Your browser is old and dusty. Try Google Chrome!

Details for slr0440

ORF slr0440
Accession NP_442194.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -131 -117 8.25939 0.0917
NP_441061.1_2 Forward -95 -81 0.88457 0.197
NP_441061.1_2 Reverse -355 -369 -0.885388 0.242
NP_440557.1_1 Reverse -361 -380 0.196116 0.265
NP_440557.1_1 Forward -131 -112 -0.590531 0.27
NP_442761.1_5 Forward -199 -180 5.211 0.268
NP_440795.1_7 Forward -131 -124 14.6904 0.0123
NP_440795.1_7 Reverse -124 -131 14.6904 0.0123
NP_440795.1_7 Forward -362 -355 10.2655 0.154
NP_441418.1_6 Forward -132 -113 6.58763 0.00708
NP_441418.1_6 Reverse -185 -204 -10.7186 0.0382
NP_441418.1_6 Forward -369 -350 -29.0082 0.215
NP_440815.1_5 Reverse -152 -171 3.44104 0.286
NP_442291.1_5 Reverse -122 -138 13.8249 0.0261
NP_442291.1_5 Forward -133 -117 -3.97304 0.261
NP_440897.1_6 Forward -132 -113 18.6815 0.0216
NP_441453.1_1 Forward -201 -183 13.6864 0.0938
NP_441453.1_1 Reverse -116 -134 6.50823 0.234
NP_441453.1_4 Reverse -123 -131 16.539 0.00633
NP_441453.1_4 Forward -132 -124 16.539 0.00633
NP_441453.1_4 Reverse -23 -31 11.8191 0.0367
NP_441453.1_4 Reverse -185 -193 6.80426 0.121
NP_441453.1_4 Forward -194 -186 6.11594 0.121
NP_442151.1_6 Forward -132 -118 9.83269 0.139
NP_442151.1_6 Reverse -123 -137 9.83269 0.139
NP_442151.1_6 Forward -90 -76 8.75105 0.164
NP_440561.1_1 Reverse -349 -368 9.93006 0.284
NP_440561.1_4 Reverse -364 -383 15.4476 0.198
NP_441818.1_1 Reverse -124 -135 18.446 0.0046
NP_441818.1_1 Forward -131 -120 9.30127 0.246
NP_440226.1_1 Forward -194 -175 11.8975 0.0496
NP_440226.1_1 Reverse -123 -142 3.24438 0.233
NP_441630.1_3 Forward -140 -121 1.17943 0.252
NP_440259.1_4 Reverse -39 -53 15.5771 0.155
NP_440996.1_3 Forward -97 -79 20.767 0.034
NP_440996.1_3 Forward -370 -352 13.5888 0.221
NP_442655.1_10 Reverse -182 -201 -9.63698 0.22
NP_443002.1_2 Forward -20 -1 12.5858 0.139
NP_442173.1_1 Forward -131 -123 15.4574 0.00633
NP_442173.1_1 Reverse -124 -132 15.4574 0.00633
NP_442173.1_1 Forward -193 -185 12.0158 0.0316
NP_442173.1_1 Reverse -186 -194 10.7375 0.0611
NP_442752.1_4 Reverse -185 -192 13.8055 0.0199
NP_442752.1_4 Forward -132 -125 13.8055 0.0199
NP_442752.1_4 Reverse -123 -130 13.8055 0.0199
NP_442752.1_4 Forward -32 -25 10.8555 0.0846
NP_442752.1_4 Forward -305 -298 8.20058 0.127
NP_443027.1_4 Reverse -121 -131 14.828 0.0437
NP_443027.1_4 Forward -134 -124 11.0914 0.107
NP_443027.1_4 Forward -196 -186 5.97822 0.294
NP_441812.1_3 Forward -133 -119 8.06273 0.254
NP_442975.1_10 Reverse -119 -133 21.9267 0.000628
NP_442975.1_10 Reverse -344 -358 8.94708 0.0821
NP_440784.1_7 Forward -131 -124 15.9687 0.0123
NP_440784.1_7 Reverse -124 -131 15.9687 0.0123
NP_440784.1_7 Reverse -186 -193 6.23397 0.241
NP_440784.1_7 Forward -193 -186 6.13563 0.241
NP_440061.1_9 Reverse -121 -135 11.2087 0.116
NP_440061.1_9 Reverse -294 -308 7.17714 0.216
NP_440061.1_9 Reverse -264 -278 6.78381 0.232
NP_440061.1_9 Forward -196 -182 6.68548 0.235
NP_440061.1_9 Forward -134 -120 5.80051 0.272
NP_440110.1_8 Forward -134 -115 8.35759 0.0916
NP_441476.1_5 Reverse -355 -374 -5.70374 0.267
NP_440878.1_4 Forward -391 -373 16.4404 0.181
NP_442062.1_8 Forward -132 -122 19.4496 0.000558
NP_442062.1_8 Reverse -123 -133 17.3846 0.00193
NP_442062.1_8 Reverse -185 -195 9.32148 0.0633
NP_440761.1_4 Forward -37 -18 -13.5702 0.257
NP_440304.1_4 Reverse -121 -131 10.8948 0.051
NP_440304.1_4 Forward -34 -24 7.55152 0.109
NP_440304.1_4 Forward -377 -367 3.22496 0.299
NP_440304.1_4 Forward -174 -164 2.92996 0.299
NP_440304.1_4 Forward -134 -124 1.84832 0.299
NP_442242.1_4 Forward -131 -124 14.3954 0.0124
NP_442242.1_4 Reverse -124 -131 14.3954 0.0124
NP_440044.1_8 Reverse -349 -368 -0.590531 0.224
NP_440044.1_8 Reverse -124 -143 -3.54046 0.286
NP_441781.1_7 Reverse -308 -327 6.58763 0.186
NP_441781.1_7 Forward -324 -305 -1.37718 0.272
NP_441581.1_6 Reverse -114 -133 12.3951 0.283
NP_440011.1_1 Forward -313 -294 15.2408 0.188
NP_442181.1_1 Reverse -85 -104 11.6025 0.186
NP_441935.1_1 Reverse -197 -216 4.71934 0.298
NP_441208.1_9 Forward -164 -150 12.586 0.132
NP_441208.1_9 Reverse -195 -209 4.81781 0.285
NP_441594.1_6 Forward -378 -359 1.86774 0.261
NP_440370.1_10 Forward -203 -184 6.98095 0.271
NP_442276.1_2 Forward -317 -298 4.22769 0.299
NP_442110.1_7 Forward -132 -118 11.406 0.0595
NP_442110.1_7 Reverse -185 -199 1.08123 0.239
NP_442110.1_7 Reverse -123 -137 0.0979218 0.267
NP_440014.1_7 Reverse -114 -128 16.4202 0.216
NP_440856.1_4 Reverse -259 -278 -0.39387 0.177
NP_441083.1_5 Reverse -123 -133 20.3345 0.00053
NP_441083.1_5 Forward -132 -122 11.3864 0.0159
NP_441083.1_5 Forward -32 -22 7.05986 0.067
NP_441083.1_5 Forward -194 -184 0.668351 0.22
NP_441083.1_5 Reverse -23 -33 0.176696 0.241
NP_441083.1_5 Reverse -185 -195 -0.904945 0.283
NP_442827.1_8 Reverse -115 -134 5.60352 0.115
NP_441434.1_7 Reverse -125 -139 2.06454 0.288
NP_441738.1_2 Forward -192 -185 15.28 0.0102
NP_441738.1_2 Forward -130 -123 15.28 0.0102
NP_441738.1_2 Reverse -125 -132 15.28 0.0102
NP_441738.1_2 Reverse -317 -324 6.72528 0.236
NP_441558.1_2 Forward -335 -316 10.9142 0.207
NP_441558.1_5 Reverse -21 -40 13.9625 0.0531
NP_441558.1_5 Reverse -121 -140 9.63589 0.117
NP_441558.1_5 Reverse -183 -202 8.45592 0.15
NP_441558.1_5 Forward -182 -163 7.57094 0.176
NP_441558.1_5 Forward -134 -115 5.11266 0.26
NP_440209.1_1 Reverse -123 -131 18.1123 0.00295
NP_440209.1_1 Forward -132 -124 18.1123 0.00295
NP_440209.1_1 Reverse -185 -193 8.57422 0.0425
NP_442889.1_1 Forward -102 -83 -11.9969 0.218
NP_442889.1_8 Reverse -120 -134 4.62054 0.26
NP_442889.1_8 Forward -71 -57 3.93223 0.27
NP_442889.1_8 Forward -135 -121 3.34225 0.281
NP_440447.1_5 Forward -314 -304 12.9597 0.291
NP_440447.1_6 Reverse -15 -33 3.65739 0.189
NP_441713.1_1 Forward -330 -311 -3.93378 0.113
NP_441713.1_1 Forward -200 -181 -10.0303 0.19
NP_441713.1_1 Reverse -17 -36 -15.3402 0.261
NP_442570.1_3 Forward -164 -145 -0.4922 0.212
NP_439953.1_1 Forward -52 -33 15.5357 0.194
NP_442445.1_1 Forward -95 -76 10.9142 0.285
NP_441792.1_1 Reverse -365 -384 4.62101 0.286
NP_441716.1_1 Forward -32 -18 7.57108 0.166
NP_441716.1_1 Forward -132 -118 6.48943 0.198
NP_442111.1_4 Forward -133 -119 17.4042 0.0102
NP_442111.1_4 Forward -56 -42 6.98109 0.108
NP_442111.1_4 Reverse -184 -198 5.70279 0.154
NP_442111.1_4 Forward -195 -181 2.85119 0.263
NP_441163.1_1 Forward -103 -86 9.47787 0.226
NP_441163.1_1 Reverse -115 -132 8.78956 0.226
NP_441163.1_9 Reverse -114 -133 11.9958 0.288
NP_440343.1_9 Forward -334 -315 6.78429 0.293
NP_440906.1_5 Forward -131 -124 15.8704 0.0124
NP_440906.1_5 Reverse -124 -131 15.8704 0.0124
NP_440906.1_5 Reverse -186 -193 6.23397 0.234
NP_440906.1_5 Forward -193 -186 6.13563 0.241
NP_440747.1_10 Forward -135 -123 16.8536 0.00143
NP_440747.1_10 Reverse -120 -132 -2.02597 0.0196
NP_440747.1_10 Reverse -182 -194 -2.32097 0.0331
NP_440747.1_10 Reverse -20 -32 -2.51763 0.0509
NP_440747.1_10 Forward -197 -185 -11.9574 0.178
NP_440747.1_10 Forward -99 -87 -12.2524 0.254
NP_440747.1_10 Reverse -107 -119 -12.3507 0.27
NP_441130.1_10 Reverse -121 -135 19.7641 0.00955
NP_441130.1_10 Forward -134 -120 7.17775 0.167
NP_441486.1_1 Reverse -120 -134 13.1759 0.00897
NP_441486.1_1 Forward -135 -121 11.3077 0.0164
NP_441880.2_10 Reverse -13 -31 8.57394 0.273
NP_442634.1_4 Reverse -183 -197 6.88276 0.0489
NP_442634.1_4 Forward -134 -120 -2.06536 0.149
NP_442634.1_4 Forward -34 -20 -5.11362 0.235
NP_442634.1_4 Reverse -21 -35 -5.70361 0.271
NP_440403.1_4 Forward -286 -267 -3.83545 0.203
NP_441014.1_8 Reverse -172 -191 -5.21209 0.266
NP_442848.1_1 Reverse -117 -131 -1.27871 0.263
NP_441012.1_4 Reverse -356 -369 13.1956 0.224
NP_443018.1_3 Forward -131 -124 14.8871 0.0123
NP_443018.1_3 Reverse -124 -131 14.8871 0.0123
NP_443018.1_3 Forward -193 -186 11.7405 0.0655
NP_443018.1_3 Reverse -24 -31 10.4622 0.103
NP_443018.1_3 Reverse -186 -193 5.44732 0.193
NP_443018.1_3 Forward -362 -355 4.36568 0.254
NP_443018.1_3 Forward -31 -24 4.36568 0.254
NP_443018.1_3 Reverse -355 -362 4.07068 0.299
NP_441316.1_7 Forward -196 -181 -1.98672 0.24
NP_441634.1_8 Forward -134 -120 15.4376 0.0248
NP_441634.1_8 Forward -282 -268 12.586 0.0486
NP_440376.1_1 Forward -132 -123 19.4693 0.000692
NP_440376.1_1 Reverse -123 -132 19.4693 0.000692
NP_440376.1_1 Forward -32 -23 12.4878 0.0191
NP_440376.1_1 Forward -180 -171 10.6195 0.0281
NP_440376.1_1 Reverse -185 -194 5.99792 0.111
NP_440376.1_1 Forward -119 -110 5.21127 0.144
NP_440376.1_1 Forward -194 -185 -0.196935 0.285
NP_440376.1_1 Reverse -23 -32 -0.196935 0.285
NP_441588.1_4 Reverse -125 -135 8.73149 0.14
NP_442687.1_7 Reverse -122 -132 15.8113 0.0125
NP_442687.1_7 Forward -133 -123 8.92815 0.0994
NP_442687.1_7 Reverse -22 -32 7.15819 0.138
NP_442687.1_7 Reverse -170 -180 4.60159 0.243
NP_442687.1_7 Reverse -386 -396 4.0116 0.271
NP_442191.1_4 Forward -131 -117 15.2592 0.0634
NP_441077.1_6 Reverse -140 -156 2.51265 0.281
NP_442485.1_3 Forward -374 -355 1.27776 0.23
NP_442088.1_6 Forward -249 -230 12.6841 0.206
NP_440642.1_6 Forward -43 -24 17.7974 0.191
NP_440642.1_10 Reverse -291 -305 2.8506 0.277
NP_441029.1_7 Reverse -127 -146 19.174 0.0837
NP_442658.1_1 Reverse -121 -131 15.9091 0.00966
NP_442658.1_1 Forward -97 -87 8.14104 0.199
NP_442658.1_1 Forward -134 -124 7.94438 0.199
NP_442658.1_1 Forward -34 -24 5.28945 0.274
NP_440141.1_8 Reverse -114 -133 8.16093 0.232
NP_440141.1_8 Forward -372 -353 3.93269 0.296
NP_441855.2_4 Reverse -115 -134 12.2225 0.2
NP_441414.1_9 Forward -132 -113 -10.817 0.296
NP_441487.1_9 Reverse -122 -141 6.09597 0.131
NP_441487.1_9 Reverse -99 -118 -2.26216 0.293
NP_442937.1_5 Forward -362 -343 10.2259 0.168
NP_442937.1_5 Forward -137 -118 6.88262 0.268
NP_441958.1_5 Forward -133 -123 12.2714 0.00183
NP_441958.1_5 Reverse -122 -132 12.2714 0.00183
NP_441958.1_5 Reverse -184 -194 9.81313 0.0174
NP_441958.1_5 Forward -33 -23 9.22315 0.0233
NP_441958.1_5 Reverse -22 -32 0.865012 0.12
NP_441958.1_5 Forward -181 -171 -0.314959 0.198
NP_440203.1_5 Reverse -89 -99 14.3359 0.0886
NP_440203.1_5 Reverse -174 -184 10.206 0.235
NP_439905.1_1 Reverse -172 -185 16.2439 0.0664
NP_439905.1_1 Forward -193 -180 9.36073 0.221
NP_439905.1_1 Reverse -24 -37 6.4108 0.288
NP_439905.1_2 Reverse -361 -375 14.3559 0.188
NP_440984.1_7 Forward -137 -123 15.3392 0.0563
NP_442911.1_2 Forward -204 -185 7.17762 0.0263
NP_442911.1_2 Reverse -113 -132 5.211 0.0344
NP_442911.1_2 Reverse -13 -32 -3.54046 0.114
NP_442911.1_2 Reverse -2 -21 -8.06369 0.226
NP_440153.1_5 Forward -131 -117 11.5043 0.0763
NP_440153.1_5 Reverse -124 -138 2.35953 0.225
NP_442536.1_8 Forward -375 -356 16.9124 0.135
NP_443055.1_6 Forward -140 -122 4.14829 0.186
NP_443055.1_6 Reverse -163 -181 1.10005 0.237
NP_443055.1_6 Reverse -171 -189 -0.0799167 0.252
NP_440138.1_6 Reverse -88 -107 4.52188 0.237
NP_441348.1_3 Forward -137 -118 7.07928 0.265
NP_441099.1_5 Forward -204 -185 -5.01543 0.148
NP_441099.1_5 Forward -142 -123 -11.8003 0.29
NP_442002.1_9 Reverse -122 -129 10.7572 0.185
NP_441294.1_7 Reverse -119 -133 15.8738 0.0188
NP_441294.1_7 Reverse -167 -181 8.96266 0.269
NP_441646.1_1 Reverse -164 -183 4.32602 0.195
NP_442438.1_10 Reverse -118 -132 18.3875 0.0168
NP_442438.1_10 Forward -199 -185 1.08123 0.206
NP_442438.1_10 Forward -362 -348 -0.0987402 0.248
NP_442438.1_10 Forward -137 -123 -0.0987402 0.248
NP_441000.1_6 Reverse -122 -136 13.3726 0.0396
NP_441000.1_6 Forward -133 -119 -4.13031 0.227
NP_441000.1_6 Forward -195 -181 -5.60527 0.285
NP_440484.1_3 Reverse -183 -197 12.586 0.242
NP_440147.1_4 Reverse -121 -134 11.0324 0.0341
NP_440147.1_4 Forward -134 -121 7.39411 0.0695
NP_440147.1_4 Reverse -21 -34 7.29578 0.0712
NP_440147.1_4 Reverse -385 -398 4.24752 0.167
NP_440147.1_4 Reverse -169 -182 0.510939 0.252
NP_440147.1_4 Forward -34 -21 0.117615 0.265
NP_441550.1_8 Forward -134 -124 15.1225 0.0132
NP_441550.1_8 Reverse -183 -193 14.5325 0.0141
NP_441550.1_8 Reverse -21 -31 14.0409 0.0194
NP_441550.1_8 Forward -34 -24 6.46942 0.206
NP_441550.1_8 Reverse -121 -131 6.0761 0.214
NP_441550.1_8 Reverse -385 -395 5.58445 0.242
NP_441550.1_8 Forward -174 -164 4.89613 0.281
NP_441916.1_7 Forward -132 -122 18.4663 0.00144
NP_441916.1_7 Reverse -123 -133 10.3048 0.0261
NP_441916.1_7 Forward -32 -22 4.40493 0.178
NP_441916.1_7 Forward -194 -184 1.06167 0.294
NP_441916.1_10 Forward -383 -364 3.83436 0.225
NP_440206.1_4 Forward -274 -255 0.981987 0.289
NP_440206.1_9 Reverse -91 -110 10.0292 0.272
NP_441041.1_4 Reverse -185 -204 6.19431 0.0445
NP_441041.1_7 Forward -135 -123 10.8188 0.0864
NP_441041.1_7 Reverse -97 -109 9.84704 0.107
NP_441041.1_7 Forward -35 -23 5.37687 0.26
NP_443063.1_2 Forward -20 -1 6.4893 0.283
NP_442004.1_6 Forward -132 -118 3.24451 0.244
NP_441725.1_5 Forward -131 -121 11.2881 0.0247
NP_441725.1_5 Reverse -124 -134 2.04498 0.115
NP_441725.1_5 Reverse -186 -196 0.275027 0.192
NP_439966.1_7 Reverse -121 -131 18.4657 0.00473
NP_439966.1_7 Forward -134 -124 15.3192 0.0152
NP_439966.1_7 Forward -196 -186 14.9258 0.0177
NP_439966.1_7 Reverse -183 -193 4.60114 0.265
NP_439966.1_7 Reverse -21 -31 4.01116 0.295
NP_439966.1_9 Reverse -121 -130 0.983037 0.253
NP_442941.1_3 Reverse -124 -134 19.2529 0.00262
NP_442941.1_3 Forward -131 -121 11.4848 0.0116
NP_442941.1_3 Forward -193 -183 9.41981 0.0319
NP_440289.1_2 Reverse -120 -133 11.9173 0.0171
NP_440289.1_2 Forward -135 -122 5.91914 0.0605
NP_440289.1_2 Forward -35 -22 -4.7006 0.294
NP_440983.1_5 Reverse -351 -370 -0.295539 0.227
NP_440983.1_5 Reverse -315 -334 -5.01543 0.261
NP_440983.1_5 Forward -393 -374 -6.88371 0.28
NP_440260.1_8 Forward -165 -147 4.14905 0.154
NP_441514.1_4 Forward -55 -36 11.8235 0.3
NP_441514.1_6 Forward -382 -375 12.7238 0.29
NP_442281.1_1 Forward -137 -123 16.8135 0.00698
NP_442281.1_1 Reverse -118 -132 11.1104 0.0507
NP_442281.1_1 Reverse -180 -194 4.42388 0.195
NP_442281.1_1 Forward -199 -185 1.67063 0.293
NP_441334.1_7 Forward -196 -177 -12.0953 0.139
NP_441334.1_7 Forward -134 -115 -21.3384 0.296
NP_441079.1_1 Forward -324 -305 19.764 0.115
NP_441058.2_6 Reverse -300 -319 11.1109 0.268
NP_442256.1_2 Forward -134 -116 3.55906 0.107
NP_001035871.2_7 Reverse -263 -273 12.9597 0.237
NP_440437.1_1 Reverse -117 -136 7.66927 0.0637
NP_442012.1_1 Reverse -308 -327 0.294447 0.241
NP_442982.1_5 Reverse -113 -132 -3.3438 0.297
NP_441644.1_6 Reverse -123 -133 17.3841 0.00127
NP_441644.1_6 Reverse -23 -33 16.9908 0.0025
NP_441644.1_6 Forward -132 -122 10.1076 0.0628
NP_441644.1_6 Forward -194 -184 9.41933 0.0767
NP_441644.1_6 Reverse -171 -181 7.55106 0.123
NP_441644.1_6 Forward -32 -22 4.40448 0.239
NP_442215.1_2 Forward -134 -118 -1.12144 0.179
NP_442215.1_2 Reverse -121 -137 -1.21977 0.181
NP_442215.1_2 Forward -279 -263 -6.92296 0.281
NP_442215.1_2 Forward -176 -160 -7.0213 0.284
NP_442029.1_6 Forward -137 -118 15.1424 0.0999
NP_442247.1_8 Forward -134 -120 8.16106 0.286
NP_440253.1_2 Reverse -123 -141 13.5888 0.0219
NP_440929.1_8 Forward -132 -123 19.2726 0.000701
NP_440929.1_8 Reverse -123 -132 19.2726 0.000701
NP_440929.1_8 Forward -194 -185 14.651 0.0105
NP_440929.1_8 Reverse -185 -194 7.66954 0.0624
NP_440929.1_8 Reverse -23 -32 6.68623 0.0887
NP_440929.1_8 Reverse -171 -180 3.93297 0.197
NP_442933.1_10 Forward -132 -123 17.601 0.00325
NP_442933.1_10 Reverse -123 -132 17.601 0.00325
NP_442933.1_10 Forward -32 -23 4.62128 0.227
NP_441751.2_8 Reverse -24 -38 0.294584 0.121
NP_441751.2_8 Forward -193 -179 -4.52363 0.174
NP_441751.2_8 Reverse -124 -138 -4.52363 0.174
NP_441751.2_8 Forward -31 -17 -5.80194 0.239
NP_442926.1_5 Reverse -118 -137 9.1053 0.287
NP_442554.1_8 Reverse -124 -134 16.2046 0.0065
NP_442554.1_8 Forward -131 -121 13.8447 0.0145
NP_442554.1_8 Forward -31 -21 11.6814 0.033
NP_442554.1_8 Reverse -24 -34 8.23984 0.0776
NP_442554.1_8 Reverse -186 -196 8.1415 0.0785
NP_442554.1_8 Forward -193 -183 7.45319 0.092
NP_441762.1_7 Forward -133 -121 2.89058 0.0676
NP_441762.1_7 Reverse -122 -134 2.39892 0.0676
NP_442142.1_4 Forward -135 -122 14.7683 0.0302
NP_442142.1_4 Reverse -120 -133 7.98351 0.125
NP_442142.1_4 Reverse -20 -33 5.0336 0.204
NP_442142.1_4 Reverse -363 -376 2.57534 0.286
NP_442142.1_4 Forward -197 -184 2.18201 0.299
NP_442292.1_1 Reverse -124 -133 18.486 0.00229
NP_442292.1_1 Forward -131 -122 9.63616 0.0183
NP_442292.1_1 Forward -193 -184 7.66954 0.0634
NP_442292.1_1 Reverse -24 -33 4.71961 0.172
NP_442292.1_1 Reverse -186 -195 -0.68859 0.268
NP_442292.1_5 Forward -136 -117 -1.18052 0.257
NP_442476.1_6 Reverse -124 -138 4.32615 0.144
NP_442381.1_8 Reverse -120 -139 -13.1769 0.267
NP_443009.1_5 Forward -133 -122 18.3477 0.00265
NP_443009.1_5 Reverse -184 -195 8.80962 0.099
NP_443009.1_5 Reverse -22 -33 5.17139 0.214
NP_442408.2_1 Forward -132 -113 5.99764 0.143
NP_441741.1_6 Reverse -282 -301 10.6192 0.249
NP_441715.1_4 Reverse -124 -134 17.3846 0.0106
NP_441715.1_4 Forward -131 -121 16.303 0.0117
NP_441715.1_4 Forward -193 -183 6.96153 0.121
NP_441715.1_4 Reverse -13 -23 5.48657 0.2
NP_441198.1_8 Forward -97 -87 10.4392 0.271
NP_441468.1_1 Forward -131 -124 15.8704 0.0124
NP_441468.1_1 Reverse -124 -131 15.8704 0.0124
NP_441468.1_1 Reverse -186 -193 6.13563 0.209
NP_441468.1_1 Forward -193 -186 6.0373 0.223
NP_441468.1_1 Forward -362 -355 4.46401 0.224
NP_441468.1_1 Forward -31 -24 4.07068 0.263
NP_441015.1_10 Forward -137 -118 -6.09707 0.241
NP_441015.1_10 Forward -317 -298 -6.29373 0.245
NP_441673.1_1 Forward -132 -123 20.8459 0.000698
NP_441673.1_1 Reverse -123 -132 20.8459 0.000698
NP_441673.1_1 Reverse -185 -194 1.37636 0.114
NP_441673.1_1 Forward -32 -23 1.37636 0.114
NP_441673.1_1 Forward -194 -185 1.1797 0.163
NP_441673.1_1 Reverse -23 -32 1.1797 0.163
NP_441339.1_9 Forward -276 -257 18.7807 0.155
NP_441876.1_9 Reverse -272 -282 11.3859 0.275
NP_441826.1_2 Reverse -117 -131 11.996 0.0328
NP_441826.1_2 Forward -375 -361 -0.885388 0.228
NP_441826.1_2 Forward -138 -124 -2.26202 0.269
NP_441330.1_1 Reverse -180 -199 -5.40875 0.121
NP_441330.1_1 Forward -137 -118 -10.6203 0.183
NP_441330.1_1 Reverse -81 -100 -15.8318 0.3
NP_441637.1_9 Reverse -199 -217 -2.93078 0.292
NP_442490.1_9 Reverse -348 -367 -2.55715 0.211
NP_442490.1_10 Reverse -170 -188 8.7706 0.262
NP_442868.1_6 Forward -134 -124 19.2529 0.00563
NP_442868.1_6 Reverse -121 -131 0.963343 0.205
NP_442868.1_6 Reverse -183 -193 0.668351 0.213
NP_442868.1_6 Reverse -352 -362 0.57002 0.217
NP_441251.1_8 Reverse -331 -344 17.6323 0.254
NP_441612.1_2 Reverse -123 -133 8.54929 0.21
NP_442227.1_2 Reverse -293 -312 3.53937 0.216
NP_442227.1_2 Reverse -356 -375 -3.73712 0.295
NP_442361.1_3 Reverse -117 -130 10.7374 0.272
NP_442808.1_1 Reverse -122 -132 18.4657 0.00201
NP_442808.1_1 Forward -195 -185 10.4026 0.0481
NP_442808.1_1 Forward -133 -123 8.63269 0.0481
NP_442808.1_1 Reverse -22 -32 6.76441 0.0982
NP_442808.1_1 Reverse -107 -117 5.68278 0.144
NP_442808.1_1 Reverse -295 -305 5.48612 0.151
NP_442808.1_1 Reverse -170 -180 5.48612 0.151
NP_442808.1_1 Forward -120 -110 4.69947 0.192
NP_441101.1_10 Reverse -262 -281 -5.31042 0.281
NP_440568.1_8 Forward -104 -85 9.63589 0.265
NP_442775.1_6 Reverse -355 -374 15.3391 0.236
NP_442692.1_1 Forward -204 -185 -5.9004 0.276
NP_440145.1_3 Forward -142 -123 5.89931 0.0587
NP_440145.1_3 Forward -334 -315 3.04771 0.11
NP_442542.1_2 Reverse -121 -134 9.45906 0.134
NP_442542.1_2 Forward -34 -21 8.86907 0.145
NP_442542.1_9 Reverse -116 -130 21.6317 0.00646
NP_442542.1_9 Reverse -178 -192 9.34041 0.138
NP_442542.1_9 Forward -187 -173 8.16044 0.17
NP_442542.1_9 Forward -370 -356 5.60385 0.26
NP_442542.1_9 Forward -312 -298 4.42388 0.297
NP_442050.1_1 Forward -308 -289 9.3409 0.247
NP_442050.1_5 Forward -134 -124 14.3359 0.0206
NP_442050.1_5 Reverse -121 -131 9.12434 0.193
NP_442342.1_9 Reverse -21 -37 10.1866 0.137
NP_441114.1_3 Reverse -88 -97 17.1093 0.113
NP_441048.1_4 Forward -113 -94 11.2092 0.266
NP_441048.1_6 Forward -63 -49 14.4309 0.296
NP_442789.1_4 Reverse -266 -285 -2.16383 0.233
NP_442789.1_4 Forward -374 -355 -3.14714 0.246
NP_442789.1_4 Forward -179 -160 -5.60541 0.273
NP_441878.1_6 Forward -133 -123 10.4031 0.0176
NP_441878.1_6 Reverse -122 -132 10.4031 0.0176
NP_441878.1_6 Reverse -22 -32 9.41981 0.0266
NP_441878.1_6 Forward -33 -23 1.74999 0.0642
NP_441878.1_6 Reverse -170 -180 -0.0199663 0.163
NP_441878.1_6 Forward -181 -171 -7.19813 0.21
NP_441878.1_6 Forward -96 -86 -7.49312 0.231
NP_441878.1_6 Forward -306 -296 -7.68978 0.255
NP_441878.1_6 Forward -278 -268 -7.88644 0.278
NP_441036.1_8 Reverse -122 -132 17.7779 0.000554
NP_441036.1_8 Forward -133 -123 8.33817 0.174
NP_441036.1_8 Forward -195 -185 7.45319 0.197
NP_442650.1_2 Reverse -185 -199 4.71948 0.163
NP_441557.1_5 Forward -132 -123 19.9609 0.000699
NP_441557.1_5 Reverse -123 -132 19.9609 0.000699
NP_441557.1_5 Forward -194 -185 7.57121 0.049
NP_441557.1_5 Reverse -185 -194 1.08137 0.0794
NP_441557.1_5 Forward -32 -23 0.491382 0.144
NP_441557.1_5 Reverse -23 -32 0.29472 0.174
NP_441557.1_8 Reverse -299 -309 15.3192 0.183
NP_441445.1_1 Reverse -378 -397 8.25926 0.122
NP_441445.1_1 Reverse -114 -133 0.982764 0.264
NP_441445.1_1 Forward -41 -22 0.58944 0.272
NP_441590.1_4 Reverse -298 -317 2.16195 0.297
NP_442066.2_9 Forward -136 -123 8.47575 0.185
NP_442350.1_3 Forward -351 -333 16.8329 0.0854
NP_441433.1_8 Forward -131 -112 -4.03212 0.286
NP_442777.1_1 Reverse -359 -378 4.03023 0.3
NP_441308.1_8 Reverse -121 -131 10.1081 0.22
NP_441458.1_10 Reverse -114 -133 2.85105 0.261
NP_442192.1_6 Reverse -368 -382 19.4691 0.248
NP_442183.1_1 Forward -132 -118 9.93102 0.0903
NP_442183.1_1 Reverse -163 -177 7.76774 0.131
NP_442183.1_1 Reverse -185 -199 6.78443 0.161
NP_442397.1_9 Reverse -146 -165 6.68596 0.246
NP_440276.1_2 Reverse -140 -159 23.0496 0.0494
NP_441549.1_9 Forward -136 -118 -6.07737 0.198
NP_442170.1_5 Reverse -123 -142 -0.590531 0.234
NP_442347.1_2 Reverse -124 -133 12.4878 0.056
NP_442347.1_2 Forward -131 -122 11.1111 0.056
NP_442347.1_2 Reverse -271 -280 4.0313 0.284
NP_442645.1_2 Forward -140 -121 -21.6334 0.29
NP_440547.1_1 Forward -377 -358 16.6165 0.109
NP_441037.1_4 Reverse -121 -131 7.02532 0.237
NP_441037.1_4 Forward -34 -24 6.24566 0.274
NP_440151.1_2 Reverse -372 -390 19.5862 0.138
NP_441633.1_3 Forward -134 -121 10.7374 0.0286
NP_441633.1_3 Reverse -121 -134 -3.71729 0.177
NP_440136.1_2 Forward -131 -124 15.9687 0.0123
NP_440136.1_2 Reverse -124 -131 15.9687 0.0123
NP_440136.1_2 Reverse -186 -193 6.23397 0.171
NP_440136.1_2 Forward -193 -186 6.13563 0.193
NP_442590.1_10 Forward -393 -374 3.73603 0.286
NP_442998.1_5 Reverse -151 -161 10.4031 0.214
NP_442998.1_10 Forward -192 -185 15.5754 0.0102
NP_442998.1_10 Forward -130 -123 15.5754 0.0102
NP_442998.1_10 Reverse -125 -132 15.5754 0.0102
NP_442998.1_10 Reverse -350 -357 10.2655 0.0946
NP_442998.1_10 Reverse -25 -32 6.13563 0.181
NP_440731.1_2 Forward -381 -362 9.43923 0.275
NP_440899.1_2 Reverse -174 -193 5.70185 0.275
NP_440899.1_5 Reverse -90 -109 2.55606 0.283
NP_440899.1_8 Reverse -2 -21 -6.98204 0.236
NP_440299.1_1 Reverse -119 -132 17.8166 0.00525
NP_440299.1_1 Forward -361 -348 9.95012 0.0631
NP_440299.1_1 Forward -198 -185 9.06515 0.0797
NP_440299.1_1 Forward -136 -123 2.37867 0.291
NP_440299.1_1 Forward -123 -110 2.37867 0.291
NP_440299.1_1 Reverse -19 -32 2.37867 0.291
NP_441799.1_1 Forward -136 -122 13.8636 0.0293
NP_441799.1_1 Reverse -19 -33 12.782 0.04
NP_441799.1_1 Reverse -181 -195 7.3738 0.144
NP_441799.1_1 Reverse -167 -181 6.19383 0.179
NP_441799.1_1 Reverse -119 -133 5.89884 0.19
NP_441007.1_10 Forward -37 -24 4.24752 0.182
NP_441007.1_10 Forward -368 -355 1.39592 0.203
NP_441007.1_10 Reverse -180 -193 1.39592 0.203
NP_441007.1_10 Forward -185 -172 1.29759 0.203
NP_441007.1_10 Forward -137 -124 0.707601 0.219
NP_440256.1_1 Forward -135 -116 28.3188 0.000743
NP_440256.1_1 Reverse -182 -201 -7.96535 0.248
NP_441559.1_8 Reverse -105 -119 6.98109 0.0752
NP_441559.1_8 Reverse -118 -132 2.45787 0.143
NP_441559.1_8 Reverse -82 -96 -4.62196 0.231
NP_441559.1_8 Forward -100 -86 -5.60527 0.267
NP_441559.1_8 Forward -167 -153 -6.09693 0.274
NP_441559.1_8 Reverse -310 -324 -6.78525 0.279
NP_441559.1_8 Forward -199 -185 -7.67023 0.297
NP_441559.1_8 Reverse -18 -32 -7.76856 0.299
NP_441270.1_5 Forward -318 -299 12.6039 0.236
NP_441270.1_5 Forward -315 -296 12.2135 0.244
NP_440915.1_6 Forward -36 -22 11.5043 0.0256
NP_440915.1_6 Forward -136 -122 1.76955 0.131
NP_440915.1_6 Forward -99 -85 -0.0987402 0.182
NP_440915.1_6 Reverse -19 -33 -0.885388 0.212
NP_440915.1_6 Reverse -119 -133 -2.06536 0.258
NP_440717.1_1 Reverse -172 -191 4.42435 0.296
NP_442785.1_7 Forward -182 -168 10.6193 0.228
NP_441704.1_8 Reverse -112 -131 12.3883 0.122
NP_441464.1_1 Reverse -19 -38 7.47261 0.261
NP_440026.1_4 Forward -135 -116 10.4225 0.239
NP_440695.1_6 Forward -21 -7 10.8961 0.265
NP_441939.1_3 Forward -131 -112 10.7175 0.122
NP_442993.1_1 Reverse -123 -139 -7.21796 0.146
NP_442993.1_1 Reverse -23 -39 -12.1345 0.266
NP_442386.1_9 Reverse -122 -131 15.7322 0.0144
NP_442386.1_9 Forward -133 -124 13.8639 0.0289
NP_442386.1_9 Forward -195 -186 10.619 0.121
NP_442386.1_9 Reverse -320 -329 6.39082 0.219
NP_442386.1_9 Reverse -353 -362 5.11253 0.266
NP_441340.1_5 Forward -131 -124 15.6737 0.0124
NP_441340.1_5 Reverse -124 -131 15.6737 0.0124
NP_441340.1_5 Reverse -186 -193 13.5105 0.0314
NP_441340.1_5 Forward -193 -186 5.84064 0.208
NP_441340.1_5 Forward -31 -24 4.07068 0.239
NP_441340.1_5 Reverse -355 -362 3.97235 0.274
NP_441947.1_4 Reverse -112 -131 22.1239 0.0161
NP_442791.1_5 Reverse -359 -378 -7.4737 0.279
NP_442506.1_2 Forward -43 -24 1.76941 0.296
NP_442240.1_2 Forward -193 -174 -20.1584 0.295
NP_441160.1_1 Reverse -303 -322 -11.9969 0.295
NP_440586.1_8 Forward -131 -124 13.2151 0.026
NP_440586.1_8 Reverse -124 -131 13.2151 0.026
NP_440586.1_8 Forward -193 -186 9.47853 0.146
NP_440586.1_8 Reverse -24 -31 7.61025 0.227
NP_440586.1_8 Reverse -186 -193 5.74197 0.283
NP_442251.1_6 Forward -131 -124 15.2804 0.0124
NP_442251.1_6 Reverse -124 -131 15.2804 0.0124
NP_440192.1_4 Reverse -263 -282 8.62144 0.292
NP_441262.1_3 Reverse -185 -192 14.7888 0.0223
NP_441262.1_3 Reverse -123 -130 14.7888 0.0223
NP_441262.1_3 Forward -132 -125 14.7888 0.0223
NP_441262.1_3 Forward -32 -25 5.25066 0.215
NP_443051.1_1 Reverse -184 -193 16.6177 0.00754
NP_443051.1_1 Reverse -122 -131 10.4228 0.00754
NP_443051.1_1 Forward -133 -124 10.4228 0.00754
NP_443051.1_1 Forward -33 -24 6.8829 0.066
NP_439937.1_8 Forward -371 -352 -0.0988766 0.237
NP_439937.1_8 Reverse -352 -371 -1.57384 0.249
NP_439937.1_8 Reverse -115 -134 -4.6221 0.286
NP_439937.1_9 Reverse -265 -282 -8.61494 0.176
NP_439937.1_9 Reverse -85 -102 -13.5315 0.287
NP_439937.1_9 Forward -33 -16 -14.9081 0.287
NP_439937.1_9 Reverse -22 -39 -17.268 0.296
NP_440408.1_3 Forward -375 -356 -4.13045 0.264
NP_440408.1_7 Forward -381 -362 6.78429 0.299
NP_440439.1_1 Reverse -120 -133 10.639 0.0362
NP_440439.1_1 Reverse -182 -195 7.6891 0.0624
NP_440439.1_1 Forward -197 -184 3.16588 0.119
NP_440439.1_1 Forward -135 -122 1.9859 0.138
NP_440439.1_1 Forward -35 -22 0.314277 0.194
NP_440439.1_1 Forward -183 -170 0.215946 0.199
NP_439943.1_1 Forward -161 -142 -8.06369 0.263
NP_440372.1_2 Forward -131 -124 16.3621 0.0124
NP_440372.1_2 Reverse -124 -131 16.3621 0.0124
NP_440372.1_2 Reverse -186 -193 13.8055 0.0214
NP_440372.1_2 Forward -193 -186 6.52896 0.188
NP_440372.1_2 Forward -31 -24 4.07068 0.262
NP_440316.1_10 Forward -96 -86 6.8632 0.251
NP_440316.1_10 Forward -33 -23 5.97822 0.275
NP_441803.1_2 Reverse -355 -374 6.58763 0.151
NP_440139.1_1 Forward -138 -119 4.52188 0.18
NP_441572.1_7 Forward -38 -19 9.53756 0.0697
NP_441572.1_7 Reverse -179 -198 -0.590531 0.182
NP_441572.1_7 Forward -138 -119 -2.36049 0.193
NP_441572.1_7 Reverse -303 -322 -3.63879 0.217
NP_440267.1_2 Forward -137 -123 11.307 0.125
NP_442384.1_10 Forward -132 -119 17.3255 0.00599
NP_442384.1_10 Forward -32 -19 9.95071 0.047
NP_442384.1_10 Forward -194 -181 4.93583 0.142
NP_442384.1_10 Reverse -123 -136 4.54251 0.153
NP_442384.1_10 Forward -396 -383 2.37923 0.228
NP_441018.1_7 Forward -136 -117 6.58763 0.285
NP_441018.1_7 Reverse -181 -200 6.4893 0.286
NP_442790.1_4 Reverse -114 -133 -15.0452 0.284
NP_442262.1_10 Forward -131 -124 14.1988 0.0123
NP_442262.1_10 Reverse -124 -131 14.1988 0.0123
NP_442262.1_10 Forward -193 -186 13.2155 0.0213
NP_442262.1_10 Reverse -24 -31 10.6589 0.14
NP_441689.1_5 Reverse -121 -131 8.53436 0.132
NP_441689.1_5 Forward -134 -124 5.78111 0.197
NP_441689.1_5 Reverse -183 -193 5.78111 0.197
NP_440344.1_10 Reverse -116 -133 9.97027 0.00774
NP_440344.1_10 Reverse -353 -370 -9.59759 0.15
NP_440531.1_6 Forward -188 -169 2.55606 0.154
NP_440531.1_6 Reverse -115 -134 2.45773 0.157
NP_440531.1_6 Reverse -177 -196 -4.81876 0.287
NP_440487.1_1 Forward -135 -116 -5.11376 0.214
NP_440562.1_3 Reverse -124 -141 6.82368 0.15
NP_440562.1_3 Forward -276 -259 4.56207 0.192
NP_441965.1_10 Reverse -120 -136 1.92682 0.297
NP_440297.1_9 Forward -131 -121 9.32148 0.0917
NP_440297.1_9 Reverse -355 -365 0.471689 0.282
NP_440297.1_9 Reverse -186 -196 -0.118297 0.282
NP_440297.1_9 Reverse -124 -134 -0.118297 0.282
NP_440297.1_9 Forward -31 -21 -0.41329 0.283
NP_442280.1_10 Reverse -368 -386 5.64923 0.283
NP_441592.1_4 Reverse -123 -142 0.982764 0.225
NP_441592.1_4 Reverse -93 -112 -0.000545616 0.237
NP_440894.1_10 Reverse -70 -89 6.78429 0.211
NP_440894.1_10 Reverse -355 -374 5.60432 0.228
NP_440894.1_10 Reverse -291 -310 4.03102 0.259
NP_440894.1_10 Forward -282 -263 3.24438 0.276
NP_442067.1_4 Reverse -112 -131 2.26107 0.298
NP_440999.1_9 Reverse -119 -133 12.1926 0.0414
NP_440999.1_9 Forward -198 -184 -0.492064 0.209
NP_440888.1_2 Forward -132 -118 19.5668 0.00119
NP_440888.1_2 Reverse -123 -137 17.4035 0.00402
NP_440888.1_2 Reverse -23 -37 12.192 0.0495
NP_440052.1_5 Reverse -112 -131 -2.0655 0.212
NP_439969.1_3 Reverse -118 -137 6.19431 0.176
NP_439969.1_3 Forward -37 -18 0.884433 0.263
NP_442277.1_4 Reverse -114 -133 10.0284 0.0975
NP_442033.1_10 Reverse -84 -103 -11.3086 0.251
NP_441543.1_2 Forward -131 -122 18.486 0.00236
NP_441543.1_2 Reverse -124 -133 16.9127 0.00359
NP_441543.1_2 Forward -193 -184 6.09625 0.153
NP_441543.1_3 Reverse -295 -309 10.8154 0.212
NP_442845.1_2 Forward -38 -24 13.3726 0.0955
NP_442845.1_2 Forward -132 -118 7.47274 0.195
NP_442845.1_2 Forward -138 -124 3.63784 0.282
NP_441551.1_5 Reverse -19 -35 8.41597 0.238
NP_441551.1_5 Forward -198 -182 8.02265 0.241
NP_441178.1_6 Reverse -293 -312 15.8299 0.177
NP_441469.1_8 Reverse -122 -131 16.126 0.00797
NP_441469.1_8 Forward -364 -355 13.5694 0.073
NP_441469.1_8 Forward -96 -87 9.4395 0.227
NP_441469.1_8 Reverse -359 -368 7.86621 0.227
NP_441469.1_8 Forward -195 -186 6.68623 0.227
NP_441469.1_8 Forward -133 -124 6.48957 0.227
NP_443064.1_6 Reverse -123 -133 12.5669 0.0796
NP_442578.1_3 Forward -38 -19 19.3761 0.223
NP_442578.1_7 Forward -131 -124 14.5921 0.026
NP_442578.1_7 Reverse -124 -131 14.5921 0.026
NP_442578.1_7 Reverse -186 -193 6.0373 0.18
NP_440071.1_4 Reverse -296 -315 11.8975 0.268
NP_441462.1_2 Forward -132 -122 11.5831 0.00406
NP_441462.1_2 Reverse -123 -133 11.5831 0.00406
NP_441462.1_2 Forward -32 -22 8.63316 0.0339
NP_441462.1_2 Reverse -185 -195 0.963343 0.109
NP_441462.1_2 Reverse -23 -33 0.57002 0.144
NP_441462.1_2 Forward -194 -184 0.57002 0.144
NP_441462.1_2 Forward -180 -170 -0.904945 0.265
NP_441621.1_7 Forward -196 -182 -4.81863 0.246
NP_443062.1_1 Reverse -23 -41 7.86337 0.166
NP_443062.1_1 Forward -335 -317 7.66836 0.17
NP_443062.1_1 Reverse -185 -203 3.76806 0.285
NP_440519.1_6 Reverse -18 -32 11.8976 0.29
NP_442204.1_1 Reverse -181 -192 11.2684 0.0565
NP_442204.1_1 Reverse -119 -130 7.92515 0.108
NP_442204.1_5 Reverse -113 -132 14.0608 0.0517
NP_441351.1_8 Reverse -121 -140 0.982764 0.276
NP_440516.1_2 Forward -200 -182 7.78729 0.116
NP_440516.1_2 Reverse -104 -122 3.55906 0.147
NP_440516.1_8 Forward -132 -123 16.9127 0.00442
NP_440516.1_8 Reverse -123 -132 16.9127 0.00442
NP_440516.1_8 Reverse -185 -194 9.53783 0.0136
NP_440516.1_8 Forward -32 -23 7.17789 0.0754
NP_440516.1_8 Forward -194 -185 5.01461 0.118
NP_440516.1_8 Reverse -23 -32 5.01461 0.118
NP_442428.1_5 Forward -131 -124 15.8704 0.0124
NP_442428.1_5 Reverse -124 -131 15.8704 0.0124
NP_442428.1_5 Reverse -186 -193 6.13563 0.209
NP_442428.1_5 Forward -193 -186 6.0373 0.212
NP_442428.1_5 Forward -362 -355 4.759 0.223
NP_442428.1_5 Forward -31 -24 4.46401 0.267
NP_442428.1_8 Forward -313 -294 -0.000545616 0.258
NP_442120.1_10 Forward -375 -356 -3.54046 0.199
NP_442823.1_8 Reverse -152 -171 11.7992 0.279
NP_441867.1_2 Forward -378 -359 -20.3551 0.291
NP_440673.1_3 Forward -192 -185 12.4288 0.0426
NP_440673.1_3 Forward -130 -123 12.4288 0.0426
NP_440673.1_3 Reverse -125 -132 12.4288 0.0426
NP_440673.1_3 Reverse -25 -32 11.6422 0.0724
NP_440673.1_3 Reverse -368 -375 6.23397 0.283
NP_440673.1_7 Forward -130 -111 0.982764 0.258
NP_441052.1_2 Reverse -123 -133 19.9412 0.00106
NP_441052.1_2 Forward -132 -122 10.5014 0.0285
NP_442219.1_8 Reverse -119 -138 8.26374 0.251
NP_442219.1_9 Reverse -124 -133 17.7976 0.00718
NP_442219.1_9 Forward -131 -122 8.35786 0.0681
NP_440436.1_4 Forward -131 -122 18.1905 0.00233
NP_440436.1_4 Reverse -124 -133 17.2072 0.00233
NP_441884.1_9 Forward -135 -116 -3.14714 0.0594
NP_441884.1_9 Reverse -293 -312 -21.9284 0.272
NP_440314.1_9 Reverse -24 -43 -9.53865 0.269
NP_441719.1_4 Forward -131 -124 16.3621 0.0124
NP_441719.1_4 Reverse -124 -131 16.3621 0.0124
NP_441719.1_4 Reverse -186 -193 6.82395 0.0855
NP_441719.1_4 Forward -193 -186 6.52896 0.188
NP_441733.1_10 Forward -135 -122 9.85238 0.106
NP_441733.1_10 Forward -35 -22 5.03416 0.231
NP_441004.1_1 Forward -375 -356 -7.96535 0.2
NP_441004.1_1 Forward -125 -106 -14.5535 0.268
NP_441004.1_1 Forward -311 -292 -17.1101 0.289
NP_441004.1_2 Reverse -161 -180 -4.32711 0.29
NP_442366.1_3 Forward -133 -115 -1.35749 0.211
NP_442873.1_2 Reverse -106 -125 9.7334 0.266
NP_442873.1_3 Forward -127 -108 9.43841 0.182
NP_440296.1_10 Forward -308 -289 -14.6519 0.27
NP_441115.1_4 Reverse -122 -140 7.49153 0.286
NP_442206.1_10 Reverse -185 -200 8.92802 0.167
NP_443054.1_2 Reverse -121 -135 3.44117 0.24
NP_443054.1_2 Reverse -21 -35 2.85119 0.24
NP_443054.1_2 Reverse -162 -176 2.2612 0.245
NP_443054.1_2 Forward -134 -120 0.982901 0.251
NP_442430.1_10 Reverse -256 -275 10.3234 0.262
NP_441966.1_6 Reverse -83 -102 6.09597 0.289
NP_440508.1_4 Forward -38 -19 12.1925 0.256
NP_440508.1_4 Forward -186 -167 11.4058 0.256
NP_441851.1_9 Forward -308 -289 10.3242 0.239
NP_441851.1_10 Reverse -122 -132 16.008 0.00552
NP_441851.1_10 Forward -133 -123 15.8113 0.00552
NP_441851.1_10 Forward -195 -185 4.60159 0.259
NP_442856.1_7 Reverse -114 -133 5.80098 0.13
NP_442515.1_1 Forward -133 -119 2.16287 0.141
NP_442515.1_1 Reverse -122 -136 0.982901 0.174
NP_442515.1_1 Reverse -267 -281 -3.147 0.287
NP_441683.1_7 Forward -308 -289 -12.8819 0.3
NP_440165.1_5 Forward -195 -176 -8.16202 0.292
NP_441046.1_2 Forward -43 -24 -1.86883 0.292
NP_440940.1_7 Reverse -113 -131 4.14829 0.261
NP_441349.1_10 Forward -142 -123 7.17762 0.0326
NP_441661.1_3 Reverse -306 -323 -4.87771 0.251
NP_441409.1_6 Reverse -117 -136 -0.688862 0.0713
NP_441409.1_6 Forward -200 -181 -4.13045 0.0893
NP_440389.1_5 Forward -187 -168 15.8859 0.194
NP_441107.1_10 Reverse -353 -367 17.8958 0.231
NP_440432.1_9 Reverse -124 -139 4.69978 0.0652
NP_442843.1_1 Forward -125 -106 -5.80207 0.244
NP_440474.1_8 Reverse -355 -369 6.39049 0.227
NP_440474.1_8 Forward -131 -117 4.71887 0.268
NP_440431.1_3 Reverse -313 -332 -8.85033 0.239
NP_442450.1_5 Reverse -121 -131 9.32148 0.115
NP_440588.1_2 Forward -141 -122 -2.0655 0.16
NP_440588.1_2 Forward -327 -308 -6.29373 0.276
NP_441031.1_6 Forward -193 -174 3.83436 0.194
NP_442006.1_2 Forward -314 -297 -6.15601 0.158
NP_442006.1_2 Forward -381 -364 -15.5958 0.228
NP_442006.1_2 Forward -305 -288 -18.2507 0.289
NP_441570.1_1 Forward -132 -114 1.29745 0.0315
NP_441570.1_1 Forward -324 -306 -16.4021 0.245
NP_441078.1_4 Forward -132 -123 19.6659 0.0007
NP_441078.1_4 Reverse -123 -132 19.6659 0.0007
NP_441078.1_4 Forward -32 -23 7.66954 0.052
NP_441078.1_4 Reverse -110 -119 5.80125 0.104
NP_441078.1_4 Reverse -23 -32 0.491382 0.188
NP_441078.1_4 Reverse -185 -194 0.196389 0.205
NP_441078.1_4 Forward -194 -185 -0.000272808 0.205
NP_441078.1_4 Reverse -348 -357 -1.37691 0.254
NP_441078.1_4 Forward -180 -171 -1.86856 0.272
NP_442729.1_7 Forward -325 -307 5.91901 0.286
NP_442729.1_8 Reverse -119 -132 8.18076 0.125
NP_440707.1_6 Reverse -102 -121 11.6017 0.254
NP_442443.1_1 Forward -188 -169 -4.13045 0.268
NP_442443.1_1 Reverse -102 -121 -6.58872 0.295
NP_440526.1_3 Reverse -124 -135 10.2846 0.0646
NP_440526.1_3 Reverse -24 -35 2.02482 0.267
NP_441432.1_8 Forward -133 -124 16.8143 0.00595
NP_441432.1_8 Reverse -184 -193 14.0611 0.0258
NP_441432.1_8 Forward -33 -24 11.3078 0.0569
NP_441432.1_8 Forward -181 -172 8.55452 0.0755
NP_441432.1_8 Reverse -122 -131 8.25953 0.0755
NP_442320.1_8 Forward -138 -124 13.4709 0.0144
NP_442320.1_8 Reverse -117 -131 5.01447 0.0442
NP_442344.1_7 Reverse -124 -143 -7.4737 0.183
NP_441732.1_2 Reverse -119 -135 1.92682 0.0254
NP_441732.1_2 Reverse -344 -360 1.43517 0.0402
NP_440497.1_2 Forward -374 -355 5.40766 0.287
NP_440497.1_6 Reverse -180 -199 3.83436 0.227
NP_442797.1_7 Reverse -116 -134 3.95239 0.234
NP_440199.1_10 Reverse -120 -130 13.2547 0.108
NP_440199.1_10 Forward -135 -125 7.25653 0.231
NP_440913.1_1 Forward -377 -359 9.45892 0.178
NP_440913.1_1 Forward -134 -116 4.44404 0.268
NP_441023.1_1 Forward -194 -176 12.3105 0.233
NP_441072.1_2 Forward -43 -24 8.06259 0.24
NP_440713.1_4 Reverse -305 -324 9.24257 0.152
NP_442489.1_7 Forward -132 -123 20.1576 0.000695
NP_442489.1_7 Reverse -123 -132 20.1576 0.000695
NP_442489.1_7 Forward -32 -23 8.1612 0.0294
NP_442489.1_7 Forward -194 -185 0.688044 0.152
NP_442489.1_7 Reverse -185 -194 0.688044 0.152
NP_442489.1_7 Reverse -23 -32 0.688044 0.152
NP_442489.1_7 Forward -180 -171 -1.37691 0.195
NP_440559.1_1 Reverse -124 -133 17.4043 0.00658
NP_440559.1_1 Forward -131 -122 8.75118 0.0586
NP_440559.1_1 Reverse -186 -195 5.11294 0.151
NP_440559.1_1 Forward -31 -22 4.81794 0.193
NP_441659.2_8 Reverse -123 -133 18.1713 0.00133
NP_441659.2_8 Reverse -23 -33 15.713 0.00515
NP_441659.2_8 Forward -132 -122 11.9764 0.0147
NP_441659.2_8 Forward -194 -184 8.23984 0.0462
NP_441659.2_8 Reverse -171 -181 6.37155 0.0774
NP_441659.2_8 Forward -32 -22 0.0783647 0.277
NP_442913.1_1 Reverse -147 -166 2.55606 0.294
NP_442913.1_10 Reverse -114 -133 -5.50708 0.268
NP_441040.1_2 Forward -189 -170 1.0811 0.119
NP_442849.1_1 Forward -308 -294 8.55439 0.282
NP_442008.1_2 Reverse -381 -400 5.89931 0.223
NP_441800.1_7 Reverse -349 -367 -1.45582 0.242
NP_441807.1_5 Reverse -174 -193 17.994 0.0884
NP_442776.1_1 Reverse -315 -334 5.50599 0.241
NP_442776.1_6 Reverse -312 -331 10.0292 0.213
NP_440779.1_5 Reverse -296 -313 -15.0058 0.3
NP_442346.1_5 Forward -133 -123 16.6963 0.00248
NP_442346.1_5 Reverse -122 -132 9.02648 0.118
NP_442346.1_5 Reverse -22 -32 6.96153 0.187
NP_442346.1_5 Reverse -353 -363 6.56821 0.198
NP_442346.1_5 Forward -33 -23 6.37155 0.205
NP_442346.1_5 Reverse -184 -194 5.87989 0.225
NP_440545.1_3 Forward -136 -119 3.0871 0.089
NP_440545.1_3 Reverse -167 -184 1.61214 0.116
NP_440545.1_3 Reverse -19 -36 -3.10775 0.199
NP_440545.1_3 Reverse -181 -198 -4.38605 0.224
NP_440545.1_3 Forward -36 -19 -4.97604 0.237
NP_440545.1_3 Forward -198 -181 -6.54933 0.283
NP_440545.1_3 Forward -361 -344 -7.04099 0.295
NP_440545.1_9 Forward -109 -90 10.2259 0.235
NP_440025.1_1 Forward -136 -117 17.994 0.139
NP_440459.1_2 Reverse -114 -131 9.08529 0.239
NP_440459.1_2 Forward -141 -124 7.41366 0.291
NP_440010.1_3 Forward -192 -173 2.65439 0.207
NP_440010.1_4 Forward -136 -117 0.883656 0.243
NP_440010.1_4 Forward -376 -357 0.293673 0.25
NP_440010.1_4 Reverse -356 -375 -2.06626 0.273
NP_440010.1_10 Forward -282 -263 12.0942 0.192
NP_442603.1_7 Forward -132 -118 13.372 0.089
NP_442603.1_9 Reverse -157 -175 10.8356 0.189
NP_441888.1_7 Reverse -118 -132 4.12949 0.225
NP_440449.1_6 Reverse -163 -181 6.89415 0.239
NP_441948.1_4 Reverse -116 -134 6.70565 0.0633
NP_442754.1_5 Forward -281 -262 14.0599 0.271
NP_441833.1_4 Forward -131 -124 15.9687 0.0124
NP_441833.1_4 Reverse -124 -131 15.9687 0.0124
NP_441833.1_4 Forward -193 -186 6.52896 0.0924
NP_441833.1_4 Reverse -186 -193 6.23397 0.163
NP_441329.1_6 Reverse -140 -159 1.38421 0.239
NP_441329.1_6 Reverse -138 -157 -2.14899 0.293
NP_441112.1_6 Reverse -113 -132 0.392778 0.278
NP_442162.1_9 Forward -131 -124 16.2637 0.0124
NP_442162.1_9 Reverse -124 -131 16.2637 0.0124
NP_442162.1_9 Forward -193 -186 12.9205 0.0282
NP_442162.1_9 Reverse -186 -193 12.9205 0.0282
NP_440671.1_4 Forward -200 -186 15.1426 0.049
NP_440671.1_4 Forward -375 -361 13.8643 0.0748
NP_442404.1_9 Reverse -351 -365 10.1271 0.263
NP_440224.1_1 Forward -143 -124 18.7807 0.0138
NP_441973.1_1 Reverse -375 -390 -7.98491 0.293
NP_442140.1_3 Reverse -124 -134 10.3048 0.0902
NP_442140.1_3 Forward -131 -121 8.33817 0.119
NP_442723.1_1 Reverse -289 -308 6.1935 0.276
NP_442723.1_1 Reverse -288 -307 3.9319 0.276
NP_440875.1_9 Forward -192 -182 16.5483 0.0145
NP_440875.1_9 Reverse -25 -35 13.1415 0.0803
NP_440875.1_9 Reverse -125 -135 7.69067 0.255
NP_440875.1_9 Forward -273 -263 7.496 0.262
NP_441813.1_5 Forward -134 -124 18.1713 0.00743
NP_441813.1_5 Reverse -121 -131 17.188 0.00979
NP_441813.1_5 Forward -196 -186 13.2547 0.0178
NP_441813.1_5 Reverse -183 -193 8.4365 0.0432
NP_441813.1_5 Reverse -21 -31 5.38824 0.13
NP_440590.1_4 Forward -131 -118 13.3923 0.013
NP_440590.1_4 Reverse -124 -137 11.229 0.0216
NP_440590.1_4 Reverse -349 -362 -0.570702 0.192
NP_440590.1_4 Reverse -186 -199 -3.32397 0.255
NP_440590.1_4 Forward -118 -105 -5.38892 0.277
NP_440567.1_1 Forward -131 -117 15.6342 0.017
NP_440567.1_1 Reverse -124 -138 1.67122 0.196
NP_442497.1_10 Forward -131 -122 10.4228 0.0087
NP_442497.1_10 Reverse -124 -133 10.4228 0.0087
NP_442497.1_10 Forward -193 -184 7.76787 0.0731
NP_442497.1_10 Forward -31 -22 0.393051 0.175
NP_442497.1_10 Reverse -186 -195 -1.18024 0.256
NP_440821.1_4 Reverse -121 -131 19.0562 0.00399
NP_440821.1_4 Forward -134 -124 9.41981 0.0286
NP_440821.1_4 Forward -196 -186 8.63316 0.0454
NP_440821.1_4 Forward -365 -355 -0.708283 0.287
NP_441239.1_9 Reverse -121 -133 13.3137 0.037
NP_441239.1_9 Forward -196 -184 12.0354 0.0512
NP_441239.1_9 Reverse -21 -33 11.937 0.0529
NP_441239.1_9 Forward -174 -162 8.79043 0.122
NP_441239.1_9 Forward -34 -22 8.20045 0.141
NP_441239.1_9 Forward -134 -122 7.80712 0.148
NP_441239.1_9 Reverse -294 -306 5.84051 0.206
NP_441239.1_9 Reverse -84 -96 3.97222 0.269
NP_441239.1_9 Forward -272 -260 3.67722 0.279
NP_441951.1_4 Forward -132 -113 4.42435 0.273
NP_442568.1_8 Reverse -141 -155 9.14437 0.26
NP_441727.1_3 Reverse -164 -183 4.52268 0.262
NP_441892.1_1 Reverse -114 -131 4.26707 0.113
NP_441892.1_1 Forward -314 -297 -5.86102 0.29
NP_440665.1_1 Reverse -111 -130 -12.1936 0.244
NP_440665.1_2 Forward -389 -370 0.687771 0.188
NP_440796.1_3 Reverse -116 -134 15.358 0.187
NP_441017.1_6 Reverse -119 -133 14.7486 0.138
NP_440863.1_1 Reverse -136 -150 13.3215 0.263
NP_440876.1_5 Reverse -270 -289 6.58763 0.283
NP_440354.1_7 Forward -132 -114 9.75391 0.224
NP_441617.1_6 Forward -162 -143 -1.27885 0.256
NP_442052.1_8 Forward -97 -87 13.1564 0.253
NP_440546.1_4 Forward -32 -22 13.2456 0.0557
NP_440546.1_4 Forward -132 -122 11.8882 0.0679
NP_440546.1_4 Reverse -123 -133 10.046 0.109
NP_440546.1_4 Reverse -23 -33 9.27034 0.146
NP_442041.1_5 Reverse -361 -380 1.27776 0.257
NP_441230.1_5 Forward -137 -118 5.70265 0.182
NP_440462.1_6 Reverse -121 -131 15.418 0.0142
NP_440462.1_6 Forward -134 -124 9.61647 0.0429
NP_440462.1_6 Reverse -183 -193 9.22315 0.049
NP_440462.1_6 Forward -196 -186 3.81494 0.228
NP_442340.1_3 Reverse -298 -317 -10.0303 0.278
NP_442611.1_1 Forward -194 -175 -0.0988766 0.266
NP_442592.1_2 Forward -323 -304 3.83436 0.297
NP_440868.1_4 Reverse -181 -193 14.4936 0.0176
NP_440868.1_4 Reverse -119 -131 11.2487 0.0327
NP_440868.1_4 Forward -136 -124 7.80712 0.0637
NP_442402.1_4 Forward -326 -307 -9.14605 0.285
NP_441084.1_6 Reverse -144 -158 11.1863 0.214
NP_440653.1_10 Reverse -315 -334 6.58763 0.203
NP_440696.1_6 Forward -107 -88 3.14605 0.288
NP_441843.2_9 Reverse -125 -143 17.884 0.0976
NP_442039.1_4 Forward -131 -124 15.1821 0.0124
NP_442039.1_4 Reverse -124 -131 15.1821 0.0124
NP_442039.1_4 Reverse -186 -193 11.6422 0.0747
NP_441811.1_1 Forward -322 -303 4.81767 0.28
NP_442679.1_1 Forward -57 -38 -1.18052 0.226
NP_441926.1_3 Reverse -123 -139 5.46674 0.17
NP_442837.1_3 Forward -131 -124 15.7721 0.0124
NP_442837.1_3 Reverse -124 -131 15.7721 0.0124
NP_442837.1_3 Forward -193 -186 6.0373 0.25
NP_442837.1_3 Reverse -186 -193 6.0373 0.25
NP_441760.1_7 Reverse -88 -106 10.4422 0.234
NP_440160.1_2 Forward -276 -257 -3.04881 0.252
NP_440160.1_2 Reverse -309 -328 -9.047 0.293
NP_442053.1_1 Forward -132 -123 18.3876 0.0007
NP_442053.1_1 Reverse -123 -132 18.3876 0.0007
NP_442053.1_1 Forward -194 -185 7.07956 0.105
NP_442053.1_1 Reverse -23 -32 6.78456 0.115
NP_440505.1_3 Forward -134 -124 18.3679 0.00213
NP_440505.1_3 Reverse -183 -193 15.6147 0.0106
NP_440505.1_3 Reverse -121 -131 13.8447 0.0247
NP_440505.1_3 Forward -34 -24 4.79825 0.266
NP_442360.1_5 Forward -329 -319 14.3364 0.233
NP_441701.1_3 Forward -42 -25 6.72535 0.275
NP_441252.1_6 Forward -326 -319 11.6422 0.288
NP_441203.1_1 Forward -131 -112 -10.7186 0.137
NP_441408.2_7 Reverse -144 -163 -5.70374 0.299
NP_440914.1_1 Reverse -123 -133 17.5935 0.000537
NP_440914.1_1 Forward -95 -85 11.3477 0.097
NP_440914.1_1 Forward -132 -122 8.6151 0.186
NP_440914.1_1 Forward -21 -11 7.83437 0.219
NP_441011.1_8 Forward -131 -122 16.9127 0.00602
NP_441011.1_8 Reverse -124 -133 8.25953 0.144
NP_441011.1_8 Forward -31 -22 7.27622 0.179
NP_441011.1_8 Forward -193 -184 6.78456 0.184
NP_441011.1_8 Reverse -186 -195 5.70292 0.237
NP_442101.1_10 Reverse -177 -196 -12.7836 0.277
NP_442101.1_10 Forward -140 -121 -13.0786 0.285
NP_440303.1_9 Reverse -307 -326 14.2566 0.168
NP_442533.1_1 Reverse -251 -270 -11.2103 0.236
NP_442533.1_1 Forward -135 -116 -15.7335 0.257
NP_442533.1_6 Forward -132 -123 17.2076 0.00137
NP_442533.1_6 Reverse -123 -132 17.2076 0.00137
NP_442533.1_6 Reverse -23 -32 14.5527 0.0116
NP_442533.1_6 Forward -32 -23 6.48957 0.109
NP_442533.1_6 Reverse -171 -180 5.3096 0.145
NP_442533.1_6 Forward -194 -185 4.42462 0.179
NP_441089.1_10 Reverse -174 -193 6.78429 0.214
NP_439981.1_9 Reverse -91 -110 15.5357 0.227
NP_442232.1_3 Forward -326 -307 -15.0452 0.288
NP_441482.1_7 Reverse -117 -131 -8.75187 0.193
NP_441482.1_7 Forward -200 -186 -10.8168 0.216
NP_441482.1_7 Reverse -17 -31 -12.3901 0.295
NP_439944.1_9 Reverse -124 -134 10.5014 0.0887
NP_439944.1_9 Forward -131 -121 10.3048 0.0887
NP_441028.1_6 Reverse -291 -301 7.35439 0.229
NP_442202.1_4 Forward -134 -120 14.7744 0.203
NP_442202.1_10 Reverse -170 -184 13.0776 0.235
NP_442202.1_10 Reverse -22 -36 3.8345 0.278
NP_440116.1_5 Reverse -38 -55 2.10379 0.282
NP_441527.1_4 Reverse -141 -160 -0.143661 0.145
NP_441527.1_4 Reverse -142 -161 -12.7486 0.293
NP_441527.1_4 Reverse -140 -159 -13.1306 0.298
NP_440115.1_6 Reverse -182 -192 14.0414 0.0615
NP_440115.1_6 Forward -135 -125 6.8632 0.167
NP_440007.1_9 Reverse -181 -195 5.99778 0.238
NP_440007.1_9 Forward -99 -85 3.53951 0.269
NP_439965.1_1 Reverse -114 -133 -9.34199 0.286
NP_441680.1_4 Reverse -295 -314 -0.787193 0.256
NP_441972.1_5 Forward -374 -355 -4.72043 0.211
NP_441972.1_5 Reverse -297 -316 -4.81876 0.211
NP_441972.1_5 Reverse -349 -368 -9.83364 0.293
NP_441106.1_1 Reverse -122 -131 18.191 0.0028
NP_441106.1_1 Forward -133 -124 9.63616 0.0311
NP_441106.1_1 Reverse -184 -193 8.75118 0.0469
NP_441106.1_1 Forward -33 -24 5.60459 0.141
NP_001035870.1_3 Reverse -174 -193 -4.81876 0.278
NP_442306.1_10 Forward -185 -166 -21.9284 0.296
NP_441286.1_1 Forward -133 -121 14.4936 0.00418
NP_441286.1_1 Reverse -122 -134 3.38223 0.0467
NP_440670.1_8 Forward -132 -123 18.3876 0.000699
NP_440670.1_8 Reverse -123 -132 18.3876 0.000699
NP_440670.1_8 Reverse -185 -194 16.0277 0.00443
NP_440670.1_8 Forward -194 -185 12.5861 0.0253
NP_440670.1_8 Forward -32 -23 8.55452 0.066
NP_440670.1_8 Reverse -23 -32 5.99792 0.13
NP_441930.1_2 Forward -96 -86 14.3364 0.226
NP_441930.1_2 Reverse -86 -96 12.7631 0.253
NP_440886.1_7 Reverse -122 -132 17.7774 0.0011
NP_440886.1_7 Forward -133 -123 7.94438 0.0805
NP_440886.1_7 Forward -195 -185 7.64939 0.0865
NP_440886.1_7 Reverse -22 -32 6.46942 0.123
NP_440886.1_7 Reverse -359 -369 5.19112 0.194
NP_440886.1_7 Reverse -109 -119 4.7978 0.218
NP_440886.1_7 Reverse -116 -126 4.50281 0.232
NP_440828.1_1 Reverse -350 -369 1.08032 0.256
NP_440828.1_1 Reverse -298 -317 -0.591301 0.274
NP_442614.1_2 Forward -32 -18 13.9626 0.11
NP_442614.1_2 Reverse -123 -137 5.70279 0.298
NP_442072.1_9 Reverse -22 -40 -2.53746 0.0317
NP_442072.1_9 Reverse -122 -140 -20.3354 0.204
NP_442072.1_9 Forward -133 -115 -22.892 0.266
NP_440513.1_4 Forward -194 -175 7.96426 0.295
NP_441753.1_10 Reverse -114 -133 4.81767 0.193
NP_440028.1_6 Forward -374 -356 13.7855 0.218
NP_440907.2_8 Forward -193 -183 7.84605 0.117
NP_440907.2_8 Forward -131 -121 7.84605 0.117
NP_440907.2_8 Reverse -24 -34 7.74772 0.117
NP_442264.1_2 Forward -136 -119 4.75873 0.293
NP_439967.1_1 Reverse -297 -315 17.1287 0.122
NP_441021.1_8 Forward -137 -119 4.6407 0.222
NP_442459.1_8 Forward -368 -349 10.2259 0.202
NP_441463.1_3 Forward -142 -123 -9.73531 0.284
NP_441463.1_5 Reverse -122 -136 13.4709 0.188
NP_441626.1_2 Forward -131 -124 15.7721 0.0124
NP_441626.1_2 Reverse -124 -131 15.7721 0.0124
NP_441626.1_2 Reverse -186 -193 12.2322 0.0511
NP_441626.1_2 Forward -193 -186 5.93897 0.231
NP_440107.1_2 Reverse -118 -137 7.86593 0.299
NP_440107.1_5 Forward -133 -114 0.982764 0.178
NP_442794.1_1 Forward -198 -186 6.92215 0.154
NP_442615.1_1 Forward -141 -123 8.47561 0.0284
NP_442615.1_1 Forward -41 -23 -6.4707 0.248
NP_442467.1_6 Reverse -299 -318 19.0748 0.0637
NP_440387.1_1 Forward -132 -116 6.64671 0.0282
NP_440387.1_1 Forward -357 -341 -6.13632 0.268
NP_440855.1_3 Forward -145 -126 7.27514 0.247
NP_441431.1_2 Reverse -20 -34 10.8154 0.153
NP_441431.1_2 Reverse -168 -182 5.89884 0.284
NP_441488.1_8 Reverse -180 -194 8.25877 0.199
NP_441488.1_8 Forward -268 -254 7.57046 0.241
NP_441836.1_2 Forward -38 -19 -6.49039 0.298
NP_440634.1_8 Reverse -299 -318 6.98015 0.285
NP_441993.1_1 Forward -38 -19 0.582284 0.297
NP_441174.1_1 Forward -117 -102 11.288 0.254
NP_440814.1_4 Forward -41 -22 -13.5702 0.293
NP_440814.1_8 Forward -302 -283 0.687771 0.269
NP_440814.1_8 Forward -308 -289 -1.47551 0.299
NP_442805.1_5 Forward -204 -185 -5.60616 0.277
NP_440114.1_10 Reverse -123 -137 10.4227 0.148
NP_440114.1_10 Reverse -23 -37 8.94771 0.19
NP_440114.1_10 Forward -180 -166 6.3911 0.273
NP_440114.1_10 Forward -132 -118 5.70279 0.296
NP_442698.1_10 Forward -309 -290 17.994 0.0823
NP_442698.1_10 Forward -66 -47 -1.47551 0.299
NP_442323.1_7 Reverse -180 -199 3.34192 0.245
NP_441510.2_7 Reverse -117 -131 10.1271 0.281
NP_441510.2_7 Reverse -111 -125 9.34041 0.287
NP_440293.1_1 Forward -188 -169 14.4541 0.162
NP_440293.1_10 Forward -189 -170 0.786102 0.219
NP_440766.1_4 Reverse -119 -133 8.25939 0.0871
NP_440766.1_4 Forward -130 -116 2.35953 0.187
NP_440766.1_4 Forward -198 -184 0.491246 0.28
NP_441237.1_9 Reverse -87 -97 13.353 0.0848
NP_442743.1_4 Forward -131 -112 -5.11376 0.257
NP_442743.1_5 Forward -131 -112 6.19431 0.194
NP_441531.1_7 Forward -292 -273 14.3558 0.272
NP_439910.1_2 Forward -202 -185 -3.40274 0.0452
NP_439910.1_2 Forward -140 -123 -12.7442 0.0944
NP_439911.1_6 Reverse -309 -328 14.9458 0.0619
NP_440457.1_1 Reverse -119 -131 8.88877 0.101
NP_440457.1_1 Forward -309 -297 4.75886 0.154
NP_440457.1_1 Reverse -181 -193 2.89058 0.205
NP_440457.1_1 Reverse -19 -31 0.333971 0.25
NP_440457.1_1 Forward -136 -124 -0.649339 0.271
NP_440798.1_6 Forward -131 -118 6.1158 0.14
NP_440798.1_6 Forward -193 -180 1.10092 0.234
NP_441984.1_3 Forward -281 -263 5.03403 0.295
NP_441332.1_6 Reverse -298 -308 11.9372 0.239
NP_441332.1_6 Reverse -359 -369 11.1627 0.269
NP_440473.1_3 Reverse -355 -374 14.3558 0.287
NP_440473.1_9 Reverse -106 -125 -7.67036 0.238
NP_440473.1_9 Forward -383 -364 -8.85033 0.259
NP_442509.1_5 Reverse -307 -324 13.1161 0.265
NP_442509.1_9 Forward -132 -122 16.2041 0.00739
NP_442509.1_9 Reverse -185 -195 9.71433 0.192
NP_442509.1_9 Reverse -123 -133 8.14104 0.192
NP_442514.1_5 Reverse -296 -315 11.0117 0.071
NP_442514.1_5 Reverse -85 -104 -9.63771 0.297
NP_440554.1_4 Forward -193 -183 15.0247 0.02
NP_440554.1_4 Forward -131 -121 14.6313 0.02
NP_440554.1_4 Reverse -24 -34 9.51814 0.0646
NP_440554.1_4 Reverse -124 -134 8.92815 0.0646
NP_440554.1_4 Reverse -186 -196 6.17489 0.126
NP_440554.1_4 Reverse -355 -365 3.42162 0.23
NP_441885.1_5 Reverse -123 -133 20.9245 0.000538
NP_441885.1_5 Forward -132 -122 11.4848 0.00668
NP_441885.1_5 Reverse -348 -358 0.176696 0.177
NP_441885.1_5 Reverse -185 -195 0.0783647 0.183
NP_441885.1_5 Forward -32 -22 -0.609952 0.215
NP_441885.1_5 Reverse -110 -120 -1.78992 0.284
NP_442341.1_7 Forward -133 -119 19.3708 0.00848
NP_442341.1_7 Reverse -22 -36 6.48943 0.126
NP_442341.1_7 Forward -120 -106 3.73617 0.214
NP_442341.1_7 Reverse -122 -136 1.47456 0.288
NP_442341.1_9 Reverse -84 -98 9.53707 0.151
NP_442341.1_9 Reverse -121 -135 5.89884 0.252
NP_442341.1_9 Reverse -183 -197 5.1122 0.279
NP_441756.1_5 Forward -198 -179 5.01433 0.187
NP_441756.1_5 Reverse -119 -138 -3.44213 0.29
NP_441756.1_5 Forward -315 -296 -4.6221 0.295
NP_441756.1_5 Reverse -161 -180 -5.21209 0.299
NP_442395.2_4 Forward -22 -3 0.981987 0.255
NP_440423.1_6 Forward -125 -106 -12.9802 0.204
NP_443000.1_7 Forward -134 -124 19.9412 0.00223
NP_443000.1_7 Reverse -183 -193 10.5998 0.0345
NP_443000.1_7 Reverse -121 -131 8.73149 0.0437
NP_440727.1_1 Forward -120 -101 4.22769 0.249
NP_441842.1_10 Reverse -116 -130 17.7975 0.0203
NP_441842.1_10 Forward -364 -350 10.4227 0.165
NP_441842.1_10 Forward -312 -298 9.04604 0.2
NP_441842.1_10 Forward -187 -173 7.07942 0.267
NP_440275.1_3 Forward -134 -124 15.123 0.0182
NP_440275.1_3 Reverse -183 -193 13.5497 0.0268
NP_440275.1_3 Reverse -121 -131 8.4365 0.0602
NP_440275.1_3 Forward -34 -24 6.37155 0.111
NP_440091.1_1 Forward -136 -124 8.88877 0.0567
NP_440091.1_1 Reverse -119 -131 8.29878 0.0653
NP_442354.1_8 Forward -182 -163 7.57094 0.266
NP_440679.1_10 Forward -370 -351 -12.3902 0.192
NP_443010.1_10 Reverse -120 -137 5.86307 0.198
NP_443010.1_10 Forward -35 -18 3.6405 0.252
NP_441359.1_5 Reverse -120 -139 5.11266 0.202
NP_442451.1_2 Reverse -115 -134 -0.590531 0.159
NP_439962.1_4 Reverse -115 -134 0.294447 0.197
NP_439962.1_4 Reverse -355 -374 -7.17871 0.288
NP_439962.1_4 Reverse -294 -313 -7.86702 0.291
NP_439962.1_4 Forward -189 -170 -8.94866 0.298
NP_442495.1_4 Forward -190 -180 12.3697 0.229
NP_442495.1_4 Forward -33 -23 11.8781 0.258
NP_442495.1_5 Forward -106 -87 5.40766 0.291
NP_440149.1_8 Forward -132 -113 13.6675 0.0273
NP_441105.1_3 Reverse -255 -274 5.30933 0.069
NP_441105.1_3 Forward -137 -118 -2.55715 0.164
NP_442373.1_1 Reverse -364 -383 -10.6203 0.252
NP_440216.1_1 Reverse -123 -137 17.7975 0.00129
NP_440216.1_1 Forward -132 -118 8.55439 0.00592
NP_440216.1_1 Forward -194 -180 5.01447 0.0225
NP_440216.1_1 Forward -32 -18 -2.65535 0.0539
NP_440216.1_6 Reverse -116 -132 6.05672 0.189
NP_440678.1_5 Reverse -351 -370 12.0942 0.214
NP_440172.1_1 Reverse -123 -133 15.0247 0.00945
NP_440172.1_1 Forward -132 -122 8.73149 0.0586
NP_440172.1_1 Reverse -23 -33 4.99491 0.157
NP_440172.1_1 Forward -194 -184 4.79825 0.166
NP_440172.1_1 Forward -32 -22 3.81494 0.216
NP_440172.1_1 Forward -95 -85 3.32329 0.232
NP_440172.1_1 Forward -323 -313 2.24165 0.279
NP_442015.1_10 Reverse -119 -132 19.5871 0.00427
NP_442015.1_10 Forward -198 -185 18.8988 0.00492
NP_442015.1_10 Forward -136 -123 2.87088 0.187
NP_442015.1_10 Forward -328 -315 2.57589 0.19
NP_442015.1_10 Forward -400 -387 1.69091 0.204
NP_442015.1_10 Reverse -305 -318 1.49425 0.204
NP_442015.1_10 Reverse -19 -32 -0.0790467 0.25
NP_442015.1_10 Forward -123 -110 -0.865694 0.285
NP_441226.1_7 Forward -131 -124 14.4934 0.0123
NP_441226.1_7 Reverse -124 -131 14.4934 0.0123
NP_441226.1_7 Reverse -186 -193 12.7234 0.0312
NP_441226.1_7 Forward -193 -186 11.5435 0.0757
NP_441226.1_7 Reverse -24 -31 11.2485 0.0971
NP_441226.1_7 Forward -125 -118 9.77352 0.131
NP_441226.1_7 Reverse -172 -179 8.29857 0.205
NP_441757.1_3 Forward -239 -220 -2.75381 0.288
NP_441111.1_7 Forward -131 -123 18.7023 0.00294
NP_441111.1_7 Reverse -124 -132 18.7023 0.00294
NP_441111.1_7 Forward -193 -185 8.86921 0.0589
NP_441766.1_2 Forward -132 -123 17.5026 0.00297
NP_441766.1_2 Reverse -123 -132 17.5026 0.00297
NP_441766.1_2 Forward -194 -185 12.6844 0.0158
NP_441766.1_2 Reverse -23 -32 4.12963 0.194
NP_441766.1_9 Forward -188 -169 4.03102 0.205
NP_442417.1_5 Forward -132 -118 11.5043 0.0983
NP_440416.1_1 Reverse -123 -142 -1.7705 0.116
NP_440416.1_9 Reverse -116 -135 -4.42544 0.0776
NP_440416.1_9 Forward -201 -182 -13.0786 0.163
NP_440416.1_9 Reverse -80 -99 -15.3402 0.189
NP_440416.1_9 Forward -139 -120 -18.6834 0.262
NP_440416.1_9 Reverse -178 -197 -19.1751 0.27
NP_440416.1_9 Forward -325 -306 -19.5684 0.276
NP_440416.1_9 Reverse -353 -372 -21.6334 0.295
NP_443052.1_8 Reverse -113 -132 0.982764 0.0618
NP_443052.1_8 Forward -142 -123 -2.95047 0.0955
NP_443052.1_8 Forward -382 -363 -12.4886 0.256
NP_443052.1_9 Reverse -295 -314 -3.93378 0.253
NP_442154.1_1 Forward -371 -353 -4.50408 0.125
NP_442154.1_1 Forward -374 -356 -8.04399 0.155
NP_442154.1_1 Forward -43 -25 -18.8604 0.286
NP_440261.1_5 Forward -193 -180 6.31247 0.038
NP_440261.1_5 Forward -31 -18 3.26421 0.0649
NP_440261.1_5 Forward -131 -118 -2.63565 0.0924
NP_440261.1_5 Reverse -124 -137 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCGGCTGATGACCCACTAGGGCAAGGCAACGGTGACTGCGGTGGCGATATTCTTCTTTTAAATCATTGATGCCTTGGGGAATGTCTTCCCCGGGGGCGAGGGAGGAAAAGGTTTCCAATTGGGGTGCAAGCCCCTGGTCCATGAGAATCTGTGCTGTTTGTTGAGCTCGTACTAAAGGACTAGTGAGAATGAGGTCAAATTCCACTCCGATCGCCTGGAGGCGTTGGGCCACTCGCTGGGTTTTGTCCTTACCTTTTTTAGTCAACTGGCGATCGCCGTCGGGGATATCCGGGGACTGTTCCTGGGCAATGCCGTGACGAATAAGGTAAAGTTCCATAGAAATGACCGATAAAATAGGGAAGTTAGAGGCGATGGGCCGGCAAACTCAAGCAGAAAGCC

CDS

ATGGAAAAATACAACATCCAAGTTTTAGGTAATGTTAATTCCCAAGAAACCTTAGTTTTTGCCCATGGGTTTGGGAGTGAACAAAACGCTTGGCGCTCTATCTATCCGGCCTTTGAAGAAAATTATCGCATTGTTTTATTTGACTTTCCTGGCAGTAAACCCGCTAATAGCAAAGATTTTGATATTCAAAATTACAATTCCCTCAAGGATTATGCCGATGATTTGATGGAGATCGCCCATTTGGCAGGGGTGCGTCAGGGAATTCTAATTGCCCACTCTGCTAGTTGCATGATTGGGGTGCTAGCCAGTTTGCGGGATCCGAATTTGTTTAAGGGCATGGTTTTCATTTGTGGTTCCCCCCGCTATCGGGATGATGGGGATTATAAAGGCGGTTTTAGCCAAGAAAAAATCGCCACAATTCTCAATGAAATGAGCCATAACTATGCCGAGTGGATTCGCACCTATGCCCCGGCGGCGGTTAATGATCCCAACAAGCCAGAATTGGTGGAAGAATTTTCCCATTGTCTTTTGCAACTGCGTCCTGACATTGGCTTGGTGGTATTTAGTCTCATCATCATGTCCGATTACCGTCGGGAGGTGGCCCAGGTGGAGATCCCGACCTTAATCGTGCAACCCCAGGAGGACATTTTTGTGCCGCCCACAGTGGGGGCTTATCTTTACAGGATTATGAAAAATAGTGAACTTTATTGGATTGATACTCCGGGGCATTTTCCCCATCTGGCTAACCCAACGGAAATCACCAAGGCGATCGCCGATTATTTACAGGAAAATGAATTCGTTTAA

Protein

MEKYNIQVLGNVNSQETLVFAHGFGSEQNAWRSIYPAFEENYRIVLFDFPGSKPANSKDFDIQNYNSLKDYADDLMEIAHLAGVRQGILIAHSASCMIGVLASLRDPNLFKGMVFICGSPRYRDDGDYKGGFSQEKIATILNEMSHNYAEWIRTYAPAAVNDPNKPELVEEFSHCLLQLRPDIGLVVFSLIIMSDYRREVAQVEIPTLIVQPQEDIFVPPTVGAYLYRIMKNSELYWIDTPGHFPHLANPTEITKAIADYLQENEFV