13045 0.296
NP_442162.1_9 Forward -154 -147 16.2637 0.0124
NP_442162.1_9 Reverse -147 -154 16.2637 0.0124
NP_440671.1_4 Forward -344 -330 5.50613 0.281
NP_440671.1_4 Forward -161 -147 5.50613 0.281
NP_441973.1_1 Forward -365 -350 0.176559 0.236
NP_440204.1_1 Forward -276 -257 0.982764 0.3
NP_441915.1_4 Reverse -225 -244 11.6017 0.23
NP_442199.1_5 Reverse -138 -157 7.47261 0.0719
NP_442140.1_3 Reverse -147 -157 6.66654 0.159
NP_442140.1_3 Forward -168 -158 5.09324 0.227
NP_442140.1_3 Forward -154 -144 4.69992 0.238
NP_440875.1_9 Forward -153 -143 15.867 0.0233
NP_440875.1_9 Reverse -337 -347 14.3096 0.0453
NP_440875.1_9 Reverse -148 -158 8.37203 0.233
NP_441813.1_5 Reverse -144 -154 18.1713 0.00743
NP_441813.1_5 Forward -157 -147 8.63316 0.0367
NP_441227.1_7 Reverse -147 -166 11.4019 0.283
NP_441259.1_8 Reverse -141 -160 14.6499 0.236
NP_440590.1_4 Forward -154 -141 2.87088 0.0788
NP_440590.1_4 Reverse -147 -160 -5.29059 0.277
NP_440567.1_1 Reverse -147 -161 9.63603 0.0422
NP_440567.1_1 Reverse -336 -350 4.32615 0.123
NP_440567.1_1 Forward -154 -140 1.67122 0.196
NP_442497.1_10 Forward -154 -145 17.601 0.00813
NP_442497.1_10 Reverse -147 -156 17.601 0.00813
NP_440821.1_4 Reverse -144 -154 2.24165 0.131
NP_440821.1_4 Forward -157 -147 2.24165 0.131
NP_440821.1_7 Forward -217 -198 9.83255 0.288
NP_441239.1_9 Reverse -144 -156 13.0187 0.0389
NP_441239.1_9 Forward -157 -145 11.1504 0.0648
NP_441239.1_9 Reverse -333 -345 3.18557 0.292
NP_441951.1_9 Reverse -56 -75 1.47442 0.254
NP_442691.1_2 Reverse -170 -189 5.70265 0.243
NP_441892.1_1 Forward -353 -336 -2.02611 0.217
NP_442044.1_1 Reverse -146 -165 -7.4737 0.224
NP_442216.1_4 Reverse -199 -207 8.27883 0.255
NP_440876.1_5 Reverse -162 -181 5.40766 0.283
NP_443035.1_1 Forward -164 -145 19.469 0.242
NP_440354.1_7 Forward -350 -332 10.6389 0.224
NP_440500.1_1 Reverse -158 -177 7.86593 0.266
NP_442052.1_3 Forward -176 -157 13.2741 0.153
NP_440546.1_4 Reverse -146 -156 13.5365 0.0459
NP_440546.1_4 Forward -155 -145 13.5365 0.0459
NP_441230.1_5 Reverse -141 -160 3.93269 0.189
NP_440462.1_6 Reverse -144 -154 18.7612 0.00454
NP_440462.1_6 Forward -157 -147 10.5014 0.0396
NP_440462.1_6 Forward -346 -336 6.37155 0.118
NP_442340.1_3 Reverse -162 -181 -6.49039 0.223
NP_440868.1_4 Forward -159 -147 13.2153 0.022
NP_440868.1_4 Reverse -142 -154 7.80712 0.0637
NP_440868.1_4 Reverse -331 -343 1.21895 0.19
NP_440868.1_4 Forward -348 -336 -0.354346 0.263
NP_441868.1_4 Forward -176 -162 13.1759 0.282
NP_441474.1_1 Forward -23 -4 3.04693 0.244
NP_441474.1_1 Reverse -56 -75 -1.67294 0.262
NP_442402.1_10 Reverse -369 -379 11.8776 0.231
NP_442258.1_2 Reverse -106 -125 3.93269 0.0976
NP_442039.1_4 Forward -154 -147 15.1821 0.0124
NP_442039.1_4 Reverse -147 -154 15.1821 0.0124
NP_441811.1_1 Reverse -46 -65 9.93088 0.26
NP_441926.1_3 Forward -155 -139 6.35172 0.17
NP_442837.1_3 Forward -154 -147 15.7721 0.0124
NP_442837.1_3 Reverse -147 -154 15.7721 0.0124
NP_442053.1_1 Forward -155 -146 18.3876 0.0007
NP_442053.1_1 Reverse -146 -155 18.3876 0.0007
NP_442053.1_1 Reverse -335 -344 4.42462 0.249
NP_440505.1_3 Reverse -144 -154 17.188 0.00332
NP_440505.1_3 Forward -157 -147 8.04317 0.147
NP_440505.1_3 Forward -171 -161 6.37155 0.183
NP_441701.1_3 Forward -338 -321 10.6586 0.23
NP_440914.1_1 Forward -155 -145 16.3248 0.00196
NP_440914.1_1 Reverse -146 -156 16.3248 0.00196
NP_441011.1_8 Forward -154 -145 16.6177 0.00602
NP_441011.1_8 Reverse -147 -156 16.6177 0.00602
NP_442101.1_10 Forward -163 -144 -7.37537 0.211
NP_442533.1_6 Forward -155 -146 17.2076 0.00137
NP_442533.1_6 Reverse -146 -155 17.2076 0.00137
NP_442533.1_6 Forward -322 -313 10.9145 0.0503
NP_442541.1_10 Reverse -160 -174 2.8506 0.254
NP_440263.1_2 Reverse -144 -163 11.7983 0.298
NP_440263.1_6 Reverse -105 -124 15.3391 0.131
NP_441482.1_7 Forward -161 -147 -10.7185 0.213
NP_441482.1_7 Reverse -140 -154 -12.1934 0.29
NP_439944.1_9 Forward -154 -144 9.12481 0.1
NP_439944.1_9 Reverse -147 -157 9.12481 0.1
NP_439944.1_9 Reverse -336 -346 5.48657 0.247
NP_439944.1_10 Forward -125 -106 13.1758 0.223
NP_440816.1_7 Reverse -327 -346 9.24257 0.255
NP_441028.1_6 Reverse -199 -209 7.45273 0.229
NP_441028.1_6 Reverse -68 -78 5.19112 0.265
NP_440116.1_8 Reverse -147 -166 -4.22878 0.164
NP_440115.1_6 Forward -158 -148 7.35486 0.147
NP_440115.1_6 Reverse -154 -164 7.15819 0.158
NP_440115.1_6 Forward -347 -337 6.56821 0.178
NP_440115.1_6 Reverse -143 -153 4.89658 0.28
NP_440007.1_4 Reverse -135 -154 9.3409 0.274
NP_440007.1_9 Reverse -142 -156 1.67122 0.285
NP_441972.1_5 Forward -249 -230 -5.01543 0.213
NP_441106.1_1 Reverse -145 -154 18.486 0.0028
NP_441106.1_1 Forward -156 -147 18.486 0.0028
NP_440646.1_1 Forward -238 -219 4.03102 0.152
NP_442306.1_10 Forward -160 -141 -20.7484 0.226
NP_441286.1_1 Forward -156 -144 -3.50094 0.145
NP_441286.1_1 Reverse -145 -157 -3.50094 0.145
NP_442674.1_3 Reverse -196 -215 2.26028 0.3
NP_440670.1_8 Forward -155 -146 18.3876 0.000699
NP_440670.1_8 Reverse -146 -155 18.3876 0.000699
NP_441705.1_3 Forward -78 -59 -6.49039 0.291
NP_440886.1_7 Forward -156 -146 8.04271 0.0805
NP_440886.1_7 Reverse -145 -155 8.04271 0.0805
NP_440886.1_7 Reverse -252 -262 4.50281 0.232
NP_440828.1_1 Reverse -162 -181 2.35861 0.231
NP_442614.1_2 Reverse -146 -160 7.47274 0.273
NP_442072.1_9 Forward -163 -145 -15.4188 0.18
NP_442072.1_9 Forward -156 -138 -20.7287 0.204
NP_440513.1_6 Reverse -136 -155 10.9134 0.222
NP_442213.1_5 Forward -329 -310 1.37609 0.25
NP_440907.2_8 Reverse -147 -157 15.9091 0.0161
NP_440907.2_8 Forward -154 -144 9.616 0.103
NP_441021.1_1 Reverse -161 -180 -12.2919 0.283
NP_441021.1_4 Forward -391 -372 10.1275 0.269
NP_440841.1_4 Forward -157 -138 -6.88371 0.215
NP_441626.1_2 Forward -154 -147 15.7721 0.0124
NP_441626.1_2 Reverse -147 -154 15.7721 0.0124
NP_442794.1_1 Forward -159 -147 2.79224 0.286
NP_442615.1_1 Forward -164 -146 14.6705 0.00938
NP_442615.1_1 Reverse -137 -155 5.13236 0.0406
NP_442615.1_1 Forward -353 -335 -4.70074 0.192
NP_441962.1_4 Forward -118 -99 -12.8819 0.265
NP_441962.1_4 Reverse -321 -340 -13.0786 0.268
NP_441962.1_4 Forward -174 -155 -13.4719 0.273
NP_440387.1_1 Reverse -146 -162 7.33503 0.0282
NP_441431.1_2 Reverse -143 -157 14.1586 0.0714
NP_441431.1_2 Reverse -310 -324 10.717 0.155
NP_441488.1_7 Forward -350 -331 3.6377 0.217
NP_441993.1_1 Forward -329 -310 6.62464 0.178
NP_440467.1_3 Reverse -105 -124 10.7679 0.296
NP_440467.1_8 Forward -61 -42 16.6174 0.0964
NP_440114.1_10 Forward -155 -141 19.3708 0.00349
NP_440114.1_10 Reverse -146 -160 6.58777 0.263
NP_440293.1_3 Reverse -108 -127 -4.22878 0.26
NP_440766.1_4 Forward -342 -328 0.687908 0.271
NP_439988.1_7 Reverse -337 -351 16.5185 0.292
NP_441311.1_2 Forward -19 -5 12.5853 0.23
NP_440643.1_6 Reverse -105 -124 1.17943 0.274
NP_439910.1_2 Forward -139 -122 -13.2358 0.153
NP_439910.1_2 Reverse -138 -155 -22.2823 0.22
NP_442867.1_1 Reverse -335 -354 14.6508 0.0327
NP_440457.1_1 Forward -159 -147 2.20226 0.216
NP_440457.1_1 Reverse -142 -154 -0.551008 0.268
NP_440798.1_6 Reverse -147 -160 10.2457 0.0785
NP_440798.1_6 Forward -154 -141 3.26421 0.151
NP_442680.1_5 Forward -61 -42 11.8928 0.124
NP_442680.1_7 Forward -308 -289 -6.29373 0.265
NP_440801.1_9 Forward -38 -24 15.1623 0.227
NP_441984.1_3 Forward -135 -117 6.70565 0.267
NP_442509.1_9 Reverse -146 -156 8.04271 0.192
NP_442509.1_9 Forward -155 -145 8.04271 0.192
NP_441253.1_1 Forward -248 -229 8.06259 0.205
NP_440734.1_1 Reverse -335 -354 23.2056 0.037
NP_440554.1_4 Forward -154 -144 17.9746 0.0131
NP_440554.1_4 Reverse -147 -157 8.82982 0.0646
NP_441885.1_5 Forward -155 -145 11.3864 0.00668
NP_441885.1_5 Reverse -146 -156 11.3864 0.00668
NP_442341.1_9 Reverse -144 -158 19.6651 0.00907
NP_442341.1_9 Forward -157 -143 7.3738 0.2
NP_441173.1_9 Reverse -371 -379 11.3271 0.226
NP_443000.1_3 Reverse -76 -95 14.1404 0.228
NP_443000.1_7 Reverse -144 -154 20.3345 0.00223
NP_443000.1_7 Forward -157 -147 10.6981 0.0345
NP_441842.1_1 Reverse -337 -350 14.965 0.0837
NP_441842.1_10 Forward -351 -337 10.9143 0.148
NP_441842.1_10 Reverse -115 -129 7.9644 0.238
NP_441842.1_10 Reverse -139 -153 6.88276 0.271
NP_440275.1_3 Reverse -144 -154 16.1063 0.0155
NP_440275.1_3 Forward -157 -147 9.02648 0.0563
NP_440091.1_1 Reverse -142 -154 1.41561 0.197
NP_441105.1_3 Reverse -135 -154 -2.85214 0.169
NP_440216.1_1 Forward -155 -141 25.664 0.000481
NP_440216.1_1 Reverse -146 -160 6.78443 0.0124
NP_440216.1_9 Reverse -205 -214 9.73449 0.286
NP_440216.1_9 Reverse -206 -215 6.78456 0.289
NP_440216.1_9 Forward -77 -68 6.29291 0.289
NP_440172.1_1 Forward -155 -145 17.5813 0.00421
NP_440172.1_1 Reverse -146 -156 17.5813 0.00421
NP_442015.1_10 Forward -159 -146 2.47756 0.191
NP_442015.1_10 Reverse -331 -344 0.314277 0.231
NP_441226.1_7 Forward -154 -147 14.4934 0.0123
NP_441226.1_7 Reverse -147 -154 14.4934 0.0123
NP_442834.1_9 Forward -215 -196 5.99764 0.268
NP_441111.1_7 Forward -154 -146 18.7023 0.00294
NP_441111.1_7 Reverse -147 -155 18.7023 0.00294
NP_441766.1_2 Forward -155 -146 17.5026 0.00297
NP_441766.1_2 Reverse -146 -155 17.5026 0.00297
NP_442417.1_5 Forward -344 -330 8.55439 0.155
NP_440416.1_1 Forward -155 -136 -11.6036 0.272
NP_440416.1_9 Reverse -44 -63 -16.6185 0.218
NP_440072.1_1 Reverse -247 -261 18.2885 0.189
NP_440261.1_5 Reverse -336 -349 4.73917 0.0532
NP_440261.1_5 Forward -154 -141 -2.83231 0.0932
NP_440261.1_5 Reverse -147 -160 -3.02898 0.108
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGAATTAGTCCCCATATTTTGTTGGGGGAACCAATCTTCCACTTGACGTTCCTGGAGGCCATCGAGGTCGTTGATATTGCCCGTGGCCGGTAAGTCTTCTGGGAAAGGTTCCACTGGGTTATAGGATTGGGCTGTAACGGTAGTAGGGGTCCCGAGCACAAAAGCGGTGCCGGCAAGCAGAACTAATTTCCATGGGGAATAATGGTATTTCATTGGTTTGGCCTCTGGTCTGGCAATGGTTGCTAGGCGATCGCCTGTTGAAATTAACAAACTGTCGCCCTTCCACTGACCATGGTAACGATGTTTTTTACTTCCTTGACTAACCGAGGAAAATTTGGCGGGGGGCAGAAATGCCAATACAATTTAGCTTGGTCTTCCCTGCCCCTAATTTGTCCCCTCC

CDS

ATGGCCTTGCTTTCCCTCAACAATCATCAATCCCATCAACGCTTAACTGTTAATCCCCCTGCCCAAGGGGTCGCTTTGACTGGCCGCCTAAGGGTGCCGGGGGATAAATCCATTTCCCATCGGGCCTTGATGTTGGGGGCGATCGCCACCGGGGAAACCATTATCGAAGGGCTACTGTTGGGGGAAGATCCCCGTAGTACGGCCCATTGCTTTCGGGCCATGGGAGCAGAAATCAGCGAACTAAATTCAGAAAAAATCATCGTTCAGGGTCGGGGTCTGGGACAGTTGCAGGAACCCAGTACCGTTTTGGATGCGGGGAACTCTGGCACCACCATGCGCTTAATGTTGGGCTTGCTAGCCGGGCAAAAAGATTGTTTATTCACCGTCACCGGCGATGATTCCCTCCGTCACCGCCCCATGTCCCGGGTAATTCAACCCTTGCAACAAATGGGGGCAAAAATTTGGGCCCGGAGTAACGGCAAGTTTGCGCCGCTGGCAGTCCAGGGTAGCCAATTAAAACCGATCCATTACCATTCCCCCATTGCTTCAGCCCAGGTAAAGTCCTGCCTGTTGCTAGCGGGGTTAACCACCGAGGGGGACACCACGGTTACAGAACCAGCTCTATCCCGGGATCATAGCGAACGCATGTTGCAGGCCTTTGGAGCCAAATTAACCATTGATCCAGTAACCCATAGCGTCACTGTCCATGGCCCGGCCCATTTAACGGGGCAACGGGTGGTGGTGCCAGGGGACATCAGCTCGGCGGCCTTTTGGTTAGTGGCGGCATCCATTTTGCCTGGATCAGAATTGTTGGTGGAAAATGTAGGCATTAACCCCACCAGGACAGGGGTGTTGGAAGTGTTGGCCCAGATGGGGGCGGACATTACCCCGGAGAATGAACGATTGGTAACGGGGGAACCGGTAGCAGATCTGCGGGTTAGGGCAAGCCATCTCCAGGGTTGCACCTTCGGCGGCGAAATTATTCCCCGACTGATTGATGAAATTCCCATTTTGGCAGTGGCGGCGGCCTTTGCAGAGGGCACTACCCGCATTGAAGATGCCGCAGAACTGAGGGTTAAAGAAAGCGATCGCCTGGCGGCCATTGCTTCGGAGTTGGGCAAAATGGGGGCCAAAGTCACCGAATTTGATGATGGCCTGGAAATTCAAGGGGGAAGCCCGTTACAAGGGGCCGAGGTGGATAGCTTGACGGATCATCGCATTGCCATGGCGTTGGCGATCGCCGCTTTAGGTAGTGGGGGGCAAACAATTATTAACCGGGCGGAAGCGGCCGCCATTTCCTATCCAGAATTTTTTGGCACGCTAGGGCAAGTTGCCCAAGGATAA

Protein

MALLSLNNHQSHQRLTVNPPAQGVALTGRLRVPGDKSISHRALMLGAIATGETIIEGLLLGEDPRSTAHCFRAMGAEISELNSEKIIVQGRGLGQLQEPSTVLDAGNSGTTMRLMLGLLAGQKDCLFTVTGDDSLRHRPMSRVIQPLQQMGAKIWARSNGKFAPLAVQGSQLKPIHYHSPIASAQVKSCLLLAGLTTEGDTTVTEPALSRDHSERMLQAFGAKLTIDPVTHSVTVHGPAHLTGQRVVVPGDISSAAFWLVAASILPGSELLVENVGINPTRTGVLEVLAQMGADITPENERLVTGEPVADLRVRASHLQGCTFGGEIIPRLIDEIPILAVAAAFAEGTTRIEDAAELRVKESDRLAAIASELGKMGAKVTEFDDGLEIQGGSPLQGAEVDSLTDHRIAMALAIAALGSGGQTIINRAEAAAISYPEFFGTLGQVAQG