Your browser is old and dusty. Try Google Chrome!

Details for slr0379

ORF slr0379
Accession NP_442029.1
Symbol
Category Other
Definition thymidylate kinase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -282 -268 13.4709 0.172
NP_442711.1_1 Reverse -374 -388 11.406 0.246
NP_441061.1_2 Reverse -105 -119 3.14618 0.168
NP_441061.1_2 Forward -365 -351 2.45787 0.176
NP_441061.1_2 Forward -227 -213 -0.393733 0.228
NP_441061.1_2 Reverse -69 -83 -0.688726 0.237
NP_441061.1_2 Forward -185 -171 -0.787057 0.239
NP_440557.1_1 Reverse -352 -371 -1.37718 0.271
NP_440795.1_7 Forward -320 -313 6.92228 0.26
NP_441418.1_6 Forward -113 -94 -3.73712 0.0249
NP_441418.1_6 Forward -339 -320 -29.2048 0.219
NP_441418.1_6 Reverse -351 -370 -30.1882 0.262
NP_441418.1_6 Reverse -168 -187 -30.2865 0.267
NP_441418.1_6 Reverse -53 -72 -30.2865 0.267
NP_441453.1_4 Forward -113 -105 14.7691 0.0119
NP_441453.1_4 Reverse -104 -112 6.80426 0.121
NP_441453.1_4 Reverse -1 -9 5.42762 0.135
NP_441453.1_4 Reverse -273 -281 5.0343 0.209
NP_442151.1_6 Forward -113 -99 8.45605 0.172
NP_441818.1_1 Forward -112 -101 10.3829 0.232
NP_441818.1_1 Reverse -69 -80 8.90795 0.271
NP_441818.1_9 Reverse -357 -376 -5.40875 0.253
NP_441818.1_9 Forward -330 -311 -7.37537 0.272
NP_441818.1_9 Forward -336 -317 -9.83364 0.291
NP_441818.1_9 Reverse -168 -187 -10.522 0.295
NP_441818.1_9 Reverse -348 -367 -10.9153 0.299
NP_440226.1_1 Reverse -273 -292 12.3892 0.0451
NP_440348.1_5 Forward -101 -82 16.0274 0.0984
NP_442744.1_8 Reverse -177 -196 1.86774 0.214
NP_442744.1_9 Forward -119 -105 12.4475 0.288
NP_443002.1_5 Reverse -316 -334 8.3765 0.297
NP_442173.1_1 Forward -112 -104 12.0158 0.0316
NP_442173.1_1 Reverse -105 -113 12.0158 0.0316
NP_442173.1_1 Reverse -2 -10 7.59091 0.163
NP_442752.1_4 Reverse -104 -111 13.8055 0.0199
NP_442752.1_4 Reverse -53 -60 5.34899 0.221
NP_442752.1_4 Forward -282 -275 4.26735 0.293
NP_441812.1_3 Reverse -329 -343 12.1926 0.21
NP_442975.1_10 Reverse -100 -114 2.16228 0.283
NP_441225.1_4 Reverse -317 -336 -3.93378 0.255
NP_440784.1_7 Reverse -105 -112 6.23397 0.241
NP_440784.1_7 Forward -112 -105 6.13563 0.241
NP_442909.1_7 Reverse -105 -119 6.29216 0.252
NP_442909.1_7 Reverse -306 -320 5.70218 0.27
NP_442000.2_1 Reverse -354 -373 11.8975 0.226
NP_440061.1_3 Reverse -350 -369 7.96426 0.278
NP_440061.1_9 Forward -115 -101 21.73 0.00189
NP_440061.1_9 Forward -80 -66 6.19383 0.255
NP_440061.1_9 Forward -388 -374 5.70218 0.275
NP_439979.1_9 Forward -329 -311 11.6222 0.227
NP_442062.1_8 Reverse -104 -114 7.94484 0.0848
NP_442062.1_8 Forward -113 -103 7.84651 0.0871
NP_441900.1_2 Reverse -317 -335 -4.01314 0.288
NP_441859.1_3 Forward -114 -95 9.7334 0.125
NP_440304.1_4 Reverse -102 -112 8.23984 0.0845
NP_440044.1_8 Forward -112 -93 1.67108 0.168
NP_440011.1_1 Forward -368 -349 12.5858 0.264
NP_442602.1_3 Reverse -226 -245 -2.85214 0.269
NP_441352.1_2 Forward -325 -306 1.17943 0.257
NP_441935.1_1 Reverse -168 -187 8.55425 0.227
NP_441594.1_6 Reverse -95 -114 7.37428 0.173
NP_440132.1_1 Forward -85 -67 8.67227 0.266
NP_442110.1_7 Forward -113 -99 -0.000409212 0.27
NP_441925.1_4 Forward -385 -366 -10.621 0.241
NP_441925.1_4 Reverse -305 -324 -13.9642 0.261
NP_441925.1_4 Reverse -314 -333 -15.0459 0.263
NP_441925.1_4 Forward -383 -364 -16.1275 0.281
NP_441925.1_4 Reverse -184 -203 -16.8158 0.285
NP_441925.1_4 Forward -70 -51 -17.0125 0.287
NP_440856.1_4 Reverse -266 -285 -2.95047 0.226
NP_440856.1_7 Reverse -32 -51 -6.98204 0.246
NP_441083.1_5 Forward -113 -103 18.0729 0.00245
NP_441083.1_5 Reverse -104 -114 17.7779 0.00336
NP_441083.1_5 Forward -62 -52 4.69992 0.134
NP_441083.1_5 Reverse -273 -283 0.176696 0.241
NP_442827.1_8 Reverse -96 -115 0.981987 0.191
NP_441149.1_9 Reverse -254 -273 4.42355 0.221
NP_441738.1_2 Forward -111 -104 15.28 0.0102
NP_441955.1_8 Forward -336 -319 8.59364 0.258
NP_441942.1_2 Forward -327 -308 16.9124 0.141
NP_440209.1_1 Reverse -104 -112 8.57422 0.0425
NP_440209.1_1 Forward -113 -105 8.47588 0.0457
NP_441770.1_4 Reverse -169 -188 -7.4737 0.233
NP_442570.1_3 Reverse -160 -179 -2.16383 0.212
NP_441025.1_6 Forward -43 -24 5.65255 0.222
NP_442111.1_4 Forward -114 -100 18.8791 0.00574
NP_441624.1_7 Reverse -351 -365 10.9143 0.217
NP_441163.1_1 Reverse -343 -360 8.00291 0.233
NP_440343.1_3 Reverse -317 -335 3.95163 0.266
NP_440906.1_5 Reverse -105 -112 6.23397 0.234
NP_440906.1_5 Forward -112 -105 6.13563 0.241
NP_440747.1_10 Forward -116 -104 5.05386 0.019
NP_440747.1_10 Reverse -101 -113 -11.6624 0.131
NP_440747.1_10 Reverse -270 -282 -12.2524 0.254
NP_441130.1_10 Forward -115 -101 6.19444 0.197
NP_441486.1_1 Reverse -101 -115 -3.54032 0.179
NP_441486.1_1 Forward -116 -102 -3.73699 0.181
NP_441265.1_3 Reverse -98 -112 3.24451 0.181
NP_440403.1_4 Reverse -95 -114 -8.94866 0.264
NP_440403.1_10 Reverse -95 -114 12.6841 0.147
NP_440403.1_10 Reverse -309 -328 0.982764 0.293
NP_440842.1_6 Forward -115 -96 11.7983 0.259
NP_440842.1_10 Reverse -173 -187 2.45787 0.274
NP_442848.1_9 Forward -119 -100 -0.983855 0.282
NP_441012.1_4 Reverse -305 -318 6.70579 0.276
NP_443018.1_3 Forward -112 -105 11.7405 0.0655
NP_443018.1_3 Reverse -105 -112 5.44732 0.193
NP_441634.1_8 Forward -79 -65 11.3077 0.0624
NP_441634.1_8 Forward -115 -101 -4.03198 0.295
NP_440376.1_1 Reverse -104 -113 15.7327 0.00625
NP_440376.1_1 Forward -113 -104 9.63616 0.0385
NP_440376.1_1 Reverse -375 -384 1.1797 0.255
NP_441857.1_5 Reverse -127 -145 2.0841 0.277
NP_441588.1_4 Reverse -106 -116 6.17489 0.206
NP_441588.1_4 Reverse -275 -285 6.07655 0.214
NP_442687.1_7 Reverse -103 -113 16.303 0.0125
NP_442485.1_3 Reverse -319 -338 4.42435 0.179
NP_442485.1_3 Forward -188 -169 -0.590531 0.253
NP_442485.1_3 Reverse -63 -82 -1.7705 0.261
NP_442485.1_3 Reverse -48 -67 -5.50708 0.291
NP_441846.1_10 Forward -330 -311 -13.1769 0.199
NP_441846.1_10 Forward -333 -314 -23.2067 0.279
NP_441950.1_7 Forward -327 -308 -0.0988766 0.191
NP_442658.1_1 Reverse -102 -112 7.94438 0.199
NP_440141.1_8 Reverse -95 -114 8.75091 0.23
NP_440141.1_8 Reverse -45 -64 4.71934 0.281
NP_441855.2_4 Forward -70 -51 11.2584 0.221
NP_441414.1_9 Reverse -104 -123 -7.08038 0.211
NP_442300.1_5 Reverse -163 -182 10.9142 0.282
NP_441256.1_1 Forward -369 -350 -2.75381 0.233
NP_442937.1_5 Forward -118 -99 13.0775 0.095
NP_442937.1_5 Forward -287 -268 7.86593 0.241
NP_441165.1_6 Forward -329 -310 12.9791 0.0974
NP_441317.1_4 Forward -91 -77 10.4189 0.29
NP_441958.1_5 Reverse -103 -113 18.2696 0.00183
NP_441958.1_5 Forward -114 -104 2.43831 0.0422
NP_441958.1_5 Forward -283 -273 -1.00328 0.227
NP_441127.1_1 Reverse -95 -109 7.57108 0.3
NP_442836.1_8 Forward -197 -182 16.0078 0.236
NP_440203.1_5 Forward -110 -100 12.7626 0.138
NP_440203.1_5 Forward -174 -164 9.71433 0.245
NP_439905.1_1 Forward -112 -99 8.57408 0.232
NP_440984.1_3 Reverse -218 -237 15.2408 0.283
NP_440984.1_7 Forward -118 -104 6.3911 0.217
NP_442376.1_6 Forward -327 -308 -3.14714 0.295
NP_442690.1_1 Reverse -11 -30 -11.2103 0.225
NP_441591.1_10 Forward -323 -304 6.09597 0.295
NP_442064.1_4 Reverse -347 -366 6.09517 0.257
NP_443055.1_6 Forward -77 -59 10.4414 0.125
NP_443055.1_6 Reverse -295 -313 0.411736 0.243
NP_440993.1_2 Forward -118 -102 1.14018 0.29
NP_440993.1_3 Forward -150 -131 1.17865 0.235
NP_440993.1_3 Reverse -263 -282 -1.37794 0.28
NP_441429.1_8 Reverse -359 -378 21.9273 0.0507
NP_442002.1_9 Reverse -103 -110 14.1004 0.074
NP_441294.1_7 Reverse -100 -114 13.8581 0.0551
NP_441646.1_1 Forward -193 -174 3.6377 0.206
NP_441646.1_7 Reverse -304 -318 14.6509 0.256
NP_442438.1_10 Reverse -99 -113 1.76955 0.188
NP_442438.1_10 Forward -52 -38 -1.08205 0.291
NP_442431.1_10 Forward -333 -315 7.39397 0.17
NP_442431.1_10 Reverse -360 -378 1.19912 0.259
NP_441752.1_6 Reverse -314 -333 3.44104 0.235
NP_441752.1_6 Forward -70 -51 0.982764 0.26
NP_441000.1_6 Forward -260 -246 -4.22864 0.231
NP_440147.1_4 Forward -284 -271 11.524 0.0326
NP_440147.1_4 Forward -115 -102 11.229 0.0335
NP_440147.1_4 Forward -188 -175 4.14919 0.171
NP_440147.1_4 Reverse -102 -115 2.2809 0.209
NP_441550.1_8 Reverse -102 -112 18.5641 0.00754
NP_441550.1_8 Forward -115 -105 13.6475 0.0228
NP_441550.1_8 Forward -284 -274 8.23937 0.127
NP_441550.1_8 Reverse -271 -281 7.45273 0.159
NP_441916.1_7 Forward -113 -103 7.25653 0.0718
NP_440206.1_4 Forward -67 -48 -1.96793 0.293
NP_441041.1_4 Reverse -1 -20 -0.197208 0.0941
NP_441041.1_4 Reverse -273 -292 -12.2919 0.262
NP_441041.1_4 Forward -83 -64 -13.2752 0.285
NP_441041.1_7 Reverse -101 -113 8.97244 0.125
NP_440569.1_6 Reverse -35 -54 1.47442 0.288
NP_441725.1_4 Reverse -268 -282 2.06395 0.297
NP_441725.1_5 Forward -112 -102 8.92815 0.0553
NP_441725.1_5 Reverse -251 -261 -0.904945 0.274
NP_439966.1_7 Forward -115 -105 6.27276 0.185
NP_439966.1_9 Reverse -66 -75 3.7363 0.253
NP_439966.1_9 Reverse -102 -111 0.983037 0.253
NP_442941.1_3 Forward -281 -271 4.40493 0.14
NP_442941.1_3 Reverse -105 -115 1.35667 0.15
NP_440289.1_2 Reverse -101 -114 1.78924 0.115
NP_440983.1_5 Forward -110 -91 -9.047 0.3
NP_440260.1_8 Forward -195 -177 0.412472 0.2
NP_440260.1_8 Reverse -348 -366 -4.70074 0.273
NP_440260.1_8 Reverse -65 -83 -7.55234 0.295
NP_442281.1_1 Forward -118 -104 8.25877 0.0832
NP_442281.1_1 Reverse -268 -282 5.60385 0.152
NP_441334.1_7 Forward -115 -96 -12.6852 0.166
NP_440177.1_1 Forward -184 -166 5.42735 0.272
NP_442012.1_1 Reverse -98 -117 -1.37718 0.286
NP_441556.1_10 Reverse -63 -77 14.1153 0.178
NP_441556.1_10 Reverse -99 -113 10.1245 0.275
NP_443030.1_4 Forward -84 -65 2.94938 0.205
NP_441644.1_6 Forward -113 -103 15.4175 0.00595
NP_441644.1_6 Reverse -104 -114 7.74772 0.117
NP_441644.1_6 Reverse -273 -283 4.89613 0.22
NP_440867.1_10 Forward -369 -350 4.22769 0.283
NP_442215.1_2 Forward -115 -99 0.648521 0.148
NP_442215.1_2 Forward -86 -70 -6.92296 0.281
NP_442177.1_5 Reverse -222 -236 12.3893 0.22
NP_442029.1_5 Forward -193 -174 20.1685 0.217
NP_442029.1_6 Forward -287 -268 20.8456 0.0338
NP_442029.1_6 Forward -330 -311 4.22769 0.271
NP_442029.1_10 Reverse -211 -230 4.03102 0.295
NP_442247.1_6 Reverse -167 -186 14.4541 0.14
NP_442247.1_8 Forward -115 -101 9.34103 0.247
NP_440253.1_2 Forward -252 -234 0.21581 0.192
NP_440929.1_8 Forward -113 -104 16.5193 0.00413
NP_440929.1_8 Reverse -104 -113 9.53783 0.0296
NP_442933.1_10 Forward -113 -104 8.06287 0.0885
NP_442933.1_10 Reverse -104 -113 7.96454 0.0937
NP_442933.1_10 Reverse -273 -282 4.42462 0.246
NP_442554.1_8 Reverse -105 -115 12.9597 0.021
NP_442554.1_8 Forward -112 -102 7.15819 0.0975
NP_442167.1_6 Reverse -94 -110 12.8408 0.229
NP_441762.1_7 Reverse -103 -115 -0.74767 0.0785
NP_441762.1_7 Forward -114 -102 -7.23751 0.286
NP_442142.1_4 Forward -180 -167 14.375 0.0311
NP_442142.1_4 Reverse -327 -340 10.8351 0.0662
NP_442142.1_4 Forward -363 -350 5.91857 0.178
NP_442292.1_1 Reverse -105 -114 8.75118 0.0306
NP_442292.1_1 Forward -112 -103 -0.295266 0.24
NP_442292.1_1 Reverse -274 -283 -0.786921 0.287
NP_442292.1_5 Forward -124 -105 7.07928 0.157
NP_440919.1_1 Reverse -99 -118 17.699 0.021
NP_441899.1_8 Reverse -179 -198 13.7658 0.22
NP_442476.1_6 Forward -61 -47 -0.0987402 0.286
NP_443009.1_5 Forward -114 -103 6.1547 0.173
NP_443009.1_5 Forward -78 -67 5.26972 0.21
NP_442408.2_1 Forward -113 -94 -2.16383 0.241
NP_441715.1_4 Forward -281 -271 5.78156 0.18
NP_441715.1_4 Reverse -213 -223 5.19158 0.224
NP_440777.1_1 Reverse -180 -199 10.6192 0.261
NP_440183.1_9 Forward -111 -92 -15.5368 0.273
NP_440183.1_9 Forward -190 -171 -17.2085 0.276
NP_440183.1_9 Forward -76 -57 -18.3884 0.276
NP_441198.1_8 Forward -394 -384 12.2947 0.144
NP_441198.1_8 Reverse -51 -61 11.5134 0.202
NP_441198.1_8 Reverse -102 -112 10.8298 0.239
NP_440379.1_5 Reverse -356 -375 -3.3438 0.204
NP_440379.1_5 Forward -369 -350 -3.3438 0.204
NP_440379.1_5 Reverse -173 -192 -9.93197 0.27
NP_440379.1_5 Reverse -348 -367 -11.0136 0.288
NP_441468.1_1 Reverse -60 -67 6.72562 0.126
NP_441468.1_1 Reverse -105 -112 6.13563 0.209
NP_441468.1_1 Forward -112 -105 6.0373 0.223
NP_441015.1_10 Reverse -372 -391 -6.09707 0.241
NP_441015.1_10 Forward -329 -310 -10.227 0.283
NP_441015.1_10 Forward -332 -313 -10.522 0.284
NP_441673.1_1 Reverse -104 -113 11.1111 0.0121
NP_441673.1_1 Forward -113 -104 11.0128 0.018
NP_441244.1_8 Forward -336 -317 4.12936 0.144
NP_441876.1_9 Reverse -264 -274 14.9258 0.267
NP_441826.1_2 Reverse -98 -112 3.53951 0.109
NP_441826.1_2 Forward -227 -213 1.86788 0.14
NP_441330.1_1 Reverse -268 -287 -14.0619 0.212
NP_441393.1_2 Reverse -164 -183 13.3552 0.272
NP_442868.1_6 Reverse -102 -112 7.05986 0.0898
NP_442868.1_6 Forward -115 -105 -0.0199663 0.255
NP_442677.1_7 Reverse -323 -333 18.8596 0.237
NP_442227.1_2 Reverse -311 -330 4.22769 0.208
NP_442227.1_2 Forward -385 -366 -0.39387 0.253
NP_442808.1_1 Forward -114 -104 9.22267 0.0481
NP_442808.1_1 Forward -375 -365 3.91283 0.218
NP_442808.1_1 Reverse -323 -333 3.42118 0.24
NP_441101.1_10 Forward -184 -165 -7.37537 0.29
NP_442542.1_2 Reverse -102 -115 12.5073 0.114
NP_442542.1_2 Reverse -51 -64 8.27909 0.158
NP_442542.1_9 Reverse -97 -111 13.5686 0.108
NP_442050.1_1 Forward -271 -252 8.75091 0.25
NP_442342.1_9 Forward -185 -169 2.61514 0.285
NP_441114.1_3 Forward -175 -166 7.37455 0.239
NP_440558.1_2 Forward -180 -161 8.75091 0.108
NP_440558.1_2 Reverse -65 -84 6.4893 0.136
NP_440558.1_2 Forward -81 -62 -7.17871 0.289
NP_440111.2_2 Reverse -93 -112 2.85105 0.201
NP_441048.1_3 Forward -72 -53 3.53937 0.275
NP_441878.1_6 Reverse -103 -113 10.5014 0.0176
NP_441878.1_6 Forward -193 -183 1.455 0.0979
NP_441878.1_6 Reverse -182 -192 1.06167 0.116
NP_441878.1_6 Forward -114 -104 0.57002 0.14
NP_441878.1_6 Forward -319 -309 -7.00147 0.201
NP_441878.1_6 Forward -84 -74 -7.59145 0.245
NP_441036.1_8 Reverse -103 -113 7.15819 0.208
NP_441036.1_8 Reverse -99 -109 6.46988 0.229
NP_441557.1_5 Reverse -104 -113 10.2261 0.0144
NP_441557.1_5 Forward -113 -104 10.1278 0.0188
NP_441557.1_5 Forward -282 -273 -0.786921 0.239
NP_441557.1_8 Reverse -135 -145 12.0743 0.236
NP_441445.1_1 Forward -327 -308 8.75091 0.116
NP_441445.1_1 Reverse -95 -114 3.34271 0.215
NP_441590.1_3 Reverse -208 -227 13.2741 0.205
NP_441590.1_4 Forward -382 -363 2.6536 0.293
NP_441433.1_8 Reverse -98 -117 1.0811 0.236
NP_441433.1_8 Reverse -140 -159 -0.295539 0.244
NP_441433.1_8 Forward -365 -346 -0.4922 0.246
NP_441433.1_8 Reverse -352 -371 -4.72043 0.294
NP_441739.1_2 Reverse -112 -128 7.13767 0.22
NP_441739.1_2 Reverse -184 -200 3.20445 0.281
NP_441308.1_8 Forward -394 -384 7.94484 0.297
NP_440101.1_3 Reverse -361 -380 7.86593 0.17
NP_442830.1_5 Reverse -350 -364 9.04542 0.192
NP_442469.1_7 Forward -236 -217 13.8641 0.282
NP_442183.1_1 Reverse -104 -118 4.62115 0.254
NP_442183.1_3 Reverse -302 -321 14.2566 0.247
NP_442183.1_9 Reverse -360 -370 10.7964 0.268
NP_441459.1_3 Reverse -309 -328 10.2621 0.296
NP_441549.1_3 Forward -187 -169 20.177 0.172
NP_441549.1_9 Reverse -49 -67 -10.2073 0.273
NP_441549.1_9 Forward -117 -99 -10.6989 0.285
NP_441638.1_10 Forward -198 -184 15.5359 0.266
NP_442347.1_2 Reverse -274 -283 12.5861 0.056
NP_442347.1_2 Forward -220 -211 4.71961 0.266
NP_442645.1_2 Reverse -51 -70 -18.6834 0.278
NP_441037.1_4 Reverse -102 -112 9.85159 0.21
NP_442594.1_8 Reverse -165 -184 4.52268 0.26
NP_442508.1_8 Forward -284 -267 8.88863 0.297
NP_442317.1_6 Reverse -304 -323 2.26107 0.285
NP_441633.1_3 Forward -115 -102 10.5407 0.0286
NP_441633.1_3 Reverse -319 -332 -6.07724 0.236
NP_440136.1_2 Reverse -105 -112 6.23397 0.171
NP_440136.1_2 Forward -112 -105 6.13563 0.193
NP_442998.1_5 Forward -261 -251 8.33817 0.264
NP_442998.1_10 Forward -111 -104 15.5754 0.0102
NP_442998.1_10 Reverse -275 -282 5.93897 0.206
NP_442998.1_10 Reverse -106 -113 5.84064 0.235
NP_440299.1_1 Reverse -70 -83 9.16348 0.0774
NP_440299.1_1 Reverse -100 -113 6.70522 0.133
NP_440299.1_1 Reverse -140 -153 4.24695 0.213
NP_440299.1_1 Forward -117 -104 3.46031 0.243
NP_441799.1_4 Forward -227 -208 -6.29373 0.266
NP_441007.1_10 Forward -326 -313 0.510939 0.226
NP_441007.1_10 Reverse -99 -112 0.0192843 0.254
NP_442334.1_1 Reverse -92 -111 5.50599 0.135
NP_442334.1_2 Reverse -374 -391 -13.7275 0.297
NP_440256.1_1 Forward -285 -266 -4.6221 0.161
NP_440256.1_1 Forward -116 -97 -9.53865 0.281
NP_441362.1_2 Forward -32 -13 8.04514 0.243
NP_442007.1_8 Reverse -311 -329 12.3097 0.258
NP_441559.1_8 Reverse -64 -78 2.85119 0.143
NP_440915.1_6 Reverse -100 -114 7.47274 0.0689
NP_442866.1_1 Reverse -346 -365 -2.0655 0.207
NP_442866.1_1 Reverse -63 -82 -7.76869 0.268
NP_442866.1_1 Reverse -48 -67 -8.65367 0.282
NP_441464.1_8 Reverse -309 -323 17.4042 0.072
NP_440702.1_2 Forward -335 -316 -5.9004 0.257
NP_441494.1_6 Reverse -99 -112 7.98409 0.242
NP_442993.1_1 Reverse -104 -120 -8.59459 0.17
NP_442386.1_9 Reverse -350 -359 11.4057 0.0942
NP_442386.1_9 Forward -114 -105 10.029 0.142
NP_442386.1_9 Forward -78 -69 5.30919 0.257
NP_442054.1_4 Forward -239 -220 13.5691 0.275
NP_441750.1_1 Forward -330 -311 -4.52377 0.204
NP_441750.1_4 Reverse -318 -337 3.6377 0.231
NP_441340.1_5 Reverse -105 -112 13.5105 0.0314
NP_441340.1_5 Forward -112 -105 5.84064 0.208
NP_441340.1_5 Forward -9 -2 3.97235 0.274
NP_442791.1_5 Reverse -211 -230 -8.26035 0.279
NP_440168.1_9 Reverse -52 -71 -3.63879 0.296
NP_442714.1_7 Reverse -75 -94 -1.37718 0.287
NP_440586.1_8 Forward -112 -105 9.47853 0.146
NP_440586.1_8 Reverse -331 -338 7.02027 0.279
NP_440586.1_8 Reverse -105 -112 5.74197 0.283
NP_440586.1_9 Reverse -147 -166 6.19431 0.288
NP_440192.1_4 Forward -323 -304 9.20356 0.279
NP_442959.1_1 Reverse -52 -71 5.80098 0.274
NP_440684.1_9 Forward -119 -105 20.3541 0.015
NP_441262.1_3 Reverse -104 -111 14.7888 0.0223
NP_441262.1_3 Forward -10 -3 5.34899 0.181
NP_440027.1_3 Forward -113 -95 12.6047 0.159
NP_440027.1_3 Forward -78 -60 5.62325 0.239
NP_440027.1_8 Reverse -240 -259 4.12856 0.292
NP_443051.1_1 Reverse -103 -112 15.1427 0.00754
NP_443051.1_1 Forward -114 -105 0.589713 0.143
NP_441232.1_9 Forward -399 -380 19.7631 0.151
NP_439937.1_9 Forward -178 -161 7.60959 0.0798
NP_439937.1_9 Forward -63 -46 0.234807 0.103
NP_439937.1_9 Forward -114 -97 -7.33664 0.158
NP_439937.1_9 Forward -64 -47 -11.0732 0.241
NP_439937.1_9 Reverse -257 -274 -11.9582 0.269
NP_440439.1_1 Reverse -101 -114 1.49425 0.153
NP_439943.1_7 Forward -287 -268 1.96607 0.299
NP_440372.1_2 Reverse -105 -112 13.8055 0.0214
NP_440372.1_2 Forward -112 -105 6.52896 0.188
NP_440372.1_2 Forward -9 -2 4.26735 0.221
NP_440372.1_2 Forward -281 -274 4.07068 0.262
NP_440171.1_3 Reverse -49 -68 12.5858 0.177
NP_440171.1_3 Reverse -362 -381 4.03102 0.284
NP_441789.1_7 Reverse -311 -330 5.40686 0.193
NP_441789.1_7 Reverse -314 -333 -1.47628 0.251
NP_441789.1_7 Forward -70 -51 -2.45958 0.257
NP_441789.1_7 Forward -376 -357 -4.52452 0.283
NP_441803.1_2 Forward -118 -99 -1.27885 0.297
NP_441572.1_7 Reverse -267 -286 -5.99873 0.278
NP_442384.1_10 Forward -113 -100 10.344 0.0461
NP_442384.1_10 Reverse -273 -286 4.05085 0.17
NP_442384.1_10 Reverse -183 -196 2.67422 0.216
NP_442384.1_10 Reverse -177 -190 1.19926 0.267
NP_440364.1_6 Reverse -350 -363 15.0633 0.275
NP_441018.1_7 Reverse -49 -68 9.43923 0.223
NP_442790.1_4 Forward -122 -103 -7.17871 0.151
NP_442262.1_10 Forward -112 -105 13.2155 0.0213
NP_442244.1_3 Reverse -215 -234 7.17762 0.189
NP_440344.1_10 Reverse -97 -114 -3.20608 0.0802
NP_440282.1_10 Reverse -173 -192 -8.752 0.263
NP_440531.1_6 Reverse -96 -115 -2.65548 0.257
NP_440531.1_8 Reverse -214 -233 15.6341 0.105
NP_441060.1_3 Reverse -98 -117 9.83255 0.218
NP_441965.1_10 Reverse -56 -72 7.13836 0.155
NP_440297.1_9 Reverse -352 -362 0.766681 0.282
NP_440297.1_9 Forward -191 -181 -0.314959 0.282
NP_440297.1_9 Forward -112 -102 -0.314959 0.282
NP_441592.1_4 Reverse -177 -196 -3.04881 0.274
NP_441592.1_4 Forward -68 -49 -4.13045 0.296
NP_441896.1_3 Forward -237 -218 1.47442 0.214
NP_441896.1_3 Reverse -95 -114 0.196116 0.23
NP_440894.1_10 Forward -188 -169 2.65439 0.286
NP_442067.1_4 Forward -371 -352 8.84924 0.194
NP_442067.1_4 Reverse -87 -106 2.45773 0.295
NP_440999.1_9 Reverse -100 -114 2.2612 0.152
NP_440999.1_9 Reverse -269 -283 1.96621 0.156
NP_440999.1_9 Reverse -64 -78 -2.45868 0.27
NP_440999.1_9 Forward -387 -373 -3.54032 0.296
NP_440888.1_2 Forward -113 -99 10.8154 0.0842
NP_440888.1_2 Forward -383 -369 5.30886 0.284
NP_439969.1_1 Forward -115 -96 -7.08038 0.291
NP_442948.1_2 Forward -283 -264 5.30933 0.256
NP_442033.1_10 Forward -386 -367 -11.5053 0.254
NP_441543.1_2 Reverse -105 -114 7.57121 0.113
NP_442845.1_2 Reverse -53 -67 13.5693 0.0949
NP_442845.1_2 Forward -327 -313 6.98109 0.199
NP_442845.1_2 Forward -288 -274 4.81781 0.251
NP_442845.1_2 Forward -192 -178 4.42448 0.259
NP_442845.1_2 Forward -83 -69 3.44117 0.29
NP_440380.1_1 Reverse -366 -385 -10.7186 0.284
NP_441469.1_8 Reverse -350 -359 12.7828 0.0967
NP_441548.1_3 Forward -112 -93 8.65176 0.286
NP_442315.1_1 Reverse -355 -373 9.0656 0.206
NP_442315.1_1 Reverse -172 -190 3.75572 0.287
NP_442315.1_2 Reverse -163 -175 10.7571 0.291
NP_443064.1_6 Forward -113 -103 11.6943 0.124
NP_443064.1_6 Reverse -104 -114 11.4034 0.13
NP_443064.1_6 Forward -282 -272 9.94905 0.187
NP_442337.1_6 Reverse -167 -186 16.0824 0.184
NP_442337.1_8 Reverse -157 -176 8.35759 0.191
NP_442578.1_5 Reverse -260 -279 6.58763 0.227
NP_442578.1_7 Forward -400 -393 9.97054 0.112
NP_442578.1_7 Reverse -105 -112 6.0373 0.18
NP_441462.1_2 Forward -113 -103 10.3048 0.0123
NP_441462.1_2 Reverse -104 -114 9.81313 0.0143
NP_441462.1_2 Forward -282 -272 7.74818 0.0513
NP_441621.1_7 Reverse -310 -324 -6.58858 0.298
NP_443062.1_1 Reverse -273 -291 4.54812 0.258
NP_441601.1_2 Reverse -336 -355 -1.27885 0.236
NP_441601.1_2 Forward -119 -100 -1.96717 0.25
NP_440519.1_8 Reverse -168 -184 2.41848 0.262
NP_442204.1_1 Reverse -100 -111 0.746988 0.281
NP_442204.1_1 Reverse -269 -280 0.0586712 0.284
NP_442204.1_5 Forward -231 -212 5.11266 0.16
NP_440516.1_6 Forward -62 -48 8.06211 0.255
NP_440516.1_6 Reverse -342 -356 6.58715 0.293
NP_440516.1_8 Reverse -104 -113 16.9127 0.00442
NP_440516.1_8 Forward -113 -104 14.8477 0.00685
NP_440516.1_8 Forward -282 -273 -0.295266 0.232
NP_440516.1_8 Reverse -53 -62 -0.491928 0.262
NP_442428.1_5 Reverse -105 -112 6.13563 0.209
NP_442428.1_5 Forward -112 -105 6.0373 0.212
NP_442428.1_8 Reverse -199 -218 5.50599 0.224
NP_441032.1_1 Reverse -319 -338 17.3057 0.221
NP_440673.1_2 Reverse -94 -113 10.9749 0.19
NP_440673.1_3 Forward -111 -104 12.4288 0.0426
NP_440673.1_3 Reverse -275 -282 10.1672 0.149
NP_440673.1_3 Forward -175 -168 8.98723 0.203
NP_440865.1_9 Forward -324 -305 -5.50708 0.214
NP_441052.1_2 Reverse -104 -114 10.4031 0.0285
NP_441052.1_2 Forward -113 -103 0.57002 0.256
NP_441052.1_2 Reverse -273 -283 -0.609952 0.288
NP_442219.1_9 Reverse -105 -114 8.06287 0.0696
NP_442219.1_9 Reverse -274 -283 4.71961 0.198
NP_440436.1_4 Forward -176 -167 7.76745 0.124
NP_440436.1_4 Reverse -105 -114 7.66912 0.124
NP_440436.1_4 Forward -112 -103 6.29249 0.164
NP_441884.1_9 Forward -116 -97 -12.7836 0.138
NP_442902.1_3 Forward -229 -210 20.7473 0.102
NP_440314.1_9 Reverse -105 -124 -0.885524 0.117
NP_440314.1_9 Forward -69 -50 -2.36049 0.155
NP_440314.1_9 Forward -382 -363 -6.09707 0.226
NP_441719.1_4 Reverse -105 -112 6.82395 0.0855
NP_441719.1_4 Forward -112 -105 6.52896 0.188
NP_441004.1_1 Reverse -359 -378 -0.885524 0.124
NP_441004.1_1 Forward -324 -305 -7.27704 0.197
NP_441004.1_1 Forward -330 -311 -12.4886 0.247
NP_441004.1_1 Reverse -360 -379 -16.5201 0.286
NP_442366.1_3 Reverse -103 -121 9.45892 0.0558
NP_442366.1_3 Reverse -67 -85 -0.7675 0.199
NP_442366.1_5 Forward -285 -275 14.5325 0.0497
NP_442366.1_5 Forward -116 -106 12.0743 0.147
NP_442873.1_5 Reverse -317 -336 12.0933 0.219
NP_443054.1_2 Forward -79 -65 0.88457 0.252
NP_443054.1_2 Forward -115 -101 -0.295402 0.293
NP_441966.1_7 Reverse -317 -336 -0.886293 0.268
NP_442308.1_4 Forward -126 -107 5.60432 0.267
NP_440508.1_2 Reverse -156 -175 12.7098 0.289
NP_441851.1_10 Reverse -103 -113 7.84651 0.13
NP_441851.1_10 Forward -114 -104 5.97822 0.19
NP_442208.1_5 Forward -320 -301 -1.37718 0.248
NP_442208.1_5 Reverse -52 -71 -6.1954 0.266
NP_442011.1_1 Reverse -94 -113 0.786102 0.268
NP_442856.1_7 Reverse -59 -78 -0.885524 0.211
NP_442856.1_7 Reverse -95 -114 -2.16383 0.234
NP_441668.1_4 Forward -123 -104 9.93088 0.113
NP_442515.1_1 Forward -114 -100 4.42448 0.107
NP_442515.1_1 Reverse -103 -117 2.2612 0.14
NP_442515.1_1 Reverse -182 -196 -4.81863 0.298
NP_441396.1_5 Reverse -45 -54 7.47288 0.252
NP_441683.1_7 Reverse -365 -384 -9.93197 0.284
NP_440593.1_3 Forward -118 -99 -7.08038 0.285
NP_442689.1_8 Reverse -15 -32 -8.61428 0.294
NP_441349.1_10 Forward -123 -104 -2.65548 0.124
NP_440432.1_9 Forward -112 -97 0.0782283 0.16
NP_442843.1_1 Forward -329 -310 -10.522 0.278
NP_442843.1_1 Reverse -45 -64 -10.6203 0.279
NP_440474.1_8 Forward -76 -62 6.98048 0.213
NP_440588.1_2 Forward -116 -97 0.58944 0.146
NP_440195.1_5 Reverse -98 -117 1.47442 0.287
NP_442006.1_2 Reverse -95 -112 3.0871 0.0846
NP_442006.1_2 Forward -339 -322 -14.8091 0.21
NP_442006.1_2 Forward -106 -89 -16.5791 0.256
NP_442006.1_2 Forward -360 -343 -18.7424 0.295
NP_440483.1_5 Reverse -27 -46 4.52268 0.272
NP_442243.1_1 Reverse -98 -116 7.58986 0.178
NP_441570.1_1 Reverse -53 -71 -8.73231 0.12
NP_441570.1_1 Forward -113 -95 -10.4039 0.17
NP_441078.1_4 Reverse -104 -113 9.93116 0.0203
NP_441078.1_4 Forward -113 -104 9.83282 0.0226
NP_442729.1_5 Reverse -167 -177 9.12481 0.235
NP_441539.1_10 Reverse -44 -63 7.7676 0.0623
NP_442348.1_2 Forward -193 -184 8.1612 0.28
NP_442443.1_1 Forward -329 -310 12.2908 0.0834
NP_442443.1_1 Reverse -358 -377 3.04771 0.177
NP_442443.1_1 Forward -326 -307 -0.295539 0.222
NP_442443.1_1 Forward -332 -313 -5.31042 0.282
NP_441094.1_6 Forward -326 -309 6.82295 0.295
NP_440526.1_3 Forward -112 -101 1.72983 0.267
NP_441432.1_8 Forward -283 -274 11.0128 0.0629
NP_441432.1_8 Forward -114 -105 6.98123 0.112
NP_441432.1_8 Reverse -103 -112 5.60459 0.147
NP_441432.1_8 Reverse -167 -176 5.40793 0.158
NP_441432.1_8 Forward -78 -69 5.40793 0.158
NP_441432.1_8 Reverse -68 -77 2.65466 0.292
NP_442320.1_8 Forward -288 -274 -4.03198 0.142
NP_442320.1_8 Forward -119 -105 -6.09693 0.265
NP_441732.1_2 Reverse -100 -116 -16.0677 0.164
NP_441732.1_2 Forward -117 -101 -16.4611 0.167
NP_441732.1_2 Forward -147 -131 -17.0511 0.231
NP_440760.1_1 Reverse -273 -292 -12.2919 0.0927
NP_440760.1_1 Reverse -104 -123 -15.6352 0.152
NP_440760.1_1 Forward -113 -94 -23.305 0.293
NP_442797.1_1 Reverse -311 -330 -2.26216 0.247
NP_442797.1_1 Forward -184 -165 -5.40875 0.288
NP_442797.1_1 Reverse -314 -333 -5.9004 0.29
NP_442797.1_7 Reverse -97 -115 -0.7675 0.287
NP_441805.1_4 Forward -329 -310 11.9958 0.128
NP_441057.1_4 Forward -114 -96 0.21581 0.256
NP_442353.1_4 Reverse -219 -238 4.42355 0.205
NP_440913.1_1 Reverse -166 -184 8.47561 0.183
NP_440913.1_1 Forward -115 -97 5.62401 0.237
NP_441072.1_2 Reverse -208 -227 11.2092 0.188
NP_441072.1_2 Forward -124 -105 7.7676 0.252
NP_440713.1_4 Reverse -347 -366 5.80098 0.202
NP_442489.1_7 Forward -113 -104 10.5211 0.0102
NP_442489.1_7 Reverse -104 -113 10.4228 0.0151
NP_442079.1_6 Reverse -175 -194 12.5858 0.283
NP_440559.1_1 Reverse -105 -114 14.651 0.0144
NP_440559.1_1 Forward -112 -103 7.66954 0.0999
NP_441659.2_8 Forward -113 -103 16.2046 0.0035
NP_441659.2_8 Reverse -104 -114 8.63316 0.0405
NP_441659.2_8 Reverse -273 -283 2.92996 0.181
NP_442913.1_10 Reverse -95 -114 10.3242 0.0421
NP_442913.1_10 Reverse -59 -78 -1.96717 0.18
NP_441040.1_2 Forward -115 -96 -14.5535 0.286
NP_439956.1_7 Reverse -48 -67 11.2092 0.226
NP_441800.1_3 Forward -191 -173 5.82068 0.286
NP_441800.1_7 Reverse -307 -325 -2.24246 0.259
NP_440779.1_5 Forward -113 -96 -14.9075 0.287
NP_441185.1_7 Forward -332 -313 15.8307 0.279
NP_442346.1_5 Reverse -103 -113 8.82982 0.124
NP_442346.1_5 Forward -114 -104 6.8632 0.188
NP_442346.1_5 Reverse -37 -47 5.38824 0.248
NP_442346.1_10 Reverse -57 -76 -2.36049 0.294
NP_440545.1_3 Forward -117 -100 4.07041 0.0751
NP_441856.1_3 Forward -47 -28 12.0942 0.101
NP_441856.1_7 Reverse -365 -384 10.2259 0.28
NP_440831.1_3 Reverse -95 -114 16.5802 0.0953
NP_440831.1_3 Reverse -348 -367 12.9884 0.136
NP_441629.1_3 Reverse -317 -336 -2.65624 0.272
NP_440486.1_6 Forward -319 -300 11.0125 0.216
NP_440459.1_2 Reverse -216 -233 10.0686 0.21
NP_440010.1_3 Reverse -93 -112 -3.54046 0.25
NP_440010.1_3 Forward -342 -323 -4.03212 0.25
NP_440010.1_3 Reverse -92 -111 -6.1954 0.25
NP_440010.1_10 Reverse -92 -111 14.3558 0.18
NP_440010.1_10 Reverse -165 -184 6.58763 0.226
NP_440010.1_10 Forward -230 -211 1.67108 0.295
NP_442551.1_4 Forward -194 -179 -3.16669 0.287
NP_442311.1_5 Reverse -165 -184 4.03102 0.245
NP_442603.1_7 Forward -113 -99 16.7152 0.0291
NP_442603.1_7 Forward -282 -268 6.58715 0.236
NP_442828.1_5 Reverse -288 -307 10.9134 0.289
NP_441888.1_7 Reverse -139 -153 3.04785 0.225
NP_441833.1_4 Forward -112 -105 6.52896 0.0924
NP_441833.1_4 Reverse -105 -112 6.23397 0.163
NP_442162.1_9 Forward -112 -105 12.9205 0.0282
NP_442162.1_9 Reverse -105 -112 12.9205 0.0282
NP_442162.1_9 Reverse -2 -9 3.4807 0.246
NP_442162.1_9 Forward -9 -2 3.38237 0.276
NP_442055.1_6 Forward -327 -308 18.0924 0.221
NP_440671.1_4 Forward -16 -2 11.0127 0.142
NP_440671.1_4 Forward -258 -244 7.47274 0.217
NP_440671.1_4 Forward -68 -54 6.09611 0.261
NP_442404.1_3 Forward -330 -311 15.3391 0.275
NP_442821.1_2 Forward -70 -51 0.884433 0.262
NP_442045.1_5 Forward -237 -218 -0.688862 0.269
NP_442199.1_7 Forward -185 -166 4.91521 0.223
NP_442140.1_3 Forward -112 -102 12.7631 0.0632
NP_442140.1_3 Forward -359 -349 3.42162 0.297
NP_442723.1_1 Reverse -252 -271 2.85027 0.282
NP_442021.1_3 Forward -288 -269 -3.73712 0.251
NP_441671.1_10 Reverse -93 -112 0.491109 0.281
NP_441813.1_5 Forward -115 -105 5.48657 0.123
NP_441813.1_5 Reverse -271 -281 4.40493 0.159
NP_441813.1_5 Reverse -102 -112 -0.806614 0.285
NP_440594.1_3 Reverse -212 -230 14.2771 0.236
NP_440590.1_4 Forward -112 -99 3.36254 0.0746
NP_440590.1_4 Reverse -105 -118 0.314277 0.16
NP_440567.1_1 Forward -112 -98 8.16106 0.0609
NP_442497.1_10 Forward -112 -103 10.0295 0.0222
NP_442497.1_10 Reverse -105 -114 0.688044 0.141
NP_440821.1_4 Reverse -102 -112 9.81313 0.0246
NP_440821.1_4 Forward -115 -105 -0.41329 0.257
NP_440821.1_4 Forward -12 -2 -0.806614 0.296
NP_441239.1_9 Forward -115 -103 5.64384 0.213
NP_441239.1_9 Reverse -102 -114 4.75886 0.243
NP_441239.1_9 Reverse -66 -78 3.77555 0.276
NP_441892.1_1 Reverse -95 -112 5.9387 0.0995
NP_440665.1_1 Forward -59 -40 -11.9969 0.244
NP_442643.1_1 Forward -288 -269 -3.63879 0.223
NP_440354.1_7 Reverse -98 -116 7.98396 0.256
NP_440546.1_4 Reverse -104 -114 11.0156 0.0991
NP_440546.1_4 Forward -113 -103 10.2399 0.109
NP_440546.1_4 Reverse -357 -367 6.74945 0.282
NP_440546.1_4 Forward -282 -272 6.55553 0.291
NP_441230.1_5 Forward -371 -352 3.34271 0.202
NP_441230.1_5 Reverse -52 -71 -0.0988766 0.277
NP_440462.1_4 Reverse -52 -66 11.701 0.205
NP_440462.1_6 Reverse -271 -281 5.68323 0.145
NP_442611.1_1 Forward -113 -94 2.3594 0.221
NP_442144.1_1 Forward -285 -269 13.0382 0.221
NP_440868.1_4 Reverse -100 -112 0.727295 0.201
NP_441474.1_1 Reverse -311 -330 2.26028 0.247
NP_441474.1_1 Reverse -350 -369 -0.492971 0.255
NP_441474.1_1 Reverse -263 -282 -2.55791 0.28
NP_442402.1_1 Reverse -254 -273 7.66927 0.289
NP_442402.1_4 Reverse -254 -273 -8.94939 0.285
NP_442402.1_10 Reverse -262 -272 11.1893 0.269
NP_441848.1_4 Forward -266 -250 8.12362 0.288
NP_441084.1_6 Reverse -102 -116 12.7376 0.155
NP_440696.1_3 Reverse -59 -77 -3.81576 0.29
NP_442039.1_4 Reverse -105 -112 11.6422 0.0747
NP_442039.1_7 Reverse -221 -231 7.94484 0.269
NP_441811.1_1 Forward -114 -95 10.9142 0.26
NP_440753.1_5 Forward -203 -184 12.8808 0.132
NP_441926.1_3 Reverse -104 -120 4.0901 0.201
NP_440825.1_7 Reverse -274 -284 10.8602 0.286
NP_442696.1_6 Forward -171 -152 -13.6686 0.287
NP_442837.1_3 Forward -220 -213 7.11894 0.173
NP_442837.1_3 Forward -112 -105 6.0373 0.25
NP_442837.1_3 Reverse -105 -112 6.0373 0.25
NP_442053.1_1 Forward -113 -104 16.6177 0.00257
NP_442053.1_1 Reverse -104 -113 8.65285 0.0741
NP_440505.1_3 Reverse -102 -112 6.27322 0.187
NP_441203.1_2 Forward -330 -311 -3.24547 0.188
NP_442255.1_2 Forward -227 -208 9.0459 0.238
NP_440914.1_1 Reverse -104 -114 13.3971 0.0303
NP_440914.1_1 Forward -113 -103 6.56569 0.273
NP_442533.1_1 Reverse -50 -69 -9.14533 0.221
NP_442533.1_1 Forward -330 -311 -11.6036 0.236
NP_442533.1_1 Reverse -165 -184 -15.0452 0.248
NP_442533.1_6 Forward -113 -104 14.2577 0.0132
NP_442533.1_6 Reverse -104 -113 7.47288 0.0898
NP_442533.1_6 Reverse -183 -192 4.71961 0.177
NP_442533.1_6 Reverse -309 -318 2.94966 0.232
NP_442533.1_6 Forward -282 -273 2.85133 0.236
NP_442541.1_10 Forward -78 -64 5.40719 0.248
NP_442232.1_3 Reverse -211 -230 -7.08038 0.194
NP_442322.1_4 Forward -386 -369 -0.355176 0.218
NP_443016.1_1 Forward -119 -100 16.3224 0.0218
NP_441482.1_7 Forward -68 -54 -2.06536 0.0922
NP_439944.1_9 Forward -112 -102 7.64985 0.134
NP_441028.1_6 Forward -58 -48 8.3377 0.216
NP_441028.1_6 Reverse -263 -273 3.8145 0.281
NP_440115.1_6 Reverse -101 -111 18.2696 0.0139
NP_440115.1_6 Reverse -50 -60 6.46988 0.181
NP_439965.1_1 Reverse -65 -84 -8.94866 0.28
NP_440608.1_6 Forward -76 -57 3.73524 0.282
NP_441602.1_3 Forward -233 -214 2.85105 0.19
NP_441972.1_5 Forward -385 -366 -8.35868 0.263
NP_440429.1_2 Forward -82 -63 14.6508 0.176
NP_441286.1_1 Forward -114 -102 14.3953 0.00424
NP_441286.1_1 Reverse -167 -179 0.923956 0.102
NP_441286.1_1 Reverse -103 -115 -5.95921 0.235
NP_442674.1_3 Forward -229 -210 4.71854 0.288
NP_440670.1_8 Reverse -104 -113 18.0926 0.00136
NP_440670.1_8 Forward -113 -104 15.831 0.00494
NP_440886.1_7 Forward -114 -104 6.66608 0.115
NP_440886.1_7 Forward -54 -44 4.60114 0.227
NP_440886.1_7 Reverse -311 -321 4.50281 0.232
NP_440886.1_7 Reverse -350 -360 3.8145 0.265
NP_440828.1_4 Reverse -302 -321 -7.76943 0.291
NP_441001.1_10 Forward -340 -321 6.39097 0.249
NP_442614.1_2 Forward -354 -340 7.17775 0.275
NP_442401.1_2 Forward -114 -95 13.47 0.156
NP_441427.1_6 Forward -189 -171 7.09898 0.297
NP_441753.1_10 Reverse -95 -114 5.30933 0.186
NP_441808.1_8 Forward -339 -320 18.584 0.146
NP_441808.1_8 Reverse -165 -184 6.78429 0.284
NP_442022.1_4 Reverse -165 -184 14.1591 0.166
NP_442022.1_4 Forward -324 -305 8.84924 0.264
NP_442022.1_4 Forward -333 -314 5.60432 0.279
NP_440907.2_8 Forward -112 -102 17.6791 0.00685
NP_440907.2_8 Forward -61 -51 6.86274 0.144
NP_442264.1_2 Forward -87 -70 5.74204 0.272
NP_439967.1_1 Forward -373 -355 13.0972 0.225
NP_440841.1_4 Reverse -102 -121 -6.49039 0.215
NP_441463.1_3 Forward -376 -357 -1.96717 0.147
NP_441463.1_6 Forward -79 -65 6.12603 0.283
NP_442056.1_1 Forward -155 -137 18.112 0.184
NP_441626.1_2 Reverse -105 -112 12.2322 0.0511
NP_441626.1_2 Forward -9 -2 9.08556 0.1
NP_441626.1_2 Forward -112 -105 5.93897 0.231
NP_442211.1_3 Forward -330 -311 9.51453 0.257
NP_440107.1_5 Forward -114 -95 -0.39387 0.178
NP_442794.1_1 Forward -117 -105 7.4138 0.138
NP_442615.1_1 Forward -122 -104 4.54237 0.0452
NP_442467.1_4 Forward -98 -79 6.39097 0.282
NP_441962.1_4 Reverse -99 -118 -10.227 0.224
NP_440387.1_1 Reverse -104 -120 7.04003 0.0282
NP_440855.1_2 Reverse -349 -368 14.9449 0.263
NP_441431.1_2 Reverse -101 -115 15.3386 0.0501
NP_441521.1_2 Forward -388 -371 14.1977 0.296
NP_441836.1_2 Forward -159 -140 -4.22878 0.255
NP_441836.1_2 Forward -116 -97 -5.60541 0.284
NP_441993.1_1 Forward -288 -269 9.35345 0.136
NP_441993.1_1 Forward -324 -305 7.89159 0.159
NP_441174.1_2 Forward -324 -310 15.3392 0.119
NP_440467.1_8 Reverse -318 -337 9.83255 0.294
NP_442698.1_10 Reverse -221 -240 11.4058 0.233
NP_440492.1_4 Reverse -148 -167 21.0537 0.0687
NP_441677.1_8 Forward -263 -249 18.8791 0.226
NP_440293.1_3 Reverse -357 -376 7.37428 0.184
NP_440766.1_4 Reverse -100 -114 10.7177 0.0853
NP_439988.1_7 Forward -111 -97 13.077 0.292
NP_440422.1_10 Reverse -14 -33 5.07958 0.279
NP_441237.1_9 Reverse -105 -115 12.0747 0.139
NP_441311.1_4 Reverse -197 -214 7.31533 0.298
NP_439910.1_2 Forward -18 -1 -14.1208 0.183
NP_442867.1_8 Forward -112 -93 6.78429 0.253
NP_442867.1_8 Forward -367 -348 5.11266 0.277
NP_440457.1_1 Reverse -100 -112 19.3118 0.0353
NP_440457.1_1 Reverse -49 -61 -0.0593532 0.25
NP_440798.1_6 Forward -112 -99 11.819 0.0564
NP_440801.1_8 Reverse -103 -122 21.1406 0.032
NP_441984.1_3 Reverse -134 -152 7.78729 0.239
NP_441984.1_3 Forward -157 -139 5.32902 0.287
NP_442040.1_8 Forward -383 -369 21.6324 0.179
NP_442509.1_9 Forward -113 -103 14.6309 0.0263
NP_442509.1_9 Reverse -53 -63 8.53436 0.192
NP_442509.1_9 Forward -392 -382 6.56775 0.263
NP_442514.1_5 Forward -113 -94 -7.57277 0.276
NP_440734.1_9 Reverse -94 -113 13.2741 0.226
NP_440734.1_9 Forward -72 -53 12.8808 0.234
NP_440554.1_4 Reverse -2 -12 3.51995 0.227
NP_440554.1_4 Forward -112 -102 3.32329 0.234
NP_441885.1_5 Reverse -104 -114 18.6629 0.00274
NP_441885.1_5 Forward -113 -103 1.55333 0.109
NP_441885.1_5 Forward -282 -272 -1.59326 0.273
NP_440478.1_4 Forward -117 -98 14.2574 0.168
NP_442341.1_7 Forward -114 -100 18.6825 0.0111
NP_442341.1_7 Forward -187 -173 2.06454 0.271
NP_442341.1_7 Reverse -103 -117 1.96621 0.274
NP_442341.1_9 Forward -368 -354 8.25877 0.174
NP_441173.1_9 Reverse -264 -272 12.0154 0.214
NP_441173.1_9 Forward -57 -49 10.1471 0.261
NP_440191.1_8 Forward -379 -361 16.2429 0.254
NP_440423.1_6 Reverse -96 -115 -11.9969 0.184
NP_443000.1_7 Reverse -271 -281 6.96153 0.109
NP_443000.1_7 Forward -115 -105 0.471689 0.298
NP_441842.1_1 Forward -111 -98 14.965 0.0837
NP_441842.1_1 Reverse -136 -149 13.3917 0.151
NP_441842.1_10 Reverse -97 -111 19.6658 0.0142
NP_440275.1_3 Reverse -102 -112 16.9913 0.0133
NP_440275.1_3 Forward -12 -2 4.99491 0.167
NP_442275.1_1 Reverse -65 -84 -0.295539 0.295
NP_440679.1_10 Reverse -37 -56 -8.65367 0.18
NP_441122.1_1 Reverse -70 -85 4.20813 0.28
NP_439962.1_4 Reverse -308 -327 8.06259 0.14
NP_439962.1_4 Reverse -96 -115 -6.98204 0.286
NP_442234.1_1 Forward -323 -304 11.8975 0.248
NP_440149.1_10 Forward -397 -378 -6.78538 0.259
NP_440216.1_1 Forward -113 -99 6.29277 0.0156
NP_440216.1_1 Forward -282 -268 -12.1934 0.247
NP_440216.1_1 Reverse -104 -118 -12.4884 0.274
NP_440216.1_6 Reverse -97 -113 5.56507 0.189
NP_440216.1_9 Forward -175 -166 5.50626 0.292
NP_440172.1_1 Forward -113 -103 13.353 0.0211
NP_440172.1_1 Forward -282 -272 7.25653 0.0853
NP_440172.1_1 Reverse -104 -114 5.28991 0.146
NP_441350.1_9 Forward -367 -348 16.0265 0.282
NP_440167.1_3 Reverse -94 -113 15.6341 0.147
NP_440167.1_3 Reverse -167 -186 10.2259 0.244
NP_442015.1_3 Reverse -263 -282 15.1416 0.185
NP_442015.1_10 Reverse -100 -113 3.95252 0.178
NP_442015.1_10 Reverse -269 -282 1.39592 0.204
NP_442015.1_10 Forward -117 -104 -1.06236 0.293
NP_441226.1_7 Reverse -105 -112 12.7234 0.0312
NP_441226.1_7 Forward -112 -105 11.5435 0.0757
NP_441226.1_7 Forward -227 -220 9.47853 0.147
NP_441226.1_7 Reverse -2 -9 8.88855 0.165
NP_441757.1_3 Reverse -167 -186 0.982764 0.18
NP_441111.1_7 Reverse -105 -113 8.96754 0.0463
NP_441111.1_7 Forward -112 -104 8.86921 0.0589
NP_441177.1_7 Forward -187 -168 8.94676 0.3
NP_441766.1_2 Forward -113 -104 13.9627 0.0114
NP_441766.1_2 Reverse -104 -113 7.76787 0.0714
NP_441766.1_9 Reverse -96 -115 5.01433 0.201
NP_443052.1_8 Reverse -94 -113 2.16274 0.0575
NP_443052.1_9 Forward -376 -357 18.0924 0.0276
NP_443052.1_9 Reverse -311 -330 16.7157 0.0322
NP_443052.1_9 Reverse -314 -333 3.24438 0.164
NP_443052.1_9 Forward -226 -207 1.67108 0.183
NP_443052.1_9 Forward -108 -89 -3.73712 0.251
NP_443052.1_9 Reverse -308 -327 -4.22878 0.255
NP_440072.1_5 Forward -330 -312 0.0191479 0.236
NP_442116.1_2 Reverse -323 -342 14.0599 0.289
NP_441974.1_3 Forward -312 -295 14.1409 0.278
NP_442403.1_8 Reverse -359 -378 3.53937 0.226
NP_440591.1_9 Reverse -52 -70 4.14905 0.288
NP_442154.1_1 Forward -329 -311 -3.52077 0.125
NP_442154.1_1 Forward -332 -314 -3.71743 0.125
NP_442154.1_1 Forward -320 -302 -5.88071 0.127
NP_442154.1_1 Reverse -51 -69 -15.2222 0.218
NP_442154.1_1 Reverse -364 -382 -17.7788 0.267
NP_442564.1_4 Forward -67 -48 17.911 0.216
NP_442564.1_10 Forward -106 -92 11.7993 0.244
NP_440261.1_5 Forward -112 -99 6.70579 0.0318
NP_440988.1_10 Forward -79 -65 8.09365 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGGTCAATGGAATCCCGCTGACCCCCTCAATACCCCCAGCGGCATGGCGGACATTAACAAGTTCATGGCGGTGCTGGAAGGGGTGGCGGCCCAGGTGAAATTTCTCTACGATGATTTGGCGATCAGTTGGGGAGAAGTAGTGCAAATGCAGGTCGGGAATTTTACTGCTCCTGCCAACGGTGCTCCCAGTAACCTAGGCAGTTTTCGGGTCTTGGCCCTCAGCACCATTGCCAACCAAAGATTTCAAGCAGTGGCCGGAGATAGTTACCTGAGCTTAGTGGAATTTGCCGATCGCCCCCGGGGCCAGAGTATTTTGGTCTATGGCAATGCCAGCCAGCCCGATTCCCCCCATAACGGTGACCAGTTGGAACTTTACAGTAAAAATCAACTGCGACCGGT

CDS

GTGGCGATCGCCAAGGGAAATCAAGGCCCATCTGGAAAAGGAAGAAATTCTCTAAAACTGGGAAAAACAATCATGGCGGCATTATTTATTGTGCTAGAAGGCATTGACGGGTCAGGGAAAACCACCCAAGGGGATCTCCTGTTGGCCCATTTTCAGCGCCAAGGCCTGGCCGCAGTGCTTAGCCCGGAACCCACCAATGGCCCCGTGGGCCGCTTAATTCGCCAAGCTTTACAGGGAGATTTATTTACCTACAACGATGCCCGACAATTTGAAGCCCAGATGGGTTATTTATTCGCTGCCGATCGCCATTACCATCTCTACCATCCAGGGGATGGAGTGGAGGCAAAATTAGCCCAACAATGCCACGTAATCACCACCCGCTACTATTTTTCTTCTCTCGCCTATAATTGCCACACAGAGGCCGACTGGGAATTTGTTCAACGCTTAAATCAATCTTTTCCCCAGCCTGACTGGGTAATTTACCTAGACCTCCCGGTGGATTTGGCCCTACAACGCCTTGGCGATCGCCAGCAACTGGAGGACCAAGCCCCGAGGGAATGTTACGAACAACGGGAAAAGCTAATCAGTGTCCACCGCAATTACGACAGAATTTTTGCCCATTACCAGGGCCAACTTTGTCGCCTGGATGCCAGCCTGCCGGTGGAGCAACTACACCAAGCCATTATCACCAAAGTTGAGGAAATGCTGTGA

Protein

MAIAKGNQGPSGKGRNSLKLGKTIMAALFIVLEGIDGSGKTTQGDLLLAHFQRQGLAAVLSPEPTNGPVGRLIRQALQGDLFTYNDARQFEAQMGYLFAADRHYHLYHPGDGVEAKLAQQCHVITTRYYFSSLAYNCHTEADWEFVQRLNQSFPQPDWVIYLDLPVDLALQRLGDRQQLEDQAPRECYEQREKLISVHRNYDRIFAHYQGQLCRLDASLPVEQLHQAIITKVEEML