Your browser is old and dusty. Try Google Chrome!

Details for slr0354

ORF slr0354
Accession NP_442098.1
Symbol
Category ATP-binding protein of ABC transporter
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441480.1_5 Forward -300 -281 9.3409 0.299
NP_441818.1_1 Reverse -58 -69 13.3328 0.0808
NP_440996.1_3 Forward -294 -276 12.1139 0.221
NP_440996.1_4 Reverse -367 -377 17.5813 0.15
NP_442752.1_4 Reverse -266 -273 12.1338 0.0546
NP_442752.1_4 Forward -293 -286 5.44732 0.202
NP_443027.1_4 Forward -277 -267 7.45319 0.24
NP_441745.1_3 Reverse -87 -106 13.47 0.282
NP_442975.1_10 Forward -279 -265 7.96378 0.112
NP_441250.1_3 Forward -304 -285 6.58763 0.223
NP_440110.1_8 Reverse -251 -270 -2.55715 0.274
NP_441054.1_2 Reverse -356 -375 16.0274 0.136
NP_441054.1_4 Forward -303 -285 4.73903 0.151
NP_441476.1_5 Forward -393 -374 2.65439 0.188
NP_440878.1_9 Forward -48 -29 -3.63879 0.299
NP_442062.1_8 Reverse -379 -389 4.79825 0.198
NP_441859.1_3 Forward -357 -338 6.48849 0.176
NP_441859.1_8 Forward -283 -264 15.9291 0.224
NP_441802.1_1 Forward -223 -204 4.81767 0.286
NP_440304.1_4 Forward -28 -18 4.40493 0.266
NP_440304.1_4 Forward -121 -111 2.33998 0.299
NP_441581.1_9 Forward -192 -173 5.58586 0.296
NP_441619.1_8 Reverse -367 -381 9.04542 0.237
NP_441594.1_6 Reverse -370 -389 3.73603 0.225
NP_441594.1_6 Forward -172 -153 1.27776 0.269
NP_442367.1_4 Forward -328 -309 7.86593 0.298
NP_441925.1_4 Forward -264 -245 -0.00131823 0.155
NP_441925.1_4 Reverse -273 -292 -17.4058 0.294
NP_441083.1_5 Reverse -30 -40 -0.41329 0.267
NP_441434.1_6 Reverse -362 -372 14.9263 0.277
NP_441738.1_2 Reverse -286 -293 10.2652 0.101
NP_441713.1_1 Reverse -260 -279 -12.2919 0.244
NP_442570.1_3 Reverse -102 -121 -0.688862 0.212
NP_442462.1_9 Reverse -258 -277 14.8474 0.292
NP_440481.1_6 Forward -34 -16 12.1139 0.294
NP_440747.1_10 Reverse -281 -293 -12.4491 0.282
NP_441486.1_1 Forward -69 -55 -0.983719 0.166
NP_442608.1_1 Forward -359 -345 20.2558 0.106
NP_442634.1_4 Reverse -264 -278 -1.5737 0.149
NP_441014.1_10 Forward -67 -48 8.94676 0.125
NP_442848.1_1 Forward -72 -58 0.982901 0.255
NP_442848.1_9 Reverse -373 -392 6.29264 0.189
NP_441846.1_10 Reverse -251 -270 -13.5702 0.206
NP_440642.1_10 Reverse -269 -283 8.55376 0.198
NP_440642.1_10 Forward -369 -355 5.89884 0.241
NP_440642.1_10 Reverse -159 -173 4.12889 0.26
NP_440642.1_10 Forward -368 -354 2.26061 0.281
NP_440667.1_2 Reverse -355 -374 -2.26216 0.232
NP_440360.1_10 Forward -354 -340 2.65453 0.261
NP_440360.1_10 Forward -386 -372 2.2612 0.267
NP_442658.1_1 Forward -121 -111 9.22267 0.165
NP_442198.1_7 Forward -274 -255 8.25844 0.298
NP_442782.1_2 Reverse -194 -208 1.27789 0.281
NP_442205.1_9 Forward -281 -265 6.64671 0.111
NP_442205.1_9 Reverse -260 -276 -1.12144 0.264
NP_441414.1_9 Reverse -57 -76 -10.7186 0.293
NP_441958.1_5 Reverse -265 -275 0.373358 0.154
NP_442690.1_1 Forward -230 -211 -11.1119 0.223
NP_443055.1_6 Reverse -15 -33 0.903388 0.238
NP_441099.1_5 Forward -303 -284 -12.0953 0.294
NP_442002.1_9 Reverse -378 -385 13.0188 0.185
NP_442438.1_10 Forward -71 -57 -0.0987402 0.248
NP_441000.1_5 Forward -21 -2 3.73524 0.286
NP_442004.1_6 Reverse -266 -280 17.8958 0.0534
NP_442004.1_6 Forward -275 -261 12.586 0.104
NP_441725.1_5 Forward -65 -55 -0.118297 0.232
NP_440736.1_10 Reverse -372 -390 17.3254 0.293
NP_442941.1_3 Forward -274 -264 7.45319 0.0727
NP_442941.1_3 Reverse -267 -277 5.5849 0.107
NP_442941.1_3 Forward -65 -55 0.57002 0.199
NP_440802.1_9 Reverse -327 -346 20.2556 0.129
NP_442281.1_1 Forward -124 -110 2.75226 0.257
NP_441334.1_7 Forward -277 -258 -14.4552 0.263
NP_442247.1_8 Reverse -264 -278 7.76774 0.294
NP_441346.1_5 Forward -225 -206 18.6823 0.133
NP_442554.1_8 Reverse -339 -349 1.74999 0.298
NP_442167.1_6 Forward -383 -367 14.1191 0.228
NP_441586.1_5 Forward -271 -252 3.34271 0.291
NP_442313.1_4 Forward -46 -27 5.89931 0.288
NP_442292.1_1 Forward -65 -56 -0.786921 0.287
NP_440122.1_2 Reverse -364 -383 -1.37718 0.286
NP_440919.1_1 Reverse -352 -371 -5.80207 0.258
NP_442476.1_6 Forward -274 -260 8.35772 0.103
NP_441264.1_10 Forward -43 -29 19.6658 0.0429
NP_443009.1_5 Reverse -265 -276 11.4645 0.0643
NP_443009.1_5 Forward -276 -265 8.51463 0.106
NP_443009.1_5 Reverse -378 -389 4.38475 0.249
NP_441371.1_3 Forward -358 -340 7.29564 0.277
NP_441715.1_4 Forward -122 -112 4.60159 0.261
NP_441198.1_8 Forward -277 -267 12.8807 0.116
NP_440379.1_5 Forward -274 -255 -5.70374 0.226
NP_441020.2_7 Forward -264 -245 9.43841 0.26
NP_441015.1_10 Forward -292 -273 -9.73531 0.282
NP_441731.1_7 Forward -45 -26 11.3075 0.147
NP_440672.1_1 Forward -292 -274 17.0304 0.215
NP_441876.1_9 Forward -361 -351 10.5993 0.287
NP_441826.1_2 Forward -72 -58 -2.26202 0.269
NP_442490.1_9 Forward -293 -274 -5.11376 0.273
NP_441612.1_2 Forward -166 -156 13.3899 0.21
NP_441612.1_2 Forward -114 -104 10.0983 0.21
NP_440923.1_10 Reverse -84 -103 11.3075 0.298
NP_441557.1_5 Reverse -266 -275 -0.885252 0.26
NP_442267.1_4 Reverse -80 -99 4.71934 0.199
NP_440738.1_5 Forward -384 -365 1.27776 0.293
NP_441308.1_8 Reverse -264 -274 10.1081 0.22
NP_441308.1_8 Forward -277 -267 9.91146 0.226
NP_442183.1_1 Reverse -266 -280 3.8345 0.295
NP_441116.1_9 Reverse -328 -342 11.8976 0.268
NP_441819.1_5 Reverse -195 -214 8.35512 0.295
NP_442347.1_2 Forward -310 -301 5.11294 0.238
NP_442347.1_2 Forward -65 -56 4.91628 0.249
NP_442645.1_2 Forward -74 -55 -17.0118 0.246
NP_442594.1_8 Reverse -362 -381 5.11266 0.254
NP_441633.1_3 Forward -390 -377 -2.93064 0.177
NP_442998.1_5 Forward -220 -210 9.91146 0.232
NP_442998.1_10 Reverse -274 -281 3.97235 0.297
NP_441799.1_1 Reverse -53 -67 4.8172 0.236
NP_442334.1_2 Reverse -354 -371 -13.8258 0.297
NP_440256.1_1 Forward -278 -259 -6.78538 0.22
NP_441559.1_8 Reverse -261 -275 0.589577 0.165
NP_441559.1_8 Forward -358 -344 -5.21195 0.254
NP_441559.1_8 Forward -280 -266 -6.78525 0.279
NP_440915.1_6 Forward -279 -265 -2.26202 0.265
NP_442158.1_4 Reverse -96 -106 10.6981 0.283
NP_440717.1_1 Reverse -29 -48 4.32602 0.296
NP_440134.1_2 Forward -230 -211 0.0977854 0.298
NP_442452.1_3 Forward -310 -291 0.884433 0.282
NP_440748.1_5 Forward -326 -307 -2.45882 0.274
NP_441464.1_8 Forward -259 -245 7.07942 0.219
NP_440026.1_8 Reverse -245 -263 7.88563 0.297
NP_440306.1_3 Reverse -372 -391 8.16093 0.295
NP_442993.1_1 Reverse -266 -282 -9.67623 0.19
NP_440168.1_9 Forward -339 -320 -3.04881 0.286
NP_441248.1_10 Forward -103 -93 16.0642 0.277
NP_440059.1_1 Reverse -371 -390 11.2092 0.193
NP_439976.1_4 Reverse -25 -44 5.50519 0.278
NP_442950.1_1 Reverse -356 -375 -3.83545 0.24
NP_440211.1_7 Reverse -261 -279 14.4738 0.0905
NP_440586.1_1 Forward -297 -278 4.81767 0.198
NP_440586.1_8 Forward -92 -85 8.88855 0.205
NP_442251.1_6 Forward -202 -195 7.11894 0.274
NP_440192.1_4 Forward -40 -21 13.3754 0.169
NP_440027.1_3 Forward -275 -257 5.22993 0.245
NP_443051.1_1 Reverse -265 -274 -0.000272808 0.245
NP_439937.1_9 Reverse -27 -44 -3.69841 0.157
NP_440439.1_1 Reverse -263 -276 11.9173 0.0288
NP_440439.1_1 Forward -278 -265 -0.37404 0.215
NP_440574.1_7 Forward -300 -281 19.174 0.0515
NP_439977.1_5 Forward -394 -375 0.196116 0.212
NP_442384.1_10 Forward -275 -262 7.98409 0.0711
NP_441018.1_7 Forward -297 -278 15.0441 0.116
NP_441018.1_7 Reverse -100 -119 12.9791 0.145
NP_441018.1_7 Forward -76 -57 11.1109 0.192
NP_441018.1_7 Reverse -53 -72 7.7676 0.265
NP_441689.1_5 Forward -277 -267 15.3192 0.0403
NP_440531.1_6 Forward -355 -336 -4.42544 0.28
NP_440531.1_8 Reverse -362 -381 8.45592 0.216
NP_441965.1_10 Forward -278 -262 3.40179 0.265
NP_441898.1_1 Reverse -245 -264 13.1758 0.299
NP_442280.1_10 Forward -274 -256 10.4218 0.223
NP_442280.1_10 Reverse -100 -118 7.69463 0.268
NP_441896.1_3 Forward -397 -378 9.0459 0.0872
NP_440894.1_4 Reverse -29 -48 1.47442 0.284
NP_440937.1_8 Reverse -364 -383 4.03102 0.264
NP_440999.1_9 Forward -392 -378 0.982901 0.172
NP_440888.1_2 Forward -275 -261 9.14375 0.137
NP_440888.1_2 Reverse -266 -280 8.06211 0.172
NP_442557.1_1 Reverse -24 -42 20.0787 0.0854
NP_442033.1_10 Reverse -377 -396 -13.5702 0.287
NP_440575.1_1 Reverse -152 -171 -1.47628 0.29
NP_442077.1_9 Reverse -88 -107 -6.88371 0.291
NP_442845.1_2 Forward -281 -267 15.1426 0.0752
NP_442845.1_2 Reverse -260 -274 4.62115 0.256
NP_441319.1_8 Reverse -255 -273 5.23069 0.281
NP_443064.1_6 Forward -275 -265 9.3673 0.226
NP_443064.1_6 Reverse -266 -276 8.59164 0.278
NP_441462.1_2 Reverse -266 -276 -0.314959 0.206
NP_442487.1_5 Forward -276 -257 6.58682 0.198
NP_440516.1_8 Forward -281 -272 -0.196935 0.185
NP_442428.1_5 Forward -65 -58 3.67736 0.298
NP_441032.1_1 Reverse -26 -45 10.6192 0.264
NP_441353.1_7 Forward -285 -267 16.4396 0.242
NP_441443.1_1 Reverse -355 -374 0.196116 0.225
NP_441443.1_7 Reverse -361 -380 -2.0655 0.268
NP_440673.1_3 Forward -64 -57 7.51227 0.252
NP_440673.1_3 Forward -309 -302 7.41394 0.263
NP_440718.1_2 Forward -124 -105 14.0608 0.197
NP_441052.1_2 Forward -66 -56 -0.511621 0.282
NP_442219.1_9 Forward -65 -56 4.71961 0.198
NP_440436.1_4 Forward -65 -56 4.12922 0.288
NP_440314.1_9 Forward -65 -46 -0.787193 0.114
NP_442907.1_9 Forward -280 -261 1.96607 0.174
NP_441004.1_1 Reverse -373 -392 -9.24366 0.206
NP_441004.1_1 Reverse -244 -263 -17.9951 0.296
NP_442366.1_5 Reverse -299 -309 12.7626 0.108
NP_442854.1_6 Forward -281 -262 12.3892 0.175
NP_442308.1_7 Reverse -270 -289 18.2132 0.187
NP_441851.1_10 Reverse -378 -388 9.81313 0.112
NP_441851.1_10 Reverse -265 -275 6.56821 0.161
NP_441851.1_10 Forward -294 -284 4.3066 0.277
NP_441668.1_4 Reverse -363 -382 10.3242 0.109
NP_441668.1_4 Forward -103 -84 4.12936 0.183
NP_442515.1_1 Forward -114 -100 -2.45868 0.275
NP_442515.1_1 Reverse -56 -70 -3.44199 0.29
NP_441683.1_7 Forward -291 -272 -10.9153 0.284
NP_441982.1_6 Forward -222 -213 11.6259 0.288
NP_441046.1_2 Reverse -362 -381 6.19431 0.221
NP_442843.1_1 Reverse -339 -358 5.01433 0.149
NP_442450.1_5 Reverse -82 -92 5.78156 0.227
NP_440195.1_4 Reverse -290 -309 6.58763 0.27
NP_442006.1_2 Reverse -349 -366 -17.3657 0.274
NP_442038.1_1 Forward -226 -207 0.687771 0.278
NP_441570.1_1 Reverse -57 -75 -9.42063 0.137
NP_441570.1_1 Forward -281 -263 -17.2871 0.269
NP_441570.1_1 Forward -275 -257 -17.7788 0.291
NP_442729.1_8 Reverse -53 -66 6.1158 0.212
NP_442348.1_2 Forward -293 -284 15.7327 0.119
NP_440793.1_1 Reverse -152 -166 11.012 0.279
NP_440526.1_3 Reverse -285 -296 5.66304 0.237
NP_441432.1_8 Reverse -56 -65 14.7494 0.0218
NP_441732.1_2 Forward -279 -263 -16.5594 0.174
NP_441737.1_1 Forward -106 -87 7.07928 0.169
NP_441023.1_1 Reverse -314 -332 19.1937 0.16
NP_440713.1_4 Reverse -256 -275 15.1424 0.0793
NP_442489.1_7 Forward -66 -57 -2.06522 0.288
NP_442913.1_10 Forward -75 -56 2.65439 0.123
NP_442913.1_10 Forward -266 -247 -5.21209 0.26
NP_441800.1_4 Forward -49 -35 19.3649 0.252
NP_442776.1_1 Forward -270 -251 9.83255 0.181
NP_442346.1_5 Reverse -56 -66 9.32148 0.118
NP_440545.1_5 Reverse -257 -274 10.2653 0.21
NP_441126.1_1 Forward -102 -83 14.5942 0.223
NP_441126.1_6 Forward -224 -210 15.4641 0.248
NP_442934.1_1 Reverse -72 -91 11.6025 0.267
NP_442603.1_7 Reverse -84 -98 6.48882 0.24
NP_442828.1_7 Forward -41 -22 -3.04881 0.276
NP_440671.1_4 Forward -32 -18 10.1277 0.164
NP_440671.1_4 Forward -72 -58 9.83269 0.17
NP_440224.1_1 Reverse -255 -274 -4.13045 0.29
NP_440772.1_7 Forward -42 -23 15.0441 0.168
NP_442140.1_3 Forward -355 -345 7.45319 0.14
NP_440875.1_9 Reverse -258 -268 6.81464 0.297
NP_440035.1_6 Forward -105 -86 10.2259 0.283
NP_441239.1_9 Forward -39 -27 7.02048 0.173
NP_441239.1_9 Forward -390 -378 4.5622 0.251
NP_442193.1_8 Forward -278 -259 10.0284 0.286
NP_441017.1_8 Reverse -325 -340 6.86307 0.287
NP_441874.1_1 Reverse -369 -383 13.8643 0.208
NP_440833.1_6 Forward -375 -361 7.17714 0.285
NP_442809.1_6 Forward -293 -274 4.42435 0.256
NP_440546.1_6 Reverse -357 -376 7.07928 0.278
NP_440462.1_6 Reverse -264 -274 7.15819 0.089
NP_440462.1_6 Forward -277 -267 4.60159 0.194
NP_441868.1_4 Reverse -259 -273 19.0758 0.164
NP_442402.1_2 Reverse -209 -223 11.897 0.272
NP_442402.1_4 Forward -153 -134 3.04693 0.154
NP_442402.1_4 Reverse -149 -168 -8.55607 0.283
NP_441848.1_4 Forward -227 -211 7.55067 0.288
NP_441848.1_7 Forward -374 -355 3.9319 0.217
NP_442039.1_7 Forward -117 -107 15.2213 0.211
NP_441811.1_8 Reverse -373 -387 7.86607 0.241
NP_442837.1_3 Reverse -267 -274 9.47889 0.125
NP_442837.1_3 Forward -274 -267 9.47889 0.125
NP_440805.1_8 Reverse -39 -58 8.84924 0.269
NP_440505.1_3 Reverse -264 -274 13.0581 0.0387
NP_440505.1_3 Forward -295 -285 11.4848 0.0755
NP_440505.1_3 Forward -261 -251 7.64985 0.151
NP_440505.1_3 Reverse -55 -65 4.99491 0.252
NP_440505.1_7 Forward -318 -299 -0.983855 0.271
NP_442255.1_1 Forward -36 -17 13.9625 0.095
NP_440914.1_1 Reverse -284 -294 12.226 0.0652
NP_440914.1_1 Reverse -57 -67 11.5428 0.0887
NP_440914.1_1 Forward -275 -265 10.2742 0.147
NP_442533.1_1 Forward -299 -280 -16.4218 0.268
NP_442533.1_6 Reverse -266 -275 4.71961 0.177
NP_442232.1_3 Reverse -371 -390 -10.227 0.266
NP_441482.1_7 Forward -99 -85 -5.60527 0.186
NP_441527.1_4 Forward -174 -155 -6.8281 0.226
NP_441527.1_4 Forward -175 -156 -10.4568 0.27
NP_441347.1_5 Reverse -260 -274 15.1419 0.238
NP_441961.1_4 Reverse -248 -267 9.73422 0.259
NP_441602.1_3 Reverse -261 -280 -1.27885 0.226
NP_441602.1_3 Reverse -374 -393 -1.86883 0.231
NP_440444.1_6 Forward -323 -310 18.2105 0.187
NP_441286.1_1 Forward -67 -55 0.432302 0.113
NP_442614.1_2 Forward -281 -267 11.7993 0.181
NP_442614.1_2 Reverse -302 -316 7.17775 0.275
NP_442098.1_4 Forward -34 -15 21.2389 0.0373
NP_442098.1_7 Forward -330 -311 26.8438 0.00421
NP_440907.2_8 Forward -274 -264 5.68278 0.191
NP_442264.1_2 Reverse -53 -70 4.95539 0.288
NP_442264.1_5 Reverse -266 -280 11.996 0.253
NP_440841.1_4 Forward -121 -102 -9.83364 0.264
NP_440193.1_4 Forward -280 -261 9.24257 0.203
NP_441463.1_3 Forward -76 -57 -6.58872 0.246
NP_441463.1_3 Reverse -100 -119 -10.3253 0.293
NP_441460.1_2 Forward -368 -355 14.2767 0.244
NP_442615.1_1 Forward -290 -272 -7.35568 0.287
NP_441962.1_4 Reverse -279 -298 -4.32711 0.157
NP_441962.1_4 Reverse -374 -393 -5.70374 0.172
NP_441962.1_4 Forward -71 -52 -14.2585 0.285
NP_440387.1_1 Reverse -266 -282 -4.1697 0.178
NP_440855.1_5 Forward -362 -343 5.99684 0.285
NP_441488.1_7 Reverse -373 -392 5.30933 0.159
NP_440287.1_5 Forward -371 -352 8.35677 0.286
NP_440293.1_3 Reverse -254 -273 7.07928 0.184
NP_440293.1_3 Reverse -371 -390 4.52268 0.192
NP_440766.1_5 Forward -223 -211 16.2501 0.158
NP_440766.1_5 Reverse -202 -214 7.46481 0.29
NP_442743.1_1 Reverse -28 -47 11.995 0.241
NP_441489.1_3 Forward -224 -210 12.6166 0.198
NP_442514.1_5 Forward -394 -375 -6.29447 0.265
NP_442341.1_7 Forward -389 -375 7.07942 0.111
NP_441173.1_9 Reverse -215 -223 13.1954 0.184
NP_441173.1_9 Reverse -214 -222 12.9004 0.206
NP_441173.1_9 Reverse -34 -42 10.2454 0.261
NP_441173.1_9 Reverse -107 -115 9.85212 0.275
NP_442395.2_9 Reverse -313 -329 12.6449 0.279
NP_440423.1_6 Reverse -339 -358 -12.4886 0.195
NP_443000.1_7 Reverse -55 -65 4.50326 0.188
NP_443000.1_7 Reverse -264 -274 1.16001 0.271
NP_441842.1_1 Forward -273 -260 10.8351 0.286
NP_441105.1_3 Reverse -368 -387 -2.95047 0.171
NP_441730.1_2 Forward -302 -284 7.59063 0.283
NP_440216.1_1 Forward -275 -261 -11.8985 0.228
NP_440172.1_1 Reverse -57 -67 2.33998 0.279
NP_440172.1_1 Forward -93 -83 1.74999 0.299
NP_441535.1_9 Reverse -31 -50 13.0775 0.211
NP_441757.1_3 Reverse -301 -320 1.57275 0.162
NP_441766.1_2 Reverse -17 -26 1.47469 0.289
NP_443052.1_9 Reverse -27 -46 1.27776 0.186
NP_443052.1_9 Forward -264 -245 1.17943 0.186
NP_440072.1_5 Forward -37 -19 -1.25915 0.258
NP_442403.1_8 Forward -297 -278 2.0644 0.226
NP_442403.1_8 Reverse -340 -359 0.294447 0.241
NP_440591.1_9 Forward -282 -264 7.78729 0.195
NP_442154.1_1 Reverse -365 -383 -17.5821 0.26
NP_442226.1_8 Reverse -367 -377 16.6963 0.164
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTAGGTTCAGCTTGAATCGCCCCAGCCAAAATTTCCTCTGCCCCCCGATAGTTCCCATCACGAAAAATGGCTTCAAAGGCAGCTTCTGTTTGGTCGCCAATATTGTGGGGATTGTTAGGGCGAAAGGGATCCCCTGCCCAGGCAGTACCACCAGCTATTAGGACTCCTAATATAGATTGGGTAAAAATTTGGGCCCAACGATTACGAATTAAATTCATCGGAGTAAAACGGGTGAGGAAAACCAACATAATCGATTGTATCTACAGTGAGAATCAGAAAGAGCACTGGCAAAACCAAGAAAATTAGGCCGATCAAGCTAAAATTCTAAGGAATTGTGATTGCCATAATATCCAGCTTTTGGCGGAACTGGCAGGGAGACTGCGTTTCAACTTTATCAAT

CDS

ATGCTGTGTTTAAACGACGTTTGCTACCATCCGCCCGCCGCATTGCATCCCATTCTAAAAGATATCAATTTAGAATTAGCTCCCCAACAACTCGGTTTGATAATTGGCCCTAGTGGCTCTGGTAAAACCACTCTGTTAGAAATCCTTTCCGGCCTGGCAGAACCGACCAGCGGTCATATCCGTTGGCAAACCCAGGAGTTAACTCCTCTCCACCTCCAGCAGCTCTGTGGTTTAGTGTTCCAGTTCCCAGAGCGTCATTTCTGCGGTGGCACCCTGCTAGAGGAATTGCGTTTGGGACATCCGGAGCTTCCCCGCAGCCGCATTGCAGAGACCCTACAAGAGGTTGGTCTGGGTCATTGCCCTTGGAATCTTTCACCCCAAGCCCTCAGTGGTGGCCAACAAAGACGGTTGTCCTTAGCCGTGCAATTAATTCGCCAACCCAATATTCTTCTCCTCGATGAACCTACCGCAGGCCTAGATTGGTCGATGCGTCAACAATTAGCCAATCTACTAATCAAATTAAAAGACCATTGGGGACTTCTTGTTGTGACCCATGATCCAGGAGAACTAACGGCGATCGCCGACCAATGTTGGCGTTTAGAAAGAGGCAGCTTAACTCCCCAAAACCCCTGA

Protein

MLCLNDVCYHPPAALHPILKDINLELAPQQLGLIIGPSGSGKTTLLEILSGLAEPTSGHIRWQTQELTPLHLQQLCGLVFQFPERHFCGGTLLEELRLGHPELPRSRIAETLQEVGLGHCPWNLSPQALSGGQQRRLSLAVQLIRQPNILLLDEPTAGLDWSMRQQLANLLIKLKDHWGLLVVTHDPGELTAIADQCWRLERGSLTPQNP