Your browser is old and dusty. Try Google Chrome!

Details for slr0418

ORF slr0418
Accession NP_442311.1
Symbol
Category putative transcripton factor DevT homolog
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -77 -63 15.7325 0.0328
NP_441061.1_2 Reverse -375 -389 4.12949 0.155
NP_441061.1_2 Reverse -192 -206 2.35953 0.177
NP_441061.1_2 Forward -218 -204 -1.8687 0.274
NP_441061.1_2 Forward -130 -116 -2.06536 0.281
NP_440795.1_7 Forward -77 -70 14.6904 0.0123
NP_440795.1_7 Reverse -70 -77 14.6904 0.0123
NP_440795.1_7 Reverse -381 -388 8.8889 0.188
NP_440795.1_7 Forward -68 -61 7.80726 0.232
NP_441418.1_6 Forward -78 -59 -1.67217 0.0147
NP_441480.1_1 Reverse -222 -241 0.392778 0.287
NP_441453.1_1 Forward -85 -67 15.8496 0.0915
NP_441453.1_4 Reverse -69 -77 16.539 0.00633
NP_441453.1_4 Forward -78 -70 7.8859 0.0536
NP_441453.1_4 Reverse -246 -254 5.0343 0.209
NP_441453.1_4 Forward -389 -381 4.64098 0.257
NP_441453.1_7 Forward -115 -108 12.1338 0.295
NP_441623.1_1 Forward -302 -284 9.95058 0.0963
NP_442151.1_6 Reverse -69 -83 10.226 0.127
NP_442151.1_6 Reverse -198 -212 6.19444 0.244
NP_442838.1_7 Reverse -64 -83 -11.4069 0.277
NP_440226.1_1 Reverse -69 -88 12.9791 0.0397
NP_440226.1_1 Forward -389 -370 2.26107 0.271
NP_441630.1_3 Forward -227 -208 1.27776 0.251
NP_442173.1_1 Forward -77 -69 15.4574 0.00633
NP_442173.1_1 Reverse -70 -78 14.1791 0.0165
NP_442173.1_1 Reverse -168 -176 4.73931 0.258
NP_442752.1_4 Reverse -69 -76 13.8055 0.0199
NP_442752.1_4 Reverse -246 -253 5.25066 0.256
NP_443027.1_4 Forward -80 -70 16.303 0.0437
NP_443027.1_4 Reverse -67 -77 13.943 0.0452
NP_439997.1_4 Forward -34 -15 9.0459 0.217
NP_441812.1_3 Reverse -68 -82 10.4227 0.222
NP_442975.1_10 Reverse -65 -79 18.5835 0.00673
NP_442975.1_10 Forward -82 -68 2.45727 0.274
NP_440784.1_7 Forward -77 -70 15.9687 0.0123
NP_440784.1_7 Reverse -70 -77 15.9687 0.0123
NP_440110.1_7 Forward -352 -333 10.2259 0.293
NP_440110.1_8 Reverse -114 -133 -2.45882 0.269
NP_441476.1_5 Reverse -64 -83 -0.688862 0.2
NP_442062.1_8 Forward -78 -68 9.91146 0.0554
NP_442062.1_8 Reverse -69 -79 9.61647 0.0587
NP_441859.1_3 Forward -79 -60 14.7483 0.0704
NP_441859.1_7 Reverse -164 -183 12.5858 0.221
NP_441802.1_1 Forward -46 -27 8.55425 0.22
NP_440304.1_4 Reverse -67 -77 9.91146 0.051
NP_440304.1_4 Forward -80 -70 9.12481 0.0626
NP_442242.1_4 Forward -77 -70 14.3954 0.0124
NP_442242.1_4 Reverse -70 -77 14.3954 0.0124
NP_440044.1_8 Forward -77 -58 7.57094 0.0817
NP_440044.1_8 Reverse -70 -89 2.85105 0.143
NP_441781.1_7 Reverse -197 -216 4.22769 0.187
NP_441581.1_6 Reverse -192 -211 9.97118 0.29
NP_440011.1_1 Forward -277 -258 14.1591 0.219
NP_441352.1_2 Forward -43 -24 7.7676 0.162
NP_441935.1_1 Forward -77 -58 11.2092 0.211
NP_441594.1_6 Reverse -60 -79 5.80098 0.205
NP_442196.1_10 Forward -80 -61 12.7825 0.21
NP_442110.1_7 Reverse -69 -83 1.76955 0.222
NP_440856.1_7 Reverse -197 -216 -8.16202 0.27
NP_441083.1_5 Forward -78 -68 2.04498 0.195
NP_441083.1_5 Reverse -69 -79 1.55333 0.204
NP_442827.1_8 Forward -86 -67 2.75194 0.155
NP_441738.1_2 Forward -76 -69 15.28 0.0102
NP_441738.1_2 Reverse -71 -78 11.5435 0.084
NP_441955.1_8 Reverse -63 -80 12.2319 0.199
NP_440209.1_1 Reverse -69 -77 18.1123 0.00295
NP_440209.1_1 Forward -78 -70 8.47588 0.0457
NP_442889.1_8 Reverse -66 -80 3.8339 0.273
NP_440407.1_4 Forward -198 -179 18.0924 0.0654
NP_441713.1_1 Reverse -240 -259 -0.688862 0.0967
NP_441770.1_4 Forward -329 -310 -9.24366 0.249
NP_440178.1_7 Reverse -68 -87 -20.7484 0.199
NP_440178.1_7 Reverse -197 -216 -22.715 0.272
NP_442706.1_5 Reverse -19 -38 13.6321 0.254
NP_441716.1_1 Forward -389 -375 6.88276 0.186
NP_440644.1_3 Forward -86 -67 1.76941 0.26
NP_442111.1_4 Forward -79 -65 9.5377 0.0606
NP_440906.1_5 Forward -77 -70 15.8704 0.0124
NP_440906.1_5 Reverse -70 -77 15.8704 0.0124
NP_442596.1_1 Reverse -70 -84 18.4851 0.179
NP_440747.1_10 Reverse -66 -78 -11.7607 0.142
NP_440747.1_10 Forward -81 -69 -11.8591 0.161
NP_440747.1_10 Reverse -377 -389 -12.1541 0.227
NP_441130.1_10 Reverse -67 -81 11.2093 0.107
NP_442634.1_4 Reverse -67 -81 4.32615 0.0819
NP_442634.1_4 Forward -80 -66 -5.60527 0.264
NP_440403.1_4 Reverse -60 -79 -5.01543 0.216
NP_440403.1_10 Reverse -60 -79 17.109 0.0938
NP_441014.1_10 Forward -79 -60 1.37531 0.229
NP_442848.1_1 Reverse -63 -77 5.70279 0.0803
NP_442848.1_9 Reverse -54 -73 -1.27885 0.288
NP_443018.1_3 Forward -77 -70 14.8871 0.0123
NP_443018.1_3 Reverse -70 -77 14.8871 0.0123
NP_441316.1_7 Reverse -67 -82 4.89645 0.121
NP_441634.1_8 Forward -80 -66 4.03116 0.138
NP_441634.1_9 Forward -274 -255 13.2733 0.191
NP_440376.1_1 Reverse -69 -78 9.73449 0.0365
NP_440376.1_1 Forward -78 -69 9.63616 0.0385
NP_440376.1_1 Reverse -198 -207 4.62128 0.154
NP_440376.1_1 Forward -321 -312 1.47469 0.251
NP_441857.1_6 Forward -322 -312 13.8447 0.267
NP_441588.1_4 Forward -76 -66 6.96153 0.178
NP_442687.1_7 Reverse -68 -78 6.76487 0.154
NP_442687.1_7 Reverse -300 -310 4.3066 0.255
NP_442687.1_7 Forward -208 -198 3.81494 0.286
NP_442485.1_3 Reverse -58 -77 5.80098 0.168
NP_442485.1_3 Forward -80 -61 -1.47551 0.259
NP_442485.1_3 Reverse -49 -68 -4.03212 0.277
NP_441846.1_10 Reverse -114 -133 -14.7502 0.238
NP_440781.1_1 Forward -276 -262 11.0127 0.296
NP_441013.1_2 Reverse -41 -59 -4.01242 0.295
NP_441422.1_7 Reverse -67 -84 -0.944468 0.173
NP_442658.1_1 Reverse -67 -77 18.7607 0.00222
NP_442658.1_1 Forward -80 -70 14.0409 0.0273
NP_442782.1_2 Forward -314 -300 1.08123 0.282
NP_442782.1_2 Forward -389 -375 0.196253 0.293
NP_442496.1_5 Forward -399 -381 4.44404 0.289
NP_442205.1_9 Forward -261 -245 3.89344 0.171
NP_440656.1_8 Reverse -58 -77 6.58763 0.0791
NP_442937.1_5 Forward -68 -49 9.24257 0.198
NP_442937.1_5 Reverse -64 -83 8.35759 0.225
NP_441958.1_5 Forward -79 -69 11.3864 0.0074
NP_441958.1_5 Reverse -68 -78 3.12662 0.0364
NP_441958.1_5 Reverse -245 -255 0.373358 0.154
NP_441958.1_5 Forward -256 -246 -0.609952 0.215
NP_440269.1_1 Forward -89 -71 15.6538 0.286
NP_442260.1_4 Forward -35 -16 14.4541 0.259
NP_442911.1_2 Reverse -370 -389 -5.50708 0.16
NP_442911.1_2 Forward -88 -69 -7.86702 0.221
NP_442911.1_2 Reverse -59 -78 -7.96535 0.223
NP_441580.1_6 Reverse -58 -77 -3.73712 0.235
NP_440153.1_5 Forward -77 -63 0.687908 0.291
NP_443055.1_6 Forward -86 -68 7.68819 0.156
NP_443055.1_6 Reverse -69 -87 3.36165 0.196
NP_440993.1_2 Forward -83 -67 13.7265 0.0656
NP_440993.1_2 Reverse -64 -80 2.22182 0.269
NP_440993.1_4 Reverse -255 -272 6.72535 0.241
NP_442995.1_5 Forward -83 -64 21.9273 0.0367
NP_441099.1_5 Reverse -262 -281 -9.34199 0.219
NP_441099.1_5 Forward -88 -69 -11.9969 0.294
NP_442002.1_9 Reverse -68 -75 10.7572 0.185
NP_440475.1_1 Reverse -237 -256 10.6817 0.267
NP_441294.1_7 Reverse -65 -79 10.3065 0.197
NP_441646.1_1 Forward -321 -302 0.392778 0.251
NP_442438.1_10 Reverse -61 -75 2.2612 0.182
NP_442438.1_10 Reverse -64 -78 -0.0987402 0.248
NP_442431.1_10 Forward -89 -71 3.55906 0.214
NP_441000.1_6 Forward -79 -65 -2.65535 0.22
NP_441000.1_6 Reverse -68 -82 -5.70361 0.29
NP_440605.1_4 Forward -88 -69 21.0458 0.036
NP_442771.1_1 Reverse -67 -85 -6.96235 0.169
NP_440147.1_4 Reverse -67 -80 2.87088 0.202
NP_440147.1_4 Forward -80 -67 2.37923 0.208
NP_440147.1_4 Reverse -196 -209 -0.275709 0.279
NP_441550.1_8 Forward -80 -70 14.2375 0.0168
NP_441550.1_8 Reverse -67 -77 10.501 0.066
NP_441916.1_7 Forward -78 -68 10.2065 0.0266
NP_441916.1_7 Reverse -69 -79 9.61647 0.0333
NP_440206.1_4 Forward -388 -369 12.0933 0.163
NP_441041.1_4 Forward -255 -236 -10.4236 0.232
NP_441041.1_7 Reverse -66 -78 10.5273 0.095
NP_441041.1_7 Forward -81 -69 7.02889 0.18
NP_442004.1_6 Reverse -246 -260 7.27608 0.161
NP_441725.1_5 Forward -77 -67 9.02648 0.0553
NP_441725.1_5 Reverse -70 -80 7.64985 0.0904
NP_441725.1_5 Reverse -381 -391 -0.609952 0.265
NP_439966.1_7 Reverse -67 -77 17.4824 0.00636
NP_439966.1_7 Forward -132 -122 11.2876 0.0688
NP_439966.1_7 Forward -80 -70 11.2876 0.0688
NP_439966.1_7 Reverse -244 -254 4.10949 0.289
NP_439966.1_9 Reverse -67 -76 10.7178 0.0863
NP_439966.1_9 Forward -80 -71 9.24284 0.253
NP_439966.1_9 Reverse -348 -357 4.52295 0.253
NP_442941.1_3 Reverse -247 -257 5.28991 0.122
NP_442941.1_3 Forward -77 -67 2.53664 0.14
NP_442941.1_3 Reverse -70 -80 1.55333 0.15
NP_442941.1_3 Forward -254 -244 0.668351 0.19
NP_440289.1_2 Reverse -66 -79 3.65753 0.0754
NP_440289.1_2 Forward -392 -379 -2.43899 0.255
NP_440983.1_9 Forward -130 -111 5.01433 0.285
NP_440260.1_8 Forward -87 -69 -3.52077 0.252
NP_442281.1_1 Reverse -64 -78 16.5185 0.00772
NP_441334.1_7 Forward -80 -61 8.35759 0.0185
NP_441334.1_7 Reverse -67 -86 -10.227 0.12
NP_442847.1_3 Forward -354 -335 24.2863 0.0169
NP_440437.1_1 Reverse -204 -223 -3.73712 0.244
NP_441457.1_7 Forward -80 -61 14.9458 0.0607
NP_441457.1_7 Forward -263 -244 -0.4922 0.293
NP_441644.1_6 Reverse -69 -79 16.5975 0.00319
NP_441644.1_6 Forward -200 -190 8.43603 0.0998
NP_441644.1_6 Reverse -198 -208 3.12618 0.297
NP_442215.1_2 Forward -209 -193 3.79511 0.0918
NP_442029.1_6 Reverse -275 -294 4.12936 0.273
NP_440253.1_2 Forward -78 -60 8.67227 0.0547
NP_440253.1_2 Reverse -69 -87 0.510803 0.184
NP_440929.1_8 Forward -78 -69 17.4043 0.00289
NP_440929.1_8 Reverse -69 -78 17.4043 0.00289
NP_440929.1_8 Forward -289 -280 1.67135 0.283
NP_442933.1_10 Reverse -69 -78 9.04618 0.063
NP_442933.1_10 Forward -78 -69 8.94785 0.0643
NP_441266.1_1 Forward -309 -290 13.1758 0.297
NP_441751.2_8 Forward -77 -63 -3.83532 0.156
NP_442554.1_8 Forward -77 -67 16.008 0.0065
NP_442554.1_8 Reverse -70 -80 15.8113 0.00783
NP_442554.1_8 Forward -254 -244 4.79825 0.173
NP_441762.1_7 Forward -79 -67 5.05386 0.0443
NP_441762.1_7 Reverse -68 -80 4.36554 0.0504
NP_441762.1_7 Reverse -59 -71 -6.05754 0.268
NP_442142.1_4 Reverse -66 -79 5.32859 0.194
NP_442142.1_4 Reverse -51 -64 3.46031 0.255
NP_442142.1_9 Reverse -62 -81 1.57275 0.285
NP_442142.1_9 Reverse -71 -90 0.687771 0.291
NP_442292.1_1 Reverse -70 -79 16.9127 0.00594
NP_442292.1_1 Forward -77 -68 9.63616 0.0183
NP_440919.1_1 Forward -308 -289 -4.13045 0.23
NP_442381.1_8 Reverse -66 -85 -2.26216 0.126
NP_443009.1_5 Forward -79 -68 9.89126 0.0866
NP_443009.1_5 Reverse -68 -79 6.74468 0.15
NP_441715.1_4 Forward -77 -67 9.32148 0.097
NP_440015.1_9 Forward -226 -208 0.0191479 0.255
NP_440183.1_9 Reverse -258 -277 -20.945 0.294
NP_441198.1_8 Forward -80 -70 13.955 0.101
NP_441198.1_8 Forward -391 -381 11.9041 0.174
NP_440379.1_5 Forward -87 -68 7.27595 0.133
NP_440379.1_5 Forward -78 -59 -9.53865 0.264
NP_441468.1_1 Forward -77 -70 15.8704 0.0124
NP_441468.1_1 Reverse -70 -77 15.8704 0.0124
NP_441020.2_6 Reverse -67 -84 15.7718 0.0361
NP_441020.2_6 Forward -80 -63 12.1336 0.101
NP_441020.2_6 Forward -71 -54 9.18362 0.179
NP_441673.1_1 Reverse -69 -78 11.1111 0.0121
NP_441673.1_1 Forward -78 -69 11.0128 0.018
NP_441876.1_9 Forward -135 -125 14.1392 0.267
NP_441876.1_9 Reverse -329 -339 13.6475 0.267
NP_441826.1_2 Reverse -63 -77 10.9143 0.0428
NP_441826.1_2 Forward -309 -295 -2.36035 0.271
NP_442868.1_6 Reverse -67 -77 8.53483 0.0555
NP_442868.1_6 Forward -391 -381 4.10993 0.186
NP_442868.1_6 Forward -80 -70 -0.314959 0.284
NP_441056.1_1 Forward -78 -59 -9.14533 0.291
NP_441612.1_2 Forward -336 -326 6.70984 0.277
NP_442227.1_2 Forward -288 -269 -3.3438 0.29
NP_442361.1_3 Reverse -63 -76 8.67241 0.285
NP_442808.1_1 Reverse -68 -78 8.73102 0.0481
NP_442808.1_1 Reverse -311 -321 3.8145 0.222
NP_442808.1_1 Forward -132 -122 3.71617 0.227
NP_441101.1_1 Forward -80 -62 10.1472 0.286
NP_440145.1_3 Forward -88 -69 -6.29373 0.295
NP_442820.1_3 Reverse -324 -334 12.7626 0.289
NP_442542.1_2 Forward -71 -58 14.1789 0.114
NP_442542.1_2 Forward -391 -378 10.639 0.125
NP_442542.1_9 Reverse -62 -76 11.897 0.111
NP_442050.1_5 Forward -80 -70 16.5975 0.00812
NP_442050.1_5 Reverse -67 -77 8.23937 0.234
NP_442342.1_9 Reverse -67 -83 5.46674 0.237
NP_441114.1_3 Forward -301 -292 6.39124 0.277
NP_442789.1_4 Reverse -67 -86 10.9142 0.0942
NP_442789.1_4 Reverse -199 -218 6.78429 0.124
NP_442789.1_4 Forward -80 -61 -8.35868 0.299
NP_441518.1_3 Reverse -59 -78 12.9791 0.0317
NP_441518.1_3 Forward -88 -69 5.30933 0.05
NP_441878.1_6 Forward -79 -69 0.668351 0.139
NP_441878.1_6 Reverse -68 -78 0.668351 0.139
NP_441878.1_6 Reverse -197 -207 -7.29646 0.217
NP_441878.1_6 Forward -390 -380 -7.49312 0.231
NP_441036.1_8 Forward -79 -69 14.7297 0.0187
NP_441036.1_8 Reverse -68 -78 8.1415 0.176
NP_441557.1_5 Forward -78 -69 17.4043 0.0023
NP_441557.1_5 Reverse -69 -78 10.8161 0.00464
NP_441557.1_5 Reverse -246 -255 -0.885252 0.26
NP_441445.1_1 Reverse -318 -337 6.88262 0.14
NP_441445.1_1 Forward -398 -379 3.53937 0.212
NP_441739.1_2 Forward -140 -124 8.80929 0.188
NP_441308.1_8 Reverse -244 -254 12.1731 0.22
NP_441308.1_8 Forward -80 -70 10.9931 0.22
NP_441308.1_8 Reverse -67 -77 9.22315 0.226
NP_440101.1_3 Forward -338 -319 0.491109 0.298
NP_442183.1_1 Reverse -69 -83 16.7159 0.0139
NP_442183.1_1 Forward -78 -64 11.3077 0.0724
NP_442183.1_1 Forward -255 -241 5.50613 0.215
NP_441407.1_5 Forward -88 -69 9.14423 0.149
NP_442166.1_3 Forward -45 -26 6.78429 0.109
NP_441574.1_1 Forward -90 -71 0.58944 0.191
NP_442444.1_6 Forward -86 -68 14.4682 0.21
NP_441549.1_9 Forward -340 -322 -9.12563 0.242
NP_441549.1_9 Forward -393 -375 -9.22396 0.244
NP_442632.1_1 Reverse -101 -120 10.9134 0.272
NP_442170.1_5 Reverse -69 -88 3.14605 0.172
NP_442347.1_2 Forward -77 -68 11.1111 0.056
NP_442645.1_2 Reverse -297 -316 -15.7335 0.209
NP_442888.1_8 Forward -354 -335 9.14423 0.275
NP_441037.1_4 Reverse -67 -77 16.2838 0.0168
NP_441037.1_4 Forward -80 -70 15.5041 0.028
NP_441037.1_4 Forward -391 -381 7.41515 0.237
NP_440151.1_2 Forward -350 -332 16.0463 0.227
NP_441633.1_3 Forward -80 -67 5.72248 0.0481
NP_441633.1_3 Reverse -67 -80 -3.81562 0.177
NP_440136.1_2 Forward -77 -70 15.9687 0.0123
NP_440136.1_2 Reverse -70 -77 15.9687 0.0123
NP_442998.1_10 Forward -76 -69 15.5754 0.0102
NP_442998.1_10 Reverse -71 -78 5.84064 0.235
NP_442998.1_10 Reverse -382 -389 3.97235 0.297
NP_440899.1_1 Reverse -129 -148 10.5545 0.181
NP_440299.1_1 Reverse -56 -69 3.36198 0.247
NP_440299.1_1 Reverse -65 -78 2.87033 0.269
NP_440299.1_6 Forward -284 -265 6.39097 0.268
NP_441799.1_1 Forward -82 -68 5.01387 0.227
NP_441007.1_10 Forward -83 -70 12.0157 0.055
NP_441007.1_10 Reverse -64 -77 3.16588 0.182
NP_442334.1_1 Forward -90 -71 -2.0655 0.174
NP_442334.1_2 Reverse -59 -76 -3.5994 0.2
NP_440256.1_1 Forward -353 -334 -0.688862 0.0954
NP_440256.1_1 Forward -81 -62 -8.45701 0.261
NP_441559.1_8 Forward -73 -59 2.2612 0.147
NP_441559.1_8 Reverse -193 -207 -4.62196 0.231
NP_441559.1_8 Forward -145 -131 -7.57189 0.295
NP_440915.1_6 Reverse -65 -79 15.6342 0.0183
NP_440915.1_6 Forward -114 -100 -2.95034 0.287
NP_442069.1_4 Reverse -58 -77 4.22769 0.254
NP_442866.1_1 Forward -83 -64 -9.53865 0.294
NP_440748.1_5 Reverse -296 -315 10.5209 0.139
NP_440748.1_5 Forward -204 -185 -0.4922 0.26
NP_442031.1_9 Forward -216 -197 16.4199 0.132
NP_441464.1_8 Reverse -69 -83 10.7177 0.178
NP_441464.1_10 Forward -344 -330 11.996 0.208
NP_440695.1_5 Reverse -246 -265 -2.16383 0.296
NP_441939.1_3 Reverse -70 -89 6.58763 0.231
NP_441199.1_6 Reverse -65 -84 3.73603 0.177
NP_442993.1_1 Reverse -191 -207 -9.77456 0.194
NP_442993.1_1 Reverse -246 -262 -12.0362 0.265
NP_442993.1_1 Forward -255 -239 -13.8061 0.295
NP_440677.1_6 Forward -345 -326 7.57094 0.298
NP_442386.1_9 Reverse -68 -77 15.7322 0.0144
NP_442386.1_9 Forward -131 -122 7.37413 0.219
NP_442386.1_9 Forward -384 -375 6.19416 0.23
NP_442386.1_9 Forward -79 -70 5.11253 0.266
NP_442386.1_9 Reverse -379 -388 4.91586 0.276
NP_440570.1_5 Forward -73 -54 -3.73712 0.292
NP_442054.1_4 Forward -325 -306 8.84924 0.299
NP_441750.1_4 Forward -387 -368 11.6025 0.145
NP_441750.1_7 Forward -343 -333 16.303 0.254
NP_441340.1_5 Forward -77 -70 15.6737 0.0124
NP_441340.1_5 Reverse -70 -77 15.6737 0.0124
NP_440168.1_9 Forward -80 -61 -5.21209 0.296
NP_440327.1_6 Reverse -269 -288 3.6377 0.282
NP_440327.1_6 Reverse -110 -129 3.14605 0.285
NP_440597.1_4 Forward -207 -189 19.0945 0.118
NP_441132.1_5 Forward -80 -61 12.7825 0.296
NP_439976.1_4 Reverse -15 -34 9.93006 0.278
NP_442474.1_6 Forward -377 -358 13.9625 0.088
NP_440586.1_8 Forward -77 -70 13.2151 0.026
NP_440586.1_8 Reverse -70 -77 13.2151 0.026
NP_442251.1_6 Forward -77 -70 15.2804 0.0124
NP_442251.1_6 Reverse -70 -77 15.2804 0.0124
NP_441262.1_3 Forward -78 -71 14.8871 0.0223
NP_441262.1_3 Reverse -69 -76 14.7888 0.0223
NP_440027.1_3 Reverse -59 -77 2.18168 0.292
NP_443051.1_1 Forward -79 -70 17.5026 0.0066
NP_443051.1_1 Reverse -68 -77 10.4228 0.00754
NP_443051.1_1 Reverse -245 -254 -0.000272808 0.245
NP_441232.1_10 Forward -89 -70 6.29264 0.162
NP_439937.1_8 Reverse -55 -74 6.39097 0.192
NP_439937.1_9 Reverse -379 -396 -7.92662 0.171
NP_439937.1_9 Forward -142 -125 -9.99156 0.22
NP_441595.1_5 Reverse -318 -336 7.00065 0.222
NP_440439.1_1 Reverse -243 -256 8.18076 0.0552
NP_440439.1_1 Reverse -66 -79 1.19926 0.159
NP_440439.1_1 Forward -81 -68 0.412608 0.192
NP_440372.1_2 Forward -77 -70 16.3621 0.0124
NP_440372.1_2 Reverse -70 -77 16.3621 0.0124
NP_441789.1_7 Forward -131 -112 -2.8529 0.264
NP_440316.1_10 Reverse -51 -61 6.46988 0.257
NP_441803.1_2 Forward -398 -379 1.67108 0.228
NP_439977.1_5 Forward -84 -65 8.06259 0.11
NP_439977.1_5 Reverse -63 -82 3.24438 0.16
NP_440139.1_1 Forward -123 -104 1.96529 0.242
NP_440139.1_1 Reverse -185 -204 0.785326 0.281
NP_442887.1_5 Reverse -14 -33 -12.2919 0.281
NP_442114.1_4 Forward -78 -67 18.4466 0.107
NP_441877.1_7 Reverse -64 -83 1.86696 0.241
NP_442790.1_4 Reverse -60 -79 -4.81876 0.135
NP_442790.1_4 Forward -323 -304 -12.6852 0.252
NP_442262.1_10 Forward -77 -70 14.1988 0.0123
NP_442262.1_10 Reverse -70 -77 14.1988 0.0123
NP_441689.1_5 Forward -257 -247 15.0242 0.0617
NP_441689.1_5 Reverse -244 -254 13.3526 0.0717
NP_442244.1_6 Reverse -152 -171 -0.295539 0.291
NP_440163.1_10 Reverse -63 -73 9.81313 0.222
NP_440344.1_10 Reverse -62 -79 6.33202 0.0183
NP_440344.1_10 Reverse -191 -208 -9.99092 0.163
NP_440344.1_10 Reverse -279 -296 -10.5809 0.185
NP_440344.1_10 Forward -85 -68 -12.4492 0.254
NP_442123.1_3 Reverse -69 -88 12.3892 0.2
NP_442529.1_7 Forward -86 -67 17.6007 0.192
NP_440297.1_8 Forward -108 -90 10.8356 0.259
NP_440297.1_9 Forward -68 -58 7.05986 0.15
NP_440297.1_9 Reverse -70 -80 -0.0199663 0.282
NP_440297.1_9 Forward -77 -67 -0.216628 0.282
NP_441896.1_3 Forward -87 -68 10.4225 0.0847
NP_441896.1_3 Reverse -60 -79 9.83255 0.0872
NP_442067.1_4 Forward -80 -61 4.52268 0.256
NP_440999.1_9 Reverse -65 -79 11.406 0.0448
NP_440888.1_2 Forward -78 -64 9.14375 0.137
NP_440888.1_2 Reverse -69 -83 6.29216 0.241
NP_440888.1_4 Reverse -287 -301 15.1668 0.253
NP_440600.1_4 Forward -86 -68 -7.84733 0.294
NP_440052.1_5 Reverse -58 -77 -6.09707 0.3
NP_442277.1_4 Reverse -60 -79 2.06362 0.256
NP_441543.1_2 Forward -77 -68 18.486 0.00236
NP_441543.1_2 Reverse -70 -79 6.39124 0.153
NP_442845.1_2 Forward -261 -247 8.06273 0.195
NP_442845.1_2 Forward -389 -375 6.98109 0.199
NP_442845.1_2 Reverse -374 -388 6.3911 0.21
NP_441178.1_6 Reverse -257 -276 5.70185 0.268
NP_441319.1_5 Reverse -92 -111 7.86593 0.3
NP_441469.1_8 Reverse -68 -77 16.126 0.00797
NP_441469.1_8 Forward -79 -70 6.98123 0.227
NP_443064.1_6 Forward -255 -245 8.39772 0.292
NP_442578.1_7 Forward -77 -70 14.5921 0.026
NP_442578.1_7 Reverse -70 -77 14.5921 0.026
NP_441462.1_2 Reverse -69 -79 11.3864 0.00425
NP_441462.1_2 Forward -78 -68 1.74999 0.0811
NP_441462.1_2 Reverse -246 -256 -0.314959 0.206
NP_441462.1_2 Forward -255 -245 -1.10161 0.281
NP_441621.1_7 Reverse -58 -72 11.2093 0.0476
NP_441621.1_7 Forward -80 -66 7.17775 0.068
NP_441621.1_7 Reverse -67 -81 6.29277 0.068
NP_441621.1_7 Forward -391 -377 -5.21195 0.248
NP_443062.1_1 Forward -255 -237 14.4939 0.0465
NP_443062.1_1 Forward -78 -60 10.7886 0.11
NP_443062.1_1 Forward -383 -365 9.81352 0.127
NP_440519.1_8 Forward -392 -376 5.95839 0.21
NP_441560.1_8 Forward -83 -64 12.4866 0.25
NP_441351.1_8 Reverse -67 -86 4.22769 0.225
NP_442487.1_2 Reverse -190 -209 3.14526 0.232
NP_440516.1_6 Forward -131 -117 7.57046 0.27
NP_440516.1_8 Reverse -69 -78 9.53783 0.0136
NP_440516.1_8 Forward -78 -69 7.07956 0.0867
NP_440516.1_8 Forward -314 -305 -0.196935 0.185
NP_440516.1_8 Forward -389 -380 -0.590259 0.283
NP_441785.1_1 Forward -78 -64 16.7136 0.0995
NP_442080.1_7 Forward -347 -328 0.0977854 0.244
NP_442428.1_5 Forward -77 -70 15.8704 0.0124
NP_442428.1_5 Reverse -70 -77 15.8704 0.0124
NP_441353.1_7 Forward -393 -375 22.7328 0.0287
NP_440673.1_2 Reverse -59 -78 17.0231 0.0543
NP_440673.1_2 Forward -88 -69 9.99938 0.226
NP_440673.1_3 Forward -76 -69 12.4288 0.0426
NP_440673.1_3 Forward -344 -337 6.3323 0.283
NP_440673.1_3 Reverse -71 -78 5.34899 0.298
NP_440865.1_9 Forward -84 -65 -7.67036 0.248
NP_441052.1_2 Reverse -198 -208 4.20827 0.163
NP_441052.1_2 Reverse -327 -337 3.02829 0.185
NP_441052.1_2 Forward -78 -68 1.94665 0.221
NP_441052.1_2 Reverse -69 -79 0.668351 0.256
NP_442219.1_8 Reverse -173 -192 15.5112 0.11
NP_442219.1_8 Reverse -283 -302 12.0324 0.168
NP_442219.1_9 Forward -77 -68 8.35786 0.0681
NP_442219.1_9 Forward -388 -379 5.70292 0.135
NP_440436.1_4 Forward -77 -68 18.1905 0.00233
NP_441884.1_9 Reverse -66 -85 -10.7186 0.0848
NP_441884.1_9 Forward -81 -62 -13.8652 0.138
NP_442086.1_3 Reverse -70 -89 16.2241 0.0667
NP_440577.1_1 Reverse -66 -85 10.2259 0.254
NP_442907.1_2 Reverse -381 -399 7.39397 0.286
NP_441719.1_4 Forward -77 -70 16.3621 0.0124
NP_441719.1_4 Reverse -70 -77 16.3621 0.0124
NP_441733.1_10 Forward -81 -68 15.4572 0.06
NP_441733.1_10 Reverse -66 -79 3.95252 0.28
NP_441004.1_1 Forward -339 -320 -7.37537 0.198
NP_441004.1_3 Forward -310 -291 2.85105 0.265
NP_442366.1_3 Reverse -190 -208 -5.48739 0.288
NP_440129.1_10 Reverse -62 -76 4.32615 0.185
NP_442854.1_6 Forward -314 -295 5.99764 0.238
NP_443054.1_2 Forward -80 -66 2.75286 0.241
NP_441851.1_9 Reverse -104 -123 10.0292 0.239
NP_441851.1_10 Reverse -68 -78 15.8113 0.00552
NP_441851.1_10 Forward -79 -69 6.96153 0.151
NP_442622.1_1 Forward -79 -60 -10.9153 0.257
NP_442622.1_5 Reverse -67 -86 -3.04881 0.171
NP_441542.1_4 Reverse -363 -377 3.63784 0.267
NP_442856.1_7 Reverse -189 -208 -4.13045 0.257
NP_442856.1_7 Forward -219 -200 -4.52377 0.262
NP_442515.1_1 Reverse -68 -82 4.22782 0.108
NP_442515.1_1 Reverse -173 -187 -3.34366 0.29
NP_441396.1_5 Forward -341 -332 9.4395 0.205
NP_440463.1_8 Forward -73 -54 5.2732 0.289
NP_440165.1_5 Forward -79 -60 -6.49039 0.238
NP_441046.1_2 Forward -41 -22 2.85105 0.24
NP_441046.1_6 Reverse -210 -229 14.2566 0.296
NP_440940.1_7 Reverse -59 -77 12.4081 0.0927
NP_440432.1_9 Forward -77 -62 9.71466 0.0419
NP_440432.1_9 Reverse -70 -85 8.63302 0.0427
NP_440474.1_8 Reverse -70 -84 19.6651 0.0423
NP_440474.1_8 Forward -77 -63 9.43874 0.16
NP_442168.1_5 Reverse -70 -89 5.99764 0.198
NP_439950.1_1 Reverse -129 -138 14.7494 0.195
NP_440943.1_6 Forward -171 -152 17.3057 0.202
NP_442006.1_2 Reverse -60 -77 -7.04099 0.169
NP_441003.1_9 Forward -78 -59 4.42435 0.281
NP_441003.1_9 Reverse -189 -208 4.12936 0.288
NP_443047.1_7 Reverse -70 -89 8.45592 0.211
NP_442243.1_1 Reverse -40 -58 1.29671 0.218
NP_441570.1_1 Reverse -69 -87 -9.12563 0.129
NP_441570.1_1 Forward -78 -60 -10.8956 0.181
NP_441078.1_4 Reverse -69 -78 9.93116 0.0203
NP_441078.1_4 Forward -78 -69 9.83282 0.0226
NP_441078.1_4 Forward -389 -380 4.81794 0.126
NP_441078.1_4 Reverse -380 -389 -1.47524 0.266
NP_441078.1_4 Reverse -198 -207 -1.6719 0.266
NP_442729.1_8 Reverse -65 -78 5.42749 0.246
NP_442348.1_2 Forward -168 -159 6.98123 0.293
NP_442443.1_1 Reverse -115 -134 -6.49039 0.294
NP_440526.1_3 Forward -77 -66 11.7595 0.0646
NP_440526.1_3 Reverse -70 -81 0.844851 0.267
NP_441432.1_8 Reverse -68 -77 8.25953 0.0755
NP_441432.1_8 Forward -79 -70 6.98123 0.112
NP_441432.1_9 Reverse -24 -37 8.59837 0.287
NP_442320.1_8 Reverse -63 -77 14.4542 0.0132
NP_442320.1_8 Forward -84 -70 -1.5737 0.0821
NP_440760.1_1 Reverse -69 -88 -12.4886 0.0931
NP_442274.1_3 Forward -351 -332 8.75091 0.297
NP_442353.1_4 Forward -342 -323 2.26028 0.234
NP_442353.1_4 Reverse -192 -211 1.17865 0.253
NP_442353.1_7 Reverse -334 -353 10.4225 0.176
NP_442751.1_2 Forward -133 -114 9.04509 0.206
NP_442230.1_2 Forward -50 -31 19.9598 0.0283
NP_442489.1_7 Reverse -69 -78 10.4228 0.0151
NP_442489.1_7 Forward -78 -69 10.3245 0.0193
NP_442489.1_7 Reverse -198 -207 -1.37691 0.195
NP_440757.1_6 Reverse -65 -84 8.25926 0.293
NP_440565.1_7 Forward -47 -28 0.196116 0.249
NP_442079.1_7 Reverse -70 -89 8.45592 0.121
NP_442079.1_7 Forward -77 -58 0.196116 0.286
NP_440559.1_1 Forward -77 -68 8.75118 0.0586
NP_440559.1_1 Reverse -70 -79 7.76787 0.0918
NP_441659.2_8 Reverse -69 -79 17.5813 0.0024
NP_441659.2_8 Forward -78 -68 2.43831 0.2
NP_440779.1_5 Forward -78 -61 -5.66436 0.152
NP_440779.1_5 Reverse -69 -86 -14.5141 0.246
NP_442346.1_5 Reverse -68 -78 7.74818 0.159
NP_442346.1_5 Forward -79 -69 6.8632 0.188
NP_442346.1_10 Forward -80 -61 9.0459 0.147
NP_440545.1_3 Forward -82 -65 4.85706 0.0661
NP_440545.1_3 Forward -393 -376 -7.13932 0.298
NP_441856.1_3 Forward -258 -239 3.93269 0.167
NP_440486.1_4 Reverse -108 -126 -4.30741 0.248
NP_441653.1_2 Reverse -58 -77 4.59259 0.255
NP_440010.1_10 Reverse -290 -309 2.65439 0.275
NP_442551.1_4 Reverse -195 -210 -1.20007 0.245
NP_442900.1_4 Forward -137 -118 12.1925 0.0958
NP_442311.1_7 Forward -288 -269 20.7473 0.201
NP_442311.1_8 Forward -177 -158 17.5024 0.0692
NP_441585.1_5 Forward -174 -155 -0.197979 0.291
NP_441888.1_7 Reverse -64 -78 4.62115 0.225
NP_440946.1_6 Reverse -41 -60 1.76941 0.294
NP_441948.1_4 Forward -85 -67 -0.865831 0.139
NP_441833.1_4 Forward -77 -70 15.9687 0.0124
NP_441833.1_4 Reverse -70 -77 15.9687 0.0124
NP_441895.1_2 Reverse -332 -351 -26.9432 0.275
NP_441895.1_10 Forward -34 -15 -18.7818 0.282
NP_442162.1_9 Forward -77 -70 16.2637 0.0124
NP_442162.1_9 Reverse -70 -77 16.2637 0.0124
NP_440671.1_4 Forward -206 -192 5.99778 0.266
NP_442404.1_9 Reverse -383 -397 8.65209 0.296
NP_442199.1_5 Forward -86 -67 5.50599 0.0951
NP_442140.1_3 Forward -77 -67 17.4829 0.0159
NP_442140.1_3 Reverse -70 -80 8.92815 0.117
NP_442723.1_1 Reverse -91 -110 2.06362 0.292
NP_440875.1_2 Forward -160 -141 7.86593 0.203
NP_440875.1_9 Forward -76 -66 17.619 0.0104
NP_440875.1_9 Reverse -71 -81 7.10665 0.283
NP_441813.1_5 Reverse -67 -77 10.0098 0.0208
NP_441813.1_5 Forward -80 -70 7.94484 0.0517
NP_441813.1_5 Reverse -244 -254 3.02829 0.178
NP_442089.1_1 Reverse -66 -85 0.0977854 0.261
NP_440590.1_4 Forward -77 -64 14.6706 0.0106
NP_440590.1_4 Reverse -192 -205 -4.50394 0.262
NP_440590.1_4 Reverse -381 -394 -5.97891 0.296
NP_440567.1_1 Forward -77 -63 15.5359 0.017
NP_440567.1_1 Reverse -70 -84 2.2612 0.179
NP_440567.1_1 Forward -388 -374 0.491246 0.244
NP_442497.1_10 Reverse -70 -79 15.7327 0.0087
NP_442497.1_10 Forward -77 -68 10.4228 0.0087
NP_442497.1_10 Reverse -381 -390 0.29472 0.199
NP_440821.1_4 Reverse -67 -77 18.7612 0.00422
NP_440821.1_4 Forward -80 -70 10.2065 0.0163
NP_440821.1_4 Reverse -378 -388 2.92996 0.131
NP_440821.1_4 Forward -391 -381 -0.0199663 0.217
NP_441239.1_9 Forward -80 -68 17.4436 0.0146
NP_441239.1_9 Reverse -67 -79 11.937 0.0529
NP_441951.1_9 Reverse -190 -209 7.96426 0.229
NP_441892.1_1 Reverse -60 -77 3.97208 0.117
NP_442044.1_1 Reverse -69 -88 -7.76869 0.23
NP_442044.1_1 Reverse -375 -394 -13.5702 0.277
NP_442216.1_4 Reverse -161 -169 8.1805 0.255
NP_442216.1_4 Forward -138 -130 8.08217 0.255
NP_440949.1_7 Reverse -61 -80 9.7334 0.258
NP_440354.1_7 Forward -84 -66 9.16393 0.229
NP_442138.1_1 Forward -77 -58 4.52188 0.24
NP_442138.1_10 Forward -78 -59 -7.37537 0.288
NP_440546.1_4 Reverse -246 -256 9.27034 0.146
NP_440546.1_4 Reverse -69 -79 6.65249 0.288
NP_439974.1_4 Reverse -58 -77 19.3707 0.0855
NP_442041.1_5 Reverse -153 -172 0.196116 0.257
NP_442041.1_5 Forward -389 -370 -1.47551 0.286
NP_440462.1_6 Reverse -67 -77 17.9746 0.00578
NP_440462.1_6 Reverse -244 -254 12.1731 0.0371
NP_440462.1_6 Forward -80 -70 10.7964 0.0396
NP_440868.1_4 Reverse -65 -77 2.98891 0.142
NP_440868.1_4 Forward -82 -70 -0.944332 0.284
NP_442402.1_4 Reverse -318 -337 -6.58946 0.259
NP_442402.1_4 Reverse -354 -373 -7.76943 0.278
NP_442402.1_4 Forward -329 -310 -8.85106 0.284
NP_442402.1_10 Forward -137 -127 13.1559 0.204
NP_441848.1_7 Reverse -29 -48 -0.39464 0.24
NP_441084.1_6 Forward -80 -66 9.05325 0.295
NP_441843.2_9 Forward -381 -363 10.0057 0.257
NP_442039.1_4 Forward -77 -70 15.1821 0.0124
NP_442039.1_4 Reverse -70 -77 15.1821 0.0124
NP_442039.1_4 Forward -388 -381 8.59391 0.193
NP_442039.1_4 Forward -254 -247 8.10225 0.221
NP_442039.1_7 Forward -34 -24 12.3697 0.236
NP_441811.1_1 Reverse -251 -270 3.83436 0.299
NP_441811.1_8 Forward -389 -375 6.6861 0.265
NP_442679.1_1 Forward -43 -24 -4.91709 0.286
NP_442829.1_2 Forward -37 -21 7.85119 0.295
NP_442696.1_2 Reverse -68 -86 12.9988 0.129
NP_442837.1_3 Forward -77 -70 15.7721 0.0124
NP_442837.1_3 Reverse -70 -77 15.7721 0.0124
NP_440160.1_2 Forward -361 -342 -7.86702 0.286
NP_442053.1_1 Reverse -69 -78 9.34117 0.0666
NP_442053.1_1 Forward -78 -69 8.84951 0.072
NP_442053.1_1 Reverse -246 -255 4.12963 0.267
NP_440505.1_3 Reverse -67 -77 14.1397 0.0235
NP_440505.1_3 Forward -80 -70 5.5849 0.222
NP_440505.1_3 Reverse -244 -254 4.50326 0.284
NP_441252.1_6 Forward -317 -310 11.6422 0.288
NP_441203.1_1 Forward -68 -49 -13.0786 0.153
NP_442532.1_7 Reverse -69 -83 22.4191 0.0421
NP_442532.1_7 Forward -78 -64 4.03116 0.178
NP_440914.1_1 Reverse -69 -79 14.0802 0.0188
NP_440914.1_1 Forward -200 -190 11.3477 0.097
NP_440914.1_1 Forward -255 -245 10.2742 0.147
NP_440914.1_1 Forward -383 -373 9.10306 0.186
NP_440914.1_1 Forward -130 -120 8.02955 0.211
NP_440914.1_1 Reverse -294 -304 7.05364 0.254
NP_440914.1_1 Forward -389 -379 6.56569 0.273
NP_441011.1_8 Forward -77 -68 16.9127 0.00602
NP_441011.1_8 Forward -254 -245 9.53783 0.123
NP_441011.1_8 Reverse -70 -79 8.94785 0.141
NP_442101.1_10 Reverse -216 -235 -7.17871 0.209
NP_442533.1_6 Reverse -69 -78 7.86621 0.0862
NP_442533.1_6 Forward -78 -69 7.37455 0.0898
NP_442533.1_6 Reverse -198 -207 4.32629 0.184
NP_442533.1_6 Reverse -246 -255 2.458 0.255
NP_442533.1_6 Reverse -266 -275 2.16301 0.27
NP_442533.1_6 Forward -200 -191 1.37636 0.3
NP_442232.1_3 Forward -338 -319 -0.4922 0.151
NP_442322.1_4 Reverse -258 -275 -7.13998 0.279
NP_442229.1_1 Forward -80 -66 11.2087 0.18
NP_441482.1_7 Reverse -63 -77 -10.2268 0.209
NP_439944.1_9 Reverse -70 -80 15.5163 0.0177
NP_439944.1_9 Forward -77 -67 10.4031 0.0887
NP_439944.1_9 Reverse -381 -391 4.99491 0.284
NP_441028.1_6 Forward -136 -126 8.3377 0.216
NP_441028.1_6 Reverse -328 -338 6.0761 0.232
NP_441028.1_6 Reverse -36 -46 5.38779 0.255
NP_441028.1_6 Forward -220 -210 3.51951 0.292
NP_440116.1_8 Forward -77 -58 -10.1286 0.299
NP_440115.1_6 Forward -392 -382 6.96153 0.166
NP_440007.1_9 Reverse -65 -79 4.71948 0.267
NP_440007.1_9 Forward -204 -190 3.04785 0.277
NP_440007.1_9 Forward -387 -373 2.2612 0.281
NP_440007.1_9 Reverse -263 -277 0.786239 0.29
NP_439965.1_1 Reverse -371 -390 -3.14714 0.182
NP_441680.1_4 Forward -279 -260 -2.26216 0.267
NP_441602.1_3 Forward -83 -64 5.40766 0.141
NP_441602.1_3 Reverse -64 -83 -5.50708 0.288
NP_441972.1_5 Reverse -199 -218 6.09597 0.0852
NP_441972.1_5 Reverse -288 -307 -9.83364 0.293
NP_441106.1_1 Reverse -68 -77 18.191 0.0028
NP_441106.1_1 Forward -79 -70 9.34117 0.0333
NP_439903.1_6 Reverse -243 -262 1.27698 0.249
NP_442306.1_10 Reverse -300 -319 -21.0434 0.242
NP_441286.1_1 Forward -79 -67 4.07055 0.0373
NP_441286.1_1 Reverse -68 -80 -3.99259 0.148
NP_441286.1_1 Reverse -379 -391 -4.58258 0.165
NP_440670.1_8 Reverse -69 -78 16.3227 0.00291
NP_440670.1_8 Forward -78 -69 15.1427 0.00768
NP_441930.1_1 Reverse -56 -75 6.29264 0.266
NP_440886.1_7 Forward -131 -121 10.0093 0.0805
NP_440886.1_7 Reverse -68 -78 8.53436 0.0805
NP_440886.1_7 Forward -201 -191 4.89613 0.213
NP_440828.1_4 Forward -79 -60 6.29183 0.124
NP_440828.1_4 Reverse -373 -392 -7.76943 0.291
NP_442614.1_2 Forward -336 -322 10.0294 0.235
NP_439995.1_3 Forward -356 -337 11.4058 0.288
NP_442072.1_9 Reverse -293 -311 -23.0886 0.277
NP_442072.1_9 Forward -79 -61 -23.187 0.284
NP_442401.1_2 Reverse -68 -87 10.7167 0.171
NP_441427.1_6 Forward -353 -335 12.4089 0.211
NP_440907.2_8 Forward -77 -67 17.4824 0.00685
NP_440907.2_8 Reverse -70 -80 17.2858 0.00883
NP_440907.2_8 Reverse -381 -391 13.2542 0.0469
NP_442264.1_5 Reverse -374 -388 16.5192 0.222
NP_441463.1_3 Forward -217 -198 3.14605 0.107
NP_441463.1_3 Forward -88 -69 -9.047 0.276
NP_441626.1_2 Forward -77 -70 15.7721 0.0124
NP_441626.1_2 Reverse -70 -77 15.7721 0.0124
NP_442238.1_1 Reverse -369 -388 8.25926 0.132
NP_442794.1_1 Reverse -365 -377 2.89058 0.286
NP_442615.1_1 Forward -87 -69 -3.12744 0.156
NP_441962.1_4 Forward -83 -64 -0.000545616 0.117
NP_441962.1_4 Reverse -55 -74 -9.73531 0.22
NP_441962.1_4 Reverse -64 -83 -14.5535 0.29
NP_440387.1_1 Forward -78 -62 -1.41643 0.142
NP_440387.1_1 Reverse -69 -85 -1.51476 0.143
NP_441431.1_2 Reverse -66 -80 12.192 0.126
NP_441488.1_7 Forward -84 -65 8.25926 0.121
NP_440114.1_10 Reverse -69 -83 15.2409 0.0283
NP_440114.1_10 Reverse -246 -260 9.43936 0.172
NP_440114.1_10 Reverse -380 -394 7.07942 0.246
NP_440114.1_10 Forward -255 -241 6.48943 0.269
NP_441510.2_2 Reverse -376 -395 4.32522 0.26
NP_440766.1_4 Reverse -65 -79 1.37622 0.236
NP_440766.1_4 Forward -82 -68 0.589577 0.276
NP_441237.1_9 Reverse -381 -391 14.6313 0.0285
NP_442867.1_8 Reverse -190 -209 5.70265 0.276
NP_440457.1_1 Reverse -65 -77 5.34885 0.141
NP_440798.1_6 Reverse -70 -83 0.412608 0.267
NP_441984.1_3 Forward -82 -64 8.96727 0.217
NP_441436.1_2 Reverse -115 -134 -2.65548 0.28
NP_440473.1_9 Reverse -58 -77 -6.49039 0.235
NP_442509.1_9 Forward -78 -68 12.1726 0.101
NP_442509.1_9 Forward -207 -197 6.0761 0.293
NP_440734.1_9 Reverse -59 -78 15.7324 0.176
NP_441440.1_1 Forward -122 -103 7.47261 0.284
NP_440554.1_4 Reverse -70 -80 16.6963 0.0189
NP_440554.1_4 Forward -77 -67 13.943 0.0218
NP_440554.1_4 Reverse -247 -257 5.68323 0.135
NP_441845.1_3 Reverse -335 -354 22.5164 0.0681
NP_441845.1_6 Reverse -57 -75 -0.0791831 0.274
NP_441761.1_8 Reverse -249 -268 20.0533 0.26
NP_441885.1_5 Reverse -69 -79 2.24165 0.0822
NP_441885.1_5 Forward -78 -68 1.65166 0.106
NP_441885.1_5 Forward -389 -379 -0.216628 0.189
NP_441428.1_8 Reverse -61 -80 3.34271 0.251
NP_442341.1_7 Forward -79 -65 3.73617 0.214
NP_442341.1_9 Reverse -264 -278 8.55376 0.168
NP_442341.1_9 Forward -278 -264 4.8172 0.291
NP_441173.1_9 Reverse -24 -32 12.1137 0.21
NP_441173.1_9 Forward -135 -127 10.1471 0.261
NP_440409.1_1 Forward -86 -67 1.67108 0.184
NP_443000.1_3 Forward -274 -255 11.3286 0.255
NP_443000.1_7 Reverse -67 -77 2.04498 0.226
NP_443000.1_7 Forward -80 -70 1.74999 0.229
NP_443000.1_7 Reverse -136 -146 1.16001 0.271
NP_441842.1_10 Reverse -62 -76 16.9125 0.0273
NP_440275.1_3 Forward -80 -70 18.7612 0.0082
NP_440275.1_3 Reverse -67 -77 17.9746 0.0082
NP_442932.1_9 Forward -42 -23 5.50599 0.266
NP_440091.1_1 Reverse -65 -77 12.6253 0.0353
NP_440091.1_1 Forward -82 -70 1.21895 0.204
NP_441902.1_3 Reverse -126 -136 12.9817 0.23
NP_440679.1_10 Forward -76 -57 -16.0285 0.25
NP_443010.1_10 Forward -258 -241 8.47219 0.16
NP_442451.1_2 Reverse -61 -80 -8.55534 0.251
NP_441122.1_1 Forward -307 -292 4.20813 0.28
NP_439962.1_4 Forward -86 -67 3.53937 0.189
NP_439962.1_4 Reverse -61 -80 -2.95047 0.242
NP_439962.1_4 Reverse -329 -348 -5.99873 0.28
NP_441875.1_7 Reverse -226 -236 15.0247 0.262
NP_440216.1_1 Reverse -69 -83 -4.7203 0.114
NP_440216.1_1 Forward -78 -64 -11.4068 0.184
NP_440172.1_1 Reverse -69 -79 10.9931 0.0445
NP_440172.1_1 Forward -200 -190 7.45319 0.0789
NP_440172.1_1 Reverse -246 -256 7.15819 0.0897
NP_440172.1_6 Reverse -57 -76 6.19431 0.278
NP_440167.1_3 Reverse -59 -78 11.0125 0.231
NP_441226.1_7 Forward -77 -70 14.4934 0.0123
NP_441226.1_7 Reverse -70 -77 14.4934 0.0123
NP_441226.1_7 Forward -254 -247 9.77352 0.131
NP_441111.1_7 Forward -77 -69 18.7023 0.00294
NP_441111.1_7 Reverse -70 -78 8.96754 0.0463
NP_441766.1_2 Forward -78 -69 16.2243 0.0047
NP_441766.1_2 Reverse -69 -78 9.14451 0.0337
NP_441766.1_2 Reverse -246 -255 4.62128 0.172
NP_441766.1_9 Forward -77 -58 -2.26216 0.276
NP_443052.1_8 Reverse -59 -78 0.196116 0.0669
NP_443052.1_8 Forward -88 -69 -12.2919 0.252
NP_443052.1_9 Reverse -206 -225 -6.09707 0.276
NP_440072.1_5 Forward -270 -252 1.98577 0.236
NP_442154.1_1 Forward -71 -53 -16.1071 0.232
NP_442154.1_1 Forward -77 -59 -16.5005 0.241
NP_441430.1_2 Forward -65 -46 2.45773 0.132
NP_440261.1_5 Reverse -381 -394 -4.9956 0.183
NP_440261.1_5 Forward -77 -64 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGACTTAGGGGGCGATACCGATGCCATTTTGGAAGAAAGCGACAATCCTGGCCCCTGGTTGCTGGGGGTAACCATGAAGGGTTTCGGCAAACGGGTGCCCATTGGTCAATTCCGCTTGCAACATCGGGCCGGCCTGGGAGTGAAAGCGATCCGCTTTAAATCCAAAGATGACCAGCTAGTGGCCCTCCATGTGGTCAACGCCGATGACGAGTTGATGATTGTCACCAACCGGGGCATTATTATCCGCCAGTCCGTGAACGATATTTCCCCCCAATCCCGTAGTGCCACTGGGGTGCGGGTACAAAGGTTAGATGCCGATGATGCGATCGCCGCTGTGGCCCTAGTGCCTCCTTCTGGGGAAGAAGAATTGGCAGAAATGTCGGAAAGCGAAGAGAGCTG

CDS

ATGGCCCCCCAACCTACCGCAACCACTACCCTGGCCGTTGTGGGGGATATCCATGAACAATGGGAATTGGCGGACCACCAAGCTCTCCAGGCGATCGGCGTAGACTTGGCACTATTTGTGGGGGATTTTGGCAACGAATCATTGCCGGTGGTCAGCTTGATTGCCTCCTTACCCATTCCCAAGGCAACGGTATTTGGTAACCACGATGCTTGGTTCACCGCCTCCGATTGGGGGCGCAAAAAGTGCCCCTACGATCGCCAAAAAGAAGACCGGGTGAAAGCTCAGCAGGAACTCCTGGGGTTGGCAGATGTTAGCTATGGCCGCCGGGATTTTCAGCAATTTAGCCTCTCGGTGGTGGGGGGCAGGCCTTTTACCTGGGGGGGCAATGAATGGAAGAATAAACAGTTTATGCGGGAACGATATGGCATGGAAAGTTTTGCCCAGTCCCAAACCCACATTGCCGCAACGGCCCTGGCTAGCCCCCATGAAACGTTAATTTTTCTGGCCCACAATGGTCCCACCGGCTTAGGAAATCATGCCGAATCCATCTGTGGTCGGGATTGGAATCCCATCGGCGGCGATTTTGGCGATCCGGATCTGGCCTGGGCGATCGCCTCTGTGCGGGAGCAGGGTAAACAGGTACCATTGGTGACCTTCGGCCATATGCACCATCGCCTTAGACATCGTCAGGATCGTCTGCGGGAGAGGGTTTATGTGGATCATCAAGGAACGGTATATCTGAATGCGGCCTGTGTACCCCGCATCCAAACGGAAAAAGACGGTTTGCCCGCTGCCCGTAATTTTTCCCTGGTGACTTTGGTGAATGGCACTGTGGAAAAAATCACCCTGGTGTGGTTACGGAATAACGGAGAAATTATCAGCCAGGAAACCCTTTGGATTAGTGCCCATTAA

Protein

MAPQPTATTTLAVVGDIHEQWELADHQALQAIGVDLALFVGDFGNESLPVVSLIASLPIPKATVFGNHDAWFTASDWGRKKCPYDRQKEDRVKAQQELLGLADVSYGRRDFQQFSLSVVGGRPFTWGGNEWKNKQFMRERYGMESFAQSQTHIAATALASPHETLIFLAHNGPTGLGNHAESICGRDWNPIGGDFGDPDLAWAIASVREQGKQVPLVTFGHMHHRLRHRQDRLRERVYVDHQGTVYLNAACVPRIQTEKDGLPAARNFSLVTLVNGTVEKITLVWLRNNGEIISQETLWISAH