Your browser is old and dusty. Try Google Chrome!

Details for slr0358

ORF slr0358
Accession NP_442104.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -246 -260 1.47456 0.188
NP_441061.1_2 Reverse -224 -238 0.786239 0.199
NP_440795.1_7 Forward -193 -186 14.6904 0.0123
NP_440795.1_7 Reverse -186 -193 14.6904 0.0123
NP_441418.1_6 Reverse -185 -204 -12.2919 0.0631
NP_441418.1_6 Forward -194 -175 -28.4182 0.205
NP_442291.1_5 Forward -195 -179 -2.39974 0.215
NP_441453.1_1 Forward -201 -183 3.95163 0.263
NP_441453.1_4 Reverse -185 -193 16.539 0.00633
NP_441453.1_4 Forward -194 -186 16.539 0.00633
NP_441623.1_1 Forward -303 -285 13.8838 0.0787
NP_441960.1_3 Forward -241 -222 13.7008 0.258
NP_442151.1_6 Reverse -185 -199 17.6008 0.00997
NP_441818.1_1 Forward -193 -182 9.20294 0.25
NP_440226.1_1 Forward -194 -175 3.44104 0.225
NP_443002.1_5 Reverse -246 -264 11.4247 0.247
NP_442173.1_1 Forward -193 -185 15.4574 0.00633
NP_442173.1_1 Reverse -186 -194 15.4574 0.00633
NP_442752.1_4 Forward -194 -187 13.8055 0.0199
NP_442752.1_4 Reverse -185 -192 13.8055 0.0199
NP_443027.1_4 Reverse -183 -193 13.2547 0.0521
NP_443027.1_4 Forward -196 -186 6.46988 0.275
NP_442975.1_10 Forward -198 -184 4.03056 0.249
NP_442975.1_10 Reverse -181 -195 3.93223 0.249
NP_440784.1_7 Forward -193 -186 15.9687 0.0123
NP_440784.1_7 Reverse -186 -193 15.9687 0.0123
NP_440061.1_9 Reverse -183 -197 20.1568 0.00431
NP_442062.1_8 Reverse -185 -195 17.6796 0.00193
NP_442062.1_8 Forward -194 -184 10.3048 0.0493
NP_441859.1_3 Reverse -184 -203 3.44025 0.241
NP_441802.1_1 Forward -289 -270 3.93269 0.298
NP_440304.1_4 Forward -196 -186 17.9746 0.00654
NP_440304.1_4 Reverse -183 -193 10.8948 0.051
NP_440304.1_4 Reverse -228 -238 5.68323 0.196
NP_442242.1_4 Forward -193 -186 14.3954 0.0124
NP_442242.1_4 Reverse -186 -193 14.3954 0.0124
NP_440044.1_8 Forward -193 -174 5.40766 0.103
NP_439918.1_2 Reverse -342 -361 -1.7705 0.24
NP_439918.1_2 Forward -266 -247 -2.85214 0.249
NP_441208.1_9 Forward -197 -183 17.2075 0.0647
NP_440370.1_10 Forward -203 -184 19.0757 0.0487
NP_440518.1_3 Forward -121 -102 17.9932 0.0513
NP_442110.1_7 Reverse -185 -199 1.96621 0.222
NP_440856.1_4 Reverse -178 -197 -0.197208 0.174
NP_441083.1_3 Forward -261 -251 13.5492 0.213
NP_441083.1_5 Reverse -185 -195 19.3512 0.000718
NP_441083.1_5 Forward -194 -184 11.2881 0.0159
NP_441083.1_5 Forward -310 -300 4.50326 0.141
NP_442827.1_8 Forward -202 -183 2.26028 0.164
NP_441738.1_2 Forward -192 -185 15.28 0.0102
NP_441738.1_2 Reverse -187 -194 15.28 0.0102
NP_441558.1_5 Reverse -183 -202 20.944 0.00412
NP_441558.1_5 Forward -196 -177 8.55425 0.147
NP_440209.1_1 Reverse -185 -193 18.1123 0.00295
NP_440209.1_1 Forward -194 -186 18.1123 0.00295
NP_440447.1_6 Forward -202 -184 17.7187 0.0357
NP_441713.1_1 Forward -200 -181 4.42435 0.0568
NP_441770.1_4 Forward -273 -254 -8.85033 0.246
NP_440178.1_7 Reverse -355 -374 -15.9302 0.164
NP_440178.1_7 Forward -195 -176 -20.945 0.204
NP_442059.1_10 Forward -130 -111 12.0942 0.232
NP_442570.1_3 Forward -257 -238 -8.65367 0.291
NP_441792.1_5 Reverse -246 -262 10.0883 0.234
NP_441716.1_1 Reverse -185 -199 17.5025 0.0264
NP_441327.1_5 Forward -46 -37 16.6177 0.111
NP_442111.1_4 Reverse -184 -198 19.3708 0.00423
NP_442111.1_4 Forward -195 -181 1.76955 0.294
NP_441495.1_1 Forward -373 -354 20.7473 0.0443
NP_440906.1_5 Forward -193 -186 15.8704 0.0124
NP_440906.1_5 Reverse -186 -193 15.8704 0.0124
NP_440747.1_10 Forward -197 -185 7.80712 0.00223
NP_440747.1_10 Reverse -182 -194 7.4138 0.00422
NP_441130.1_10 Forward -196 -182 15.5359 0.0312
NP_441486.1_1 Reverse -182 -196 -2.85201 0.175
NP_442634.1_4 Reverse -183 -197 15.5359 0.0115
NP_442634.1_4 Forward -196 -182 4.62115 0.0764
NP_441265.1_3 Forward -200 -186 14.8476 0.059
NP_440403.1_4 Reverse -176 -195 -6.88371 0.236
NP_443017.1_1 Forward -80 -61 14.5434 0.274
NP_441014.1_8 Forward -355 -336 -4.03212 0.247
NP_441014.1_10 Reverse -64 -83 -0.689632 0.252
NP_442848.1_1 Forward -200 -186 -1.5737 0.263
NP_441012.1_4 Reverse -247 -260 12.5073 0.247
NP_443018.1_3 Forward -193 -186 14.8871 0.0123
NP_443018.1_3 Reverse -186 -193 14.8871 0.0123
NP_441634.1_8 Reverse -183 -197 -2.95034 0.295
NP_440376.1_1 Forward -194 -185 19.4693 0.000692
NP_440376.1_1 Reverse -185 -194 19.4693 0.000692
NP_440376.1_1 Reverse -301 -310 1.47469 0.251
NP_440376.1_1 Reverse -302 -311 -0.491928 0.29
NP_441588.1_4 Forward -192 -182 6.76487 0.185
NP_442687.1_7 Forward -195 -185 18.5646 0.0028
NP_442687.1_7 Reverse -184 -194 9.02648 0.0994
NP_441846.1_10 Reverse -342 -361 -12.9802 0.197
NP_441846.1_10 Reverse -17 -36 -21.7317 0.256
NP_441846.1_10 Reverse -341 -360 -22.6167 0.264
NP_442958.1_3 Reverse -174 -193 -1.47551 0.277
NP_440642.1_10 Reverse -40 -54 3.34225 0.275
NP_440642.1_10 Reverse -306 -320 2.45727 0.277
NP_441013.1_2 Forward -357 -339 -4.60241 0.299
NP_441422.1_7 Reverse -183 -200 0.137172 0.148
NP_442658.1_1 Forward -196 -186 17.6791 0.00565
NP_442658.1_1 Reverse -183 -193 14.2375 0.0237
NP_442496.1_5 Forward -171 -153 7.39397 0.256
NP_440656.1_8 Reverse -174 -193 8.16093 0.0791
NP_442544.1_2 Reverse -315 -329 -0.197071 0.217
NP_442937.1_5 Reverse -144 -163 10.9142 0.151
NP_441317.1_4 Reverse -35 -49 9.94142 0.29
NP_441958.1_2 Forward -203 -184 14.3558 0.203
NP_441958.1_5 Reverse -184 -194 21.2195 0.000805
NP_441958.1_5 Forward -195 -185 20.5312 0.000966
NP_442486.1_4 Reverse -187 -206 6.68596 0.282
NP_442836.1_5 Forward -200 -181 14.2574 0.0588
NP_440203.1_5 Reverse -188 -198 13.6475 0.112
NP_442025.1_7 Forward -260 -242 14.7083 0.276
NP_440984.1_7 Reverse -180 -194 5.99778 0.231
NP_439990.1_5 Forward -199 -186 13.1956 0.102
NP_442376.1_2 Forward -199 -180 -4.81876 0.257
NP_442690.1_1 Forward -296 -277 -8.55534 0.189
NP_442911.1_2 Forward -204 -185 12.7825 0.0122
NP_440153.1_5 Forward -193 -179 1.67122 0.245
NP_440153.1_8 Reverse -251 -264 6.4108 0.17
NP_442536.1_4 Forward -88 -70 6.90232 0.299
NP_440993.1_2 Reverse -180 -196 11.0716 0.085
NP_441099.1_5 Forward -204 -185 10.3242 0.0295
NP_441099.1_5 Reverse -175 -194 -5.21209 0.15
NP_442002.1_1 Reverse -340 -358 -0.275845 0.192
NP_442002.1_9 Forward -195 -188 14.1004 0.074
NP_442002.1_9 Forward -394 -387 10.5605 0.214
NP_441294.1_7 Reverse -181 -195 13.2821 0.0711
NP_441646.1_1 Forward -201 -182 4.22769 0.198
NP_442438.1_10 Forward -199 -185 2.75286 0.168
NP_441292.1_2 Forward -63 -44 -11.9969 0.296
NP_441000.1_6 Forward -195 -181 14.2576 0.0396
NP_440605.1_9 Reverse -255 -271 18.6801 0.234
NP_440147.1_4 Reverse -183 -196 19.9805 0.00251
NP_440147.1_4 Forward -196 -183 11.0324 0.0341
NP_441175.1_7 Reverse -185 -204 7.27595 0.237
NP_441550.1_8 Forward -196 -186 19.8424 0.00352
NP_441550.1_8 Reverse -183 -193 15.8108 0.0132
NP_441916.1_7 Forward -194 -184 18.9579 0.00144
NP_441916.1_7 Reverse -185 -195 16.893 0.00407
NP_441916.1_10 Forward -319 -300 2.55606 0.244
NP_441916.1_10 Forward -166 -147 1.76941 0.262
NP_441041.1_4 Forward -266 -247 6.19431 0.0445
NP_441041.1_4 Reverse -351 -370 -5.40875 0.152
NP_441041.1_4 Reverse -185 -204 -9.44032 0.216
NP_441041.1_4 Forward -260 -241 -13.5702 0.291
NP_441041.1_7 Forward -197 -185 18.593 0.00508
NP_441041.1_7 Reverse -182 -194 16.6495 0.0131
NP_441547.1_2 Forward -265 -247 9.16393 0.208
NP_442004.1_6 Reverse -185 -199 6.3911 0.174
NP_441725.1_4 Reverse -180 -194 3.8339 0.278
NP_441725.1_5 Reverse -186 -196 18.7612 0.0119
NP_441725.1_5 Forward -193 -183 1.94665 0.115
NP_439966.1_7 Reverse -183 -193 14.3359 0.0203
NP_439966.1_7 Forward -196 -186 8.14104 0.14
NP_439966.1_9 Forward -196 -187 0.983037 0.253
NP_442941.1_3 Forward -193 -183 19.2529 0.00262
NP_442941.1_3 Reverse -186 -196 2.43831 0.14
NP_440289.1_2 Reverse -182 -195 15.5556 0.0107
NP_440289.1_2 Forward -197 -184 4.64084 0.0657
NP_440983.1_5 Forward -131 -112 -8.26035 0.294
NP_440260.1_7 Reverse -28 -47 4.32602 0.222
NP_442281.1_1 Reverse -180 -194 17.5018 0.00555
NP_442281.1_1 Forward -199 -185 10.3237 0.0595
NP_442012.1_1 Reverse -179 -198 0.786102 0.231
NP_439983.1_7 Reverse -22 -40 11.2289 0.271
NP_441457.1_7 Forward -196 -177 8.16093 0.157
NP_441556.1_10 Reverse -218 -232 10.6112 0.266
NP_441556.1_10 Reverse -351 -365 10.0271 0.28
NP_441556.1_10 Forward -199 -185 9.54046 0.298
NP_441644.1_3 Reverse -298 -317 18.6823 0.218
NP_441644.1_6 Forward -194 -184 19.0557 0.000803
NP_441644.1_6 Reverse -185 -195 15.7125 0.0048
NP_441644.1_6 Forward -260 -250 3.51951 0.277
NP_440867.1_10 Forward -360 -341 4.22769 0.283
NP_441795.1_4 Reverse -365 -378 16.6363 0.276
NP_442029.1_6 Forward -265 -246 16.6174 0.0975
NP_440253.1_2 Forward -194 -176 14.7688 0.0186
NP_440253.1_2 Reverse -185 -203 1.69077 0.155
NP_440929.1_8 Forward -194 -185 19.2726 0.000701
NP_440929.1_8 Reverse -185 -194 19.2726 0.000701
NP_442933.1_10 Forward -194 -185 17.601 0.00325
NP_442933.1_10 Reverse -185 -194 17.601 0.00325
NP_441310.1_10 Forward -322 -312 16.3745 0.0807
NP_441751.2_8 Forward -193 -179 4.22782 0.0521
NP_441751.2_8 Reverse -186 -200 4.12949 0.0534
NP_442554.1_8 Forward -193 -183 17.2863 0.00543
NP_442554.1_8 Reverse -186 -196 16.9913 0.0065
NP_442554.1_8 Reverse -252 -262 3.61828 0.218
NP_442970.1_1 Reverse -366 -380 14.5264 0.269
NP_441762.1_7 Reverse -184 -196 2.69391 0.0676
NP_441762.1_7 Forward -195 -183 1.7106 0.0735
NP_442142.1_4 Forward -197 -184 13.785 0.0334
NP_442142.1_4 Reverse -182 -195 4.93527 0.206
NP_442292.1_1 Forward -193 -184 17.5026 0.00435
NP_442292.1_1 Reverse -186 -195 9.53783 0.0183
NP_442476.1_6 Reverse -186 -200 0.392915 0.262
NP_443009.1_5 Reverse -184 -195 17.0694 0.00659
NP_443009.1_5 Forward -195 -184 16.7744 0.00677
NP_441715.1_4 Forward -193 -183 16.7946 0.0106
NP_441448.1_7 Forward -324 -305 5.60432 0.293
NP_441198.1_4 Reverse -20 -39 11.2092 0.241
NP_441198.1_8 Forward -196 -186 15.2245 0.0427
NP_441468.1_1 Forward -193 -186 15.8704 0.0124
NP_441468.1_1 Reverse -186 -193 15.8704 0.0124
NP_441020.2_6 Forward -196 -179 6.62702 0.26
NP_441020.2_7 Forward -316 -297 9.83173 0.26
NP_441673.1_1 Forward -194 -185 20.8459 0.000698
NP_441673.1_1 Reverse -185 -194 20.8459 0.000698
NP_441826.1_2 Forward -200 -186 12.7826 0.0253
NP_441330.1_1 Reverse -180 -199 -12.7836 0.183
NP_441637.1_8 Forward -132 -115 10.9536 0.237
NP_442490.1_9 Forward -206 -187 4.32602 0.165
NP_441764.1_4 Forward -398 -381 9.59972 0.282
NP_441764.1_8 Reverse -9 -19 16.2873 0.284
NP_442868.1_6 Forward -196 -186 16.7946 0.0131
NP_442868.1_6 Reverse -183 -193 10.4031 0.038
NP_442227.1_2 Forward -360 -341 -3.3438 0.29
NP_440789.1_8 Forward -319 -300 13.3725 0.28
NP_442808.1_1 Reverse -184 -194 8.73102 0.0481
NP_442808.1_1 Forward -195 -185 8.73102 0.0481
NP_440145.1_3 Forward -204 -185 9.93088 0.0431
NP_440145.1_3 Reverse -175 -194 -1.27885 0.15
NP_442542.1_2 Forward -196 -183 11.9173 0.114
NP_442050.1_1 Reverse -343 -362 6.88262 0.281
NP_442050.1_5 Reverse -183 -193 15.9091 0.0091
NP_442050.1_5 Forward -196 -186 14.9258 0.0175
NP_442342.1_9 Reverse -183 -199 6.74504 0.217
NP_440342.1_1 Reverse -347 -366 20.8456 0.164
NP_441518.1_3 Reverse -175 -194 -12.6852 0.263
NP_441878.1_6 Forward -195 -185 20.2362 0.0046
NP_441878.1_6 Reverse -184 -194 10.5014 0.0176
NP_441878.1_6 Reverse -355 -365 -7.49312 0.231
NP_441878.1_6 Forward -173 -163 -7.98478 0.285
NP_441036.1_8 Reverse -184 -194 15.713 0.00724
NP_441036.1_8 Forward -195 -185 8.4365 0.174
NP_441557.1_4 Forward -89 -75 11.0127 0.291
NP_441557.1_5 Forward -194 -185 19.9609 0.000699
NP_441557.1_5 Reverse -185 -194 19.9609 0.000699
NP_441590.1_4 Reverse -246 -265 1.96529 0.299
NP_442066.2_4 Reverse -185 -204 -8.35868 0.294
NP_442066.2_9 Reverse -181 -194 10.2457 0.154
NP_440101.1_10 Forward -266 -247 12.5858 0.135
NP_442183.1_1 Forward -194 -180 9.73436 0.094
NP_442183.1_1 Reverse -185 -199 8.25939 0.119
NP_441870.1_7 Forward -383 -364 11.7008 0.291
NP_440058.1_7 Forward -265 -246 7.17762 0.247
NP_442170.1_5 Forward -194 -175 1.0811 0.207
NP_442170.1_7 Forward -129 -110 16.1257 0.0877
NP_442347.1_2 Forward -193 -184 3.34298 0.284
NP_442347.1_2 Reverse -186 -195 3.34298 0.284
NP_442645.1_2 Forward -268 -249 -15.3402 0.197
NP_442888.1_8 Reverse -111 -130 8.94757 0.275
NP_441037.1_4 Forward -196 -186 18.9151 0.00351
NP_441037.1_4 Reverse -183 -193 7.22024 0.237
NP_442317.1_6 Forward -199 -180 10.8159 0.208
NP_441633.1_3 Reverse -183 -196 15.4572 0.0103
NP_440136.1_2 Forward -193 -186 15.9687 0.0123
NP_440136.1_2 Reverse -186 -193 15.9687 0.0123
NP_442998.1_10 Forward -192 -185 15.5754 0.0102
NP_442998.1_10 Reverse -187 -194 15.5754 0.0102
NP_440299.1_1 Forward -198 -185 18.6032 0.00369
NP_441799.1_1 Forward -198 -184 7.57046 0.138
NP_441799.1_1 Reverse -181 -195 5.89884 0.19
NP_440640.1_6 Reverse -338 -357 -0.983855 0.297
NP_441007.1_10 Reverse -180 -193 2.37923 0.19
NP_441007.1_10 Forward -199 -186 2.18257 0.195
NP_440256.1_1 Forward -197 -178 6.88262 0.0282
NP_441559.1_8 Forward -199 -185 2.85119 0.143
NP_441559.1_8 Forward -129 -115 -0.197071 0.174
NP_441559.1_8 Reverse -180 -194 -7.17857 0.287
NP_440915.1_6 Forward -198 -184 24.2873 0.000746
NP_440915.1_6 Reverse -181 -195 9.5377 0.0406
NP_440164.1_1 Reverse -256 -275 2.0644 0.298
NP_441113.1_3 Forward -320 -306 17.9935 0.178
NP_441939.1_3 Reverse -186 -205 12.6841 0.0997
NP_441199.1_6 Reverse -181 -200 -1.67217 0.296
NP_441494.1_6 Forward -199 -186 10.8357 0.225
NP_442993.1_1 Forward -194 -178 -9.5779 0.188
NP_442993.1_1 Reverse -302 -318 -12.6262 0.276
NP_442386.1_9 Forward -195 -186 6.39082 0.219
NP_442386.1_9 Reverse -184 -193 6.39082 0.219
NP_442386.1_10 Reverse -294 -307 3.36254 0.279
NP_441340.1_5 Forward -193 -186 15.6737 0.0124
NP_441340.1_5 Reverse -186 -193 15.6737 0.0124
NP_442240.1_1 Reverse -292 -311 13.6666 0.167
NP_442240.1_1 Reverse -147 -166 9.7334 0.216
NP_442240.1_2 Reverse -186 -205 6.58763 0.0292
NP_440161.1_3 Forward -196 -177 12.4875 0.177
NP_440586.1_8 Forward -193 -186 13.2151 0.026
NP_440586.1_8 Reverse -186 -193 13.2151 0.026
NP_442251.1_6 Forward -193 -186 15.2804 0.0124
NP_442251.1_6 Reverse -186 -193 15.2804 0.0124
NP_441262.1_3 Reverse -185 -192 14.7888 0.0223
NP_441262.1_3 Forward -194 -187 14.7888 0.0223
NP_440027.1_3 Forward -372 -354 2.47668 0.289
NP_440027.1_3 Forward -165 -147 2.18168 0.292
NP_443051.1_1 Reverse -184 -193 19.5676 0.00335
NP_443051.1_1 Forward -195 -186 18.0926 0.00402
NP_439937.1_9 Reverse -184 -201 -6.74666 0.157
NP_439937.1_9 Forward -35 -18 -13.2365 0.283
NP_440439.1_1 Reverse -182 -195 12.9006 0.023
NP_440439.1_1 Forward -197 -184 8.37742 0.0537
NP_440372.1_2 Forward -193 -186 16.3621 0.0124
NP_440372.1_2 Reverse -186 -193 16.3621 0.0124
NP_440819.1_5 Forward -46 -38 7.68924 0.266
NP_440316.1_10 Forward -173 -163 7.55152 0.246
NP_439977.1_5 Reverse -179 -198 4.12936 0.155
NP_440139.1_1 Reverse -179 -198 9.34008 0.0996
NP_440267.1_2 Reverse -180 -194 21.6317 0.00946
NP_442384.1_10 Reverse -185 -198 11.9173 0.0319
NP_442384.1_10 Forward -194 -181 2.57589 0.22
NP_442339.1_8 Reverse -372 -389 17.6401 0.27
NP_441877.1_5 Reverse -102 -121 -2.16383 0.296
NP_441018.1_7 Forward -270 -251 6.88262 0.281
NP_442262.1_10 Forward -193 -186 14.1988 0.0123
NP_442262.1_10 Reverse -186 -193 14.1988 0.0123
NP_441689.1_5 Reverse -183 -193 8.3377 0.132
NP_440344.1_10 Reverse -178 -195 -8.81095 0.134
NP_440344.1_10 Forward -201 -184 -9.3026 0.143
NP_440075.1_2 Reverse -344 -363 6.29264 0.257
NP_440562.1_3 Reverse -186 -203 15.9685 0.052
NP_440562.1_10 Reverse -176 -194 7.88563 0.284
NP_440297.1_9 Reverse -186 -196 9.51814 0.0917
NP_440297.1_9 Forward -193 -183 -0.216628 0.282
NP_441896.1_3 Forward -203 -184 8.94757 0.0872
NP_441103.1_9 Reverse -312 -322 13.8568 0.234
NP_440894.1_10 Reverse -305 -324 5.11266 0.238
NP_440999.1_9 Forward -198 -184 10.4227 0.0529
NP_440999.1_9 Reverse -181 -195 -0.590395 0.212
NP_440888.1_2 Forward -194 -180 12.8803 0.0369
NP_440888.1_2 Reverse -185 -199 9.14375 0.137
NP_442892.1_9 Reverse -148 -162 11.897 0.296
NP_439969.1_3 Forward -199 -180 10.2259 0.116
NP_442948.1_2 Forward -195 -176 4.03102 0.274
NP_442277.1_4 Reverse -176 -195 5.50519 0.175
NP_442033.1_10 Reverse -183 -202 1.37609 0.0882
NP_441543.1_2 Forward -193 -184 15.9293 0.00518
NP_441543.1_2 Reverse -186 -195 9.34117 0.0818
NP_442845.1_2 Forward -140 -126 4.22782 0.264
NP_441551.1_5 Forward -198 -182 6.94101 0.252
NP_441469.1_8 Forward -195 -186 13.3727 0.073
NP_441469.1_8 Reverse -184 -193 6.5879 0.227
NP_443064.1_6 Reverse -185 -195 13.8273 0.0796
NP_443064.1_6 Forward -194 -184 10.8217 0.13
NP_442578.1_7 Forward -193 -186 14.5921 0.026
NP_442578.1_7 Reverse -186 -193 14.5921 0.026
NP_440710.1_1 Reverse -177 -195 -8.14232 0.257
NP_440071.1_5 Forward -355 -336 13.8641 0.179
NP_441462.1_2 Forward -194 -184 20.2362 0.000805
NP_441462.1_2 Reverse -185 -195 20.1379 0.000967
NP_441621.1_7 Forward -196 -182 2.65453 0.123
NP_441621.1_7 Reverse -183 -197 -2.95034 0.188
NP_440668.1_9 Forward -268 -249 12.6841 0.182
NP_443062.1_6 Forward -202 -183 3.73603 0.229
NP_443062.1_6 Reverse -177 -196 2.65439 0.252
NP_442204.1_1 Forward -198 -187 2.51695 0.266
NP_442204.1_1 Reverse -181 -192 2.02529 0.266
NP_441560.1_8 Forward -199 -180 15.0187 0.123
NP_440516.1_8 Forward -194 -185 16.9127 0.00442
NP_440516.1_8 Reverse -185 -194 16.9127 0.00442
NP_440516.1_8 Forward -172 -163 -0.491928 0.262
NP_442428.1_4 Reverse -184 -203 3.34271 0.242
NP_442428.1_5 Forward -193 -186 15.8704 0.0124
NP_442428.1_5 Reverse -186 -193 15.8704 0.0124
NP_442859.1_2 Reverse -186 -205 5.30933 0.21
NP_442120.1_10 Forward -164 -145 -4.72043 0.199
NP_440673.1_3 Forward -192 -185 12.4288 0.0426
NP_440673.1_3 Reverse -187 -194 12.4288 0.0426
NP_440673.1_3 Reverse -267 -274 8.20058 0.234
NP_440673.1_3 Reverse -151 -158 7.80726 0.244
NP_440673.1_7 Reverse -219 -238 2.0644 0.234
NP_440865.1_9 Reverse -179 -198 10.3242 0.0497
NP_441052.1_2 Forward -194 -184 10.4031 0.0285
NP_441052.1_2 Reverse -185 -195 10.4031 0.0285
NP_442219.1_9 Forward -193 -184 8.25953 0.0681
NP_442219.1_9 Reverse -186 -195 8.25953 0.0681
NP_440436.1_4 Reverse -186 -195 15.9289 0.00508
NP_440436.1_4 Forward -193 -184 9.24241 0.0871
NP_441884.1_9 Forward -197 -178 -24.6816 0.288
NP_442086.1_3 Reverse -186 -205 5.99764 0.288
NP_440314.1_9 Reverse -186 -205 -9.63698 0.273
NP_442907.1_9 Reverse -246 -265 0.982764 0.2
NP_441719.1_4 Forward -193 -186 16.3621 0.0124
NP_441719.1_4 Reverse -186 -193 16.3621 0.0124
NP_441733.1_10 Forward -197 -184 7.49244 0.153
NP_441733.1_10 Reverse -182 -195 6.50913 0.184
NP_441004.1_1 Forward -170 -151 -17.1101 0.289
NP_441004.1_2 Forward -175 -156 2.65439 0.215
NP_441004.1_3 Forward -241 -222 3.44104 0.261
NP_442366.1_3 Forward -240 -222 -0.0791831 0.183
NP_439949.1_7 Reverse -30 -44 11.0127 0.291
NP_440296.1_10 Forward -197 -178 -4.22878 0.209
NP_441115.1_4 Reverse -184 -202 15.7513 0.0354
NP_443054.1_2 Reverse -183 -197 8.06273 0.13
NP_443054.1_2 Forward -313 -299 1.96621 0.245
NP_441851.1_10 Forward -195 -185 17.4829 0.0027
NP_441851.1_10 Reverse -184 -194 8.53483 0.114
NP_442208.1_8 Reverse -107 -125 19.7837 0.132
NP_441555.1_3 Reverse -5 -24 17.3748 0.204
NP_442622.1_8 Forward -194 -176 -19.1554 0.296
NP_441668.1_3 Reverse -105 -124 4.71934 0.257
NP_442515.1_1 Forward -195 -181 2.85119 0.129
NP_442515.1_1 Reverse -184 -198 -1.37704 0.253
NP_441982.1_6 Forward -47 -38 12.1989 0.288
NP_442709.1_3 Forward -201 -182 11.7008 0.109
NP_441046.1_2 Forward -97 -78 3.73603 0.231
NP_442689.1_8 Forward -380 -363 -4.18939 0.263
NP_441349.1_10 Reverse -175 -194 7.66927 0.0298
NP_441409.1_6 Forward -200 -181 10.7175 0.024
NP_440432.1_9 Forward -193 -178 22.4977 0.00712
NP_440432.1_9 Reverse -186 -201 -1.98672 0.167
NP_440432.1_9 Reverse -309 -324 -3.16669 0.179
NP_440474.1_8 Forward -193 -179 4.71887 0.268
NP_441477.1_10 Forward -201 -183 0.707465 0.276
NP_441124.1_5 Reverse -271 -281 10.7163 0.286
NP_440431.1_3 Reverse -184 -203 -12.3902 0.299
NP_442450.1_5 Forward -196 -186 10.1081 0.115
NP_440588.1_2 Forward -250 -231 -4.42544 0.216
NP_440040.1_8 Reverse -370 -389 5.0129 0.239
NP_440954.1_1 Forward -260 -241 -7.4737 0.289
NP_443047.1_4 Reverse -370 -380 17.5813 0.28
NP_441570.1_1 Forward -194 -176 -8.33898 0.109
NP_441078.1_4 Forward -194 -185 19.6659 0.0007
NP_441078.1_4 Reverse -185 -194 19.6659 0.0007
NP_441078.1_4 Forward -365 -356 3.7363 0.131
NP_442729.1_8 Forward -198 -185 8.9674 0.125
NP_441663.1_8 Reverse -179 -198 -0.39387 0.228
NP_442348.1_2 Reverse -33 -42 14.7494 0.146
NP_440793.1_1 Reverse -39 -53 14.8469 0.26
NP_440793.1_1 Reverse -305 -319 11.897 0.279
NP_440526.1_3 Reverse -186 -197 18.446 0.0306
NP_440526.1_3 Forward -193 -182 1.92649 0.267
NP_441432.1_8 Reverse -184 -193 16.8143 0.00595
NP_441432.1_8 Forward -195 -186 8.35786 0.0755
NP_442320.1_8 Reverse -179 -193 5.30946 0.0394
NP_442344.1_7 Reverse -156 -175 -8.752 0.226
NP_441732.1_2 Reverse -181 -197 -15.2811 0.145
NP_441732.1_2 Forward -198 -182 -15.9694 0.164
NP_440760.1_1 Reverse -185 -204 -2.85214 0.0334
NP_440760.1_9 Reverse -304 -323 8.65258 0.277
NP_442797.1_7 Reverse -349 -367 -1.45582 0.299
NP_440913.1_1 Reverse -183 -201 9.26226 0.179
NP_442489.1_7 Forward -194 -185 20.1576 0.000695
NP_442489.1_7 Reverse -185 -194 20.1576 0.000695
NP_442079.1_7 Reverse -186 -205 12.1925 0.0873
NP_440559.1_1 Reverse -186 -195 17.306 0.00658
NP_440559.1_1 Forward -193 -184 8.65285 0.0586
NP_441659.2_8 Forward -194 -184 20.9245 0.000805
NP_441659.2_8 Reverse -185 -195 19.3512 0.000966
NP_441659.2_8 Reverse -251 -261 1.16001 0.248
NP_440708.1_6 Forward -350 -331 3.83436 0.168
NP_440779.1_5 Reverse -308 -325 -6.15601 0.164
NP_442346.1_5 Forward -195 -185 17.9746 0.00128
NP_442346.1_5 Reverse -184 -194 16.303 0.00248
NP_442346.1_5 Reverse -250 -260 8.33817 0.14
NP_442346.1_5 Forward -261 -251 4.79825 0.272
NP_440545.1_3 Reverse -181 -198 8.39697 0.0444
NP_440545.1_3 Forward -198 -181 7.90532 0.048
NP_441856.1_3 Reverse -182 -201 -0.885524 0.228
NP_441710.1_9 Forward -201 -182 11.995 0.222
NP_440486.1_6 Forward -179 -160 7.7676 0.26
NP_440459.1_2 Reverse -215 -232 8.88863 0.246
NP_441653.1_2 Forward -205 -186 6.81516 0.225
NP_442603.1_7 Reverse -185 -199 17.6002 0.0211
NP_441888.1_7 Reverse -180 -194 2.35953 0.225
NP_441833.1_4 Forward -193 -186 15.9687 0.0124
NP_441833.1_4 Reverse -186 -193 15.9687 0.0124
NP_442162.1_9 Forward -193 -186 16.2637 0.0124
NP_442162.1_9 Reverse -186 -193 16.2637 0.0124
NP_440671.1_4 Forward -200 -186 8.25939 0.202
NP_443026.1_5 Reverse -26 -45 0.196116 0.283
NP_440224.1_1 Reverse -174 -193 0.982764 0.132
NP_440772.1_8 Forward -316 -297 10.7175 0.253
NP_442199.1_5 Reverse -177 -196 -0.4922 0.177
NP_442140.1_3 Reverse -186 -196 14.828 0.0433
NP_442140.1_3 Forward -193 -183 4.69992 0.238
NP_442021.1_3 Forward -266 -247 -5.99873 0.257
NP_441671.1_10 Forward -130 -111 1.17943 0.273
NP_440875.1_9 Forward -192 -182 15.867 0.0233
NP_440875.1_9 Reverse -187 -197 9.24806 0.233
NP_441813.1_5 Reverse -183 -193 18.1713 0.00743
NP_441813.1_5 Forward -196 -186 8.92815 0.0347
NP_440590.1_4 Reverse -186 -199 6.4108 0.0575
NP_440590.1_4 Forward -193 -180 -4.20895 0.258
NP_440567.1_1 Reverse -186 -200 0.982901 0.224
NP_440567.1_1 Forward -193 -179 -0.0987402 0.264
NP_442497.1_10 Reverse -186 -195 19.8626 0.00532
NP_442497.1_10 Forward -193 -184 17.601 0.00813
NP_440821.1_4 Forward -196 -186 19.5479 0.00399
NP_440821.1_4 Reverse -183 -193 2.24165 0.131
NP_441239.1_9 Reverse -183 -195 16.5586 0.0166
NP_441239.1_9 Forward -196 -184 14.4936 0.0272
NP_441892.1_1 Forward -203 -186 -4.68105 0.266
NP_442044.1_9 Reverse -185 -204 1.47442 0.289
NP_442643.1_1 Forward -266 -247 -10.817 0.231
NP_442216.1_4 Reverse -158 -166 8.08217 0.255
NP_442138.1_10 Forward -194 -175 3.93269 0.114
NP_440412.1_2 Forward -300 -281 6.29264 0.281
NP_440546.1_4 Forward -194 -184 13.5365 0.0459
NP_440546.1_4 Reverse -185 -195 12.8578 0.0572
NP_441230.1_5 Reverse -180 -199 1.57275 0.239
NP_440462.1_6 Reverse -183 -193 18.7612 0.00454
NP_440462.1_6 Forward -196 -186 10.4031 0.0396
NP_442465.1_9 Reverse -252 -266 9.5377 0.298
NP_442340.1_3 Forward -126 -107 0.294447 0.159
NP_440868.1_4 Reverse -181 -193 7.80712 0.0637
NP_440868.1_4 Forward -198 -186 0.727295 0.201
NP_440401.1_9 Forward -306 -299 14.5917 0.287
NP_442499.1_3 Forward -366 -348 3.26407 0.298
NP_442402.1_4 Reverse -110 -129 -9.14605 0.285
NP_441848.1_9 Forward -33 -22 13.2345 0.263
NP_441084.1_6 Reverse -249 -263 12.3498 0.164
NP_442023.1_1 Reverse -242 -261 16.7149 0.189
NP_442039.1_4 Forward -193 -186 15.1821 0.0124
NP_442039.1_4 Reverse -186 -193 15.1821 0.0124
NP_442039.1_7 Forward -230 -220 7.64985 0.273
NP_441811.1_8 Forward -200 -186 8.06273 0.238
NP_441926.1_3 Forward -194 -178 7.63002 0.17
NP_442837.1_3 Forward -193 -186 15.7721 0.0124
NP_442837.1_3 Reverse -186 -193 15.7721 0.0124
NP_440160.1_2 Reverse -245 -264 -8.35868 0.286
NP_439994.1_3 Reverse -184 -203 7.95079 0.296
NP_442053.1_1 Forward -194 -185 18.3876 0.0007
NP_442053.1_1 Reverse -185 -194 18.3876 0.0007
NP_440505.1_3 Reverse -183 -193 17.188 0.00332
NP_440505.1_3 Forward -196 -186 7.84651 0.147
NP_440505.1_5 Forward -132 -118 15.5359 0.268
NP_441959.1_9 Forward -180 -161 13.6675 0.269
NP_441203.1_1 Reverse -186 -205 -20.2567 0.297
NP_442255.1_3 Forward -328 -309 10.9142 0.208
NP_440914.1_1 Forward -194 -184 16.3248 0.00196
NP_440914.1_1 Reverse -185 -195 8.51751 0.186
NP_441011.1_8 Forward -193 -184 16.6177 0.00602
NP_441011.1_8 Reverse -186 -195 14.356 0.0249
NP_442533.1_1 Reverse -16 -35 -15.9302 0.26
NP_442533.1_6 Forward -194 -185 17.2076 0.00137
NP_442533.1_6 Reverse -185 -194 17.2076 0.00137
NP_442533.1_6 Forward -260 -251 11.7994 0.0386
NP_442533.1_6 Reverse -125 -134 2.35967 0.259
NP_442232.1_3 Forward -202 -183 -13.6686 0.282
NP_443016.1_1 Reverse -157 -176 -7.96535 0.289
NP_441482.1_7 Forward -200 -186 10.521 0.0135
NP_441482.1_7 Reverse -179 -193 -4.62196 0.153
NP_439944.1_9 Reverse -186 -196 17.4829 0.00423
NP_439944.1_9 Forward -193 -183 9.12481 0.1
NP_441028.1_6 Reverse -38 -48 14.0409 0.158
NP_441028.1_6 Reverse -312 -322 7.35439 0.229
NP_441028.1_6 Reverse -158 -168 7.15773 0.23
NP_441028.1_6 Reverse -78 -88 5.48612 0.255
NP_441028.1_6 Reverse -311 -321 5.38779 0.255
NP_441527.1_4 Forward -324 -305 -1.95801 0.152
NP_440115.1_6 Forward -197 -187 19.2529 0.0106
NP_440115.1_6 Reverse -182 -192 4.89658 0.28
NP_440007.1_9 Forward -198 -184 4.03116 0.267
NP_441961.1_2 Reverse -102 -121 7.96426 0.237
NP_443045.1_5 Forward -259 -246 15.6054 0.206
NP_441972.1_5 Reverse -186 -205 -2.75381 0.19
NP_441106.1_1 Reverse -184 -193 18.486 0.0028
NP_441106.1_1 Forward -195 -186 9.73449 0.0311
NP_439903.1_6 Reverse -182 -201 2.26028 0.231
NP_439903.1_6 Reverse -214 -233 -0.886293 0.287
NP_441439.1_7 Reverse -21 -40 16.8141 0.139
NP_442306.1_10 Reverse -180 -199 -19.7651 0.2
NP_441286.1_1 Reverse -184 -196 14.7886 0.00418
NP_441286.1_1 Forward -195 -183 -3.50094 0.145
NP_441286.1_1 Reverse -154 -166 -6.5492 0.267
NP_441385.1_1 Reverse -26 -41 14.4346 0.28
NP_440670.1_8 Forward -194 -185 18.3876 0.000699
NP_440670.1_8 Reverse -185 -194 18.3876 0.000699
NP_440886.1_7 Forward -195 -185 8.04271 0.0805
NP_440886.1_7 Reverse -184 -194 8.04271 0.0805
NP_440886.1_7 Reverse -162 -172 4.50281 0.232
NP_440886.1_7 Forward -35 -25 4.10949 0.253
NP_442614.1_2 Forward -319 -305 11.7993 0.181
NP_442614.1_2 Reverse -185 -199 9.63603 0.242
NP_442382.1_9 Reverse -151 -170 7.66846 0.29
NP_442072.1_9 Reverse -184 -202 -4.11075 0.041
NP_442072.1_9 Forward -195 -177 -11.3872 0.0789
NP_440907.2_8 Reverse -186 -196 19.449 0.00351
NP_440907.2_8 Forward -193 -183 9.616 0.103
NP_441021.1_1 Reverse -186 -205 -5.31042 0.177
NP_440841.1_4 Forward -174 -155 -10.6203 0.283
NP_441463.1_3 Reverse -175 -194 -10.4236 0.294
NP_441463.1_5 Forward -195 -181 11.5043 0.232
NP_441463.1_6 Reverse -183 -197 8.73514 0.25
NP_441626.1_2 Forward -193 -186 15.7721 0.0124
NP_441626.1_2 Reverse -186 -193 15.7721 0.0124
NP_442794.1_1 Forward -198 -186 3.57889 0.286
NP_442794.1_5 Forward -197 -183 12.1926 0.275
NP_442615.1_1 Forward -203 -185 3.46073 0.0542
NP_442615.1_1 Reverse -176 -194 -4.40575 0.185
NP_441962.1_4 Forward -163 -144 -6.68705 0.18
NP_441962.1_4 Forward -199 -180 -10.3253 0.226
NP_441962.1_9 Forward -358 -339 5.11266 0.28
NP_440387.1_1 Reverse -185 -201 5.46674 0.0322
NP_441431.1_2 Reverse -182 -196 11.2087 0.145
NP_441431.1_2 Forward -197 -183 9.53707 0.183
NP_441836.1_2 Reverse -331 -350 -5.01543 0.269
NP_441836.1_2 Forward -130 -111 -5.70374 0.284
NP_441993.1_1 Forward -200 -181 2.23906 0.261
NP_441174.1_4 Forward -210 -200 11.7798 0.288
NP_440358.1_1 Forward -317 -303 16.7159 0.298
NP_440814.1_4 Forward -203 -184 -12.5869 0.236
NP_440114.1_10 Forward -194 -180 19.0758 0.00367
NP_441500.1_8 Forward -124 -110 13.5668 0.297
NP_440293.1_3 Forward -262 -243 0.982764 0.21
NP_440293.1_9 Forward -265 -251 11.8274 0.257
NP_440766.1_4 Forward -198 -184 8.06273 0.0871
NP_439988.1_3 Reverse -338 -352 3.63784 0.298
NP_441237.1_9 Reverse -186 -196 17.2863 0.00348
NP_440643.1_6 Reverse -246 -265 2.3594 0.26
NP_439910.1_1 Forward -266 -252 18.0925 0.271
NP_439910.1_2 Reverse -177 -194 -12.6459 0.0924
NP_439910.1_2 Forward -202 -185 -13.6292 0.162
NP_440457.1_1 Forward -198 -186 16.4603 0.0486
NP_440457.1_1 Reverse -21 -33 2.79224 0.205
NP_440457.1_1 Reverse -181 -193 -0.551008 0.268
NP_440798.1_6 Reverse -186 -199 0.805932 0.248
NP_440801.1_9 Forward -263 -249 13.3201 0.276
NP_442509.1_9 Reverse -185 -195 17.3841 0.00128
NP_442509.1_9 Forward -194 -184 8.04271 0.192
NP_440554.1_4 Forward -193 -183 17.9746 0.0131
NP_440554.1_4 Reverse -186 -196 6.27322 0.123
NP_441885.1_5 Forward -194 -184 11.3864 0.00668
NP_441885.1_5 Reverse -185 -195 11.3864 0.00668
NP_442341.1_7 Reverse -184 -198 8.65272 0.0858
NP_442341.1_9 Reverse -183 -197 14.0603 0.0713
NP_441756.1_5 Forward -198 -179 7.66927 0.154
NP_440191.1_5 Forward -238 -219 17.2074 0.142
NP_443000.1_7 Reverse -183 -193 20.3345 0.00223
NP_443000.1_7 Forward -196 -186 2.14332 0.226
NP_440507.2_3 Reverse -347 -366 11.5033 0.179
NP_440507.2_8 Reverse -373 -392 8.16093 0.142
NP_440552.1_8 Forward -388 -371 11.2247 0.261
NP_440275.1_3 Forward -196 -186 19.5479 0.00756
NP_440275.1_3 Reverse -183 -193 16.1063 0.0155
NP_440091.1_1 Reverse -181 -193 1.41561 0.197
NP_440149.1_10 Forward -158 -139 -11.0136 0.285
NP_441105.1_3 Forward -370 -351 1.96607 0.108
NP_441105.1_3 Reverse -174 -193 -7.57203 0.255
NP_440216.1_1 Forward -194 -180 15.8309 0.00314
NP_440216.1_1 Reverse -185 -199 -2.16369 0.0482
NP_440172.1_1 Forward -194 -184 17.5813 0.00421
NP_440172.1_1 Reverse -185 -195 16.303 0.00854
NP_442015.1_10 Forward -198 -185 13.0973 0.0365
NP_441226.1_7 Forward -193 -186 14.4934 0.0123
NP_441226.1_7 Reverse -186 -193 14.4934 0.0123
NP_441111.1_7 Forward -193 -185 18.7023 0.00294
NP_441111.1_7 Reverse -186 -194 18.7023 0.00294
NP_441766.1_2 Forward -194 -185 17.5026 0.00297
NP_441766.1_2 Reverse -185 -194 17.5026 0.00297
NP_440416.1_1 Forward -194 -175 -3.3438 0.117
NP_440416.1_9 Forward -359 -340 -18.5851 0.26
NP_443052.1_8 Forward -249 -230 -12.6852 0.259
NP_443052.1_8 Reverse -175 -194 -13.4719 0.286
NP_443052.1_9 Forward -358 -339 -7.37537 0.297
NP_440261.1_5 Reverse -186 -199 16.2439 0.0122
NP_440261.1_5 Forward -193 -180 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGATTAGAGCGATTAATTATCCTTTTGCAACAAATGGCTACGCCCCCCGCTCCTAGCCCGGACTTGTACCTGATTTCCAAAGGGGAAAAGGCAGAACCCCAAGCGTTAATTCTGGCTCAAAAGTTACGCAATCAAGGTTTGGCCGTGGCTTTGGATCTAAGTGCTAGTGCCTTTGGCAAACAATTTAAACGGGCGGATAAATCCGGGGCGATCGCCTGTTTAGTACTGGGAGATGGGGAAATAGCAACGGGCACAGTACAGCTTAAATGGCTGGCCGATAAAGCCCAGGAAACCTTGCAGTTACAGGATTTAATGGGGAACATTACGGAACTCAAACAACGTTTAGCGGGACATAGGGAAAAATACCCCCACCTCACCTCTAACTTTTCTGTGACTTGCC

CDS

ATGACCCCATGGACAATTTGGTTTAAAACCGACGATATCCCCAGTTGGCAACCGCTAGATTCCTGCCGCTCCTTGCCCGTGGGCCATTACCGTCTAGCGGCCCGATTGCCAGTGCCCCACAAATATGTGCAATGGCGCTGGAAGTTTTTCTCCGCCACCGGCAAAGTGGAAAACCATGATTTCCAGGGCCGCACTAATCAAGACGGTCTGATTTCTCTGTTGGATTTGCACACTGTCCAACCGGGAACCTGGCAACTGAGTGCCCAACCAGACTTATTCGATCACCTTTGTGGAGAAACCTGGCAAATTCGTTTTCAATTCCAAATTGTTACCCCTGCCATCACCACGGTGACAGTACCGAAACTCAATACTGAACCAGAGGAATTGGAGCCGGAAGAAGAACAGAGCGTAACAGATGAGGCCAATAACTCCATTGTGCCCCATCCAAAGCGTCCTATGGTGGTGCCAGAGCTTGATCCAGAGCCGGTACCGGTACTGCAATGGCACAGAAAGGCAAGGGTGAAACTGACAGGGAATGGGGAAACGGAACCCGGTAAATCTCTAGAGACCACGGAAGTAACGGAAAACAGAGGGGAAATAATTGAAGAGCAAATTCCAGAACCGCTGGCAATTACAGCGCCAACCATTGAAAAAATAGCTGAAGAGAAGGTGGAGGAGCCAATCCTCGAACCCGTGTTGGCGATCGCCGTTAATGTTGAAGCAGGGGAAGAACAAATAGAAGAAAAAATAAAGGAATCAGTACAGGAAGAAATGCCAGAGGCTTTGGTGGCTAGTGTTTTAGATGTTATTGAAGAAAAAGAGGAGGTAACGGACGATAAACAGCCAGAAGCCTTGGTAATAGTAGAGTCATCAACTGATACCGATGCCGAAGACAAGTTAGAAAAATCAGAGGGATTTAACCCTTTCCGTTCCGTCAGTTACTCTGTGGAGCTAATTTATCCAGAACTGGAAAATCCCATCCAAGTTGACATTACGGTGATGGTGGACGAAAATCGCCCGCCCGTGCATCTGGATTTACCCGATCCCAGCAAAATGGTTAGCCTACTGCACCGTCGTCCCCGTTATCCCAATTCCCCTCTACCGCCTCGGTTGACTAGTGCTTAG

Protein

MTPWTIWFKTDDIPSWQPLDSCRSLPVGHYRLAARLPVPHKYVQWRWKFFSATGKVENHDFQGRTNQDGLISLLDLHTVQPGTWQLSAQPDLFDHLCGETWQIRFQFQIVTPAITTVTVPKLNTEPEELEPEEEQSVTDEANNSIVPHPKRPMVVPELDPEPVPVLQWHRKARVKLTGNGETEPGKSLETTEVTENRGEIIEEQIPEPLAITAPTIEKIAEEKVEEPILEPVLAIAVNVEAGEEQIEEKIKESVQEEMPEALVASVLDVIEEKEEVTDDKQPEALVIVESSTDTDAEDKLEKSEGFNPFRSVSYSVELIYPELENPIQVDITVMVDENRPPVHLDLPDPSKMVSLLHRRPRYPNSPLPPRLTSA