Your browser is old and dusty. Try Google Chrome!

Details for slr0353

ORF slr0353
Accession NP_442096.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_2 Reverse -49 -67 15.7521 0.0797
NP_440259.1_4 Forward -340 -326 10.7568 0.262
NP_441098.1_3 Reverse -103 -122 -0.56821 0.25
NP_441208.1_9 Forward -77 -63 8.94771 0.219
NP_440769.1_8 Forward -362 -343 8.55425 0.23
NP_441434.1_7 Forward -51 -37 1.57289 0.299
NP_441716.1_2 Reverse -345 -364 -0.951026 0.277
NP_442530.1_2 Forward -370 -360 11.0914 0.284
NP_440236.1_2 Reverse -78 -96 -4.99573 0.277
NP_442496.1_8 Forward -159 -140 18.0541 0.0494
NP_440184.1_7 Forward -65 -46 13.5099 0.28
NP_442321.1_4 Forward -85 -66 -7.76869 0.284
NP_441317.1_4 Forward -73 -59 14.143 0.161
NP_441317.1_4 Forward -71 -57 14.0475 0.161
NP_442690.1_1 Forward -160 -141 -9.93197 0.207
NP_440388.1_7 Reverse -92 -111 0.491109 0.251
NP_441000.1_1 Reverse -197 -215 12.8119 0.199
NP_441550.1_7 Reverse -354 -373 15.5152 0.241
NP_440345.1_3 Reverse -362 -376 17.2957 0.161
NP_440345.1_3 Reverse -165 -179 14.3354 0.215
NP_440345.1_3 Reverse -361 -375 11.7571 0.247
NP_440736.1_4 Reverse -319 -338 14.3549 0.122
NP_440289.1_4 Forward -133 -114 9.0459 0.283
NP_441514.1_1 Forward -174 -164 15.5864 0.274
NP_441079.1_7 Forward -149 -130 -7.6711 0.296
NP_440891.1_8 Reverse -341 -360 16.5696 0.233
NP_440775.1_4 Forward -365 -346 12.3837 0.216
NP_440775.1_4 Reverse -357 -376 10.4615 0.216
NP_440895.1_6 Reverse -169 -182 9.2624 0.228
NP_441741.1_6 Forward -81 -62 7.96426 0.249
NP_442719.1_2 Forward -156 -138 -0.571569 0.162
NP_442719.1_2 Forward -157 -139 -10.0113 0.268
NP_441251.1_7 Reverse -134 -147 10.344 0.288
NP_442427.1_8 Reverse -132 -151 7.86593 0.203
NP_441849.1_2 Forward -117 -98 1.76618 0.245
NP_441906.1_2 Reverse -145 -164 3.44025 0.286
NP_442718.1_2 Reverse -100 -119 -5.11376 0.292
NP_440334.1_2 Reverse -373 -386 15.5556 0.203
NP_440334.1_2 Reverse -112 -125 13.6873 0.298
NP_442724.1_1 Forward -156 -146 15.9097 0.278
NP_440084.1_8 Forward -85 -71 11.9481 0.241
NP_442919.1_3 Reverse -57 -76 32.3539 0.000000334
NP_442998.1_5 Forward -143 -133 7.15819 0.299
NP_440899.1_8 Forward -116 -97 -10.3253 0.277
NP_440299.1_1 Reverse -44 -57 2.87033 0.269
NP_440977.1_1 Reverse -37 -56 37.3652 0.000000188
NP_440977.1_4 Reverse -102 -121 37.8569 0.000000502
NP_440087.1_1 Reverse -289 -308 -5.60541 0.249
NP_442860.1_7 Reverse -57 -75 8.22348 0.283
NP_442474.1_1 Reverse -65 -84 -4.22878 0.297
NP_440991.1_8 Forward -178 -159 14.9299 0.268
NP_440699.1_1 Reverse -52 -71 3.10306 0.288
NP_441877.1_9 Forward -285 -268 2.59545 0.285
NP_442262.1_2 Reverse -65 -84 15.3417 0.247
NP_442280.1_10 Forward -333 -315 4.87002 0.292
NP_441894.1_1 Reverse -316 -335 -5.21209 0.258
NP_442067.1_3 Reverse -338 -357 14.6508 0.224
NP_442637.1_1 Reverse -71 -90 -3.54046 0.16
NP_442637.1_7 Forward -121 -102 3.73603 0.166
NP_440519.1_2 Forward -190 -171 12.1925 0.194
NP_440603.1_4 Forward -52 -33 9.43923 0.221
NP_442694.1_4 Forward -76 -67 14.8477 0.164
NP_442694.1_4 Reverse -342 -351 11.0128 0.286
NP_441354.1_1 Reverse -71 -90 4.22769 0.213
NP_441542.1_4 Forward -154 -140 9.73436 0.25
NP_441982.1_6 Reverse -382 -391 13.2493 0.274
NP_441982.1_6 Reverse -367 -376 11.9124 0.288
NP_440874.1_2 Forward -119 -100 20.5519 0.0141
NP_441031.1_1 Reverse -262 -281 9.32929 0.212
NP_439950.1_3 Reverse -77 -96 3.14605 0.293
NP_442348.1_2 Forward -76 -67 6.68623 0.299
NP_441432.1_9 Forward -103 -90 11.604 0.221
NP_441333.1_1 Forward -70 -60 12.9245 0.217
NP_440386.1_3 Reverse -101 -120 -4.72043 0.221
NP_441329.1_3 Reverse -348 -358 15.3887 0.25
NP_441329.1_6 Reverse -51 -70 5.1084 0.191
NP_441329.1_6 Reverse -53 -72 -3.00842 0.294
NP_440912.1_3 Forward -73 -54 10.52 0.254
NP_441692.1_2 Reverse -82 -101 34.317 0.000000227
NP_442568.1_5 Reverse -320 -339 13.0775 0.177
NP_440219.1_4 Forward -174 -161 15.829 0.223
NP_440546.1_4 Reverse -334 -344 7.33119 0.246
NP_441848.1_7 Forward -110 -91 0.195343 0.228
NP_441084.1_6 Reverse -375 -389 9.05325 0.295
NP_442679.1_1 Reverse -319 -338 -4.03212 0.269
NP_441701.1_3 Reverse -336 -353 6.03703 0.294
NP_441959.1_8 Forward -117 -104 10.4446 0.286
NP_440013.1_2 Reverse -224 -238 16.1259 0.176
NP_442532.1_1 Reverse -56 -70 11.8628 0.215
NP_442532.1_4 Forward -137 -119 9.51625 0.273
NP_441699.1_7 Reverse -144 -163 4.12856 0.255
NP_442101.1_6 Reverse -340 -359 11.0125 0.29
NP_441527.1_4 Reverse -90 -109 0.715766 0.134
NP_441527.1_4 Reverse -318 -337 -6.25514 0.215
NP_441527.1_4 Reverse -329 -348 -9.1199 0.255
NP_441527.1_4 Reverse -315 -334 -11.2207 0.278
NP_441527.1_7 Forward -347 -328 6.88182 0.298
NP_442673.1_7 Forward -71 -52 16.6629 0.13
NP_441825.1_4 Forward -77 -67 13.8447 0.249
NP_440326.1_9 Forward -364 -345 11.8967 0.274
NP_440326.1_9 Forward -119 -100 11.5033 0.274
NP_442842.1_10 Forward -110 -91 5.22221 0.207
NP_442061.1_6 Forward -254 -244 16.1063 0.27
NP_439958.1_2 Reverse -97 -111 17.5025 0.115
NP_442238.1_7 Forward -148 -129 10.7167 0.201
NP_441836.1_2 Forward -190 -171 0.786102 0.197
NP_441425.1_2 Forward -172 -153 13.0324 0.247
NP_442698.1_10 Reverse -54 -73 7.86593 0.233
NP_442087.1_7 Forward -87 -68 -3.73788 0.285
NP_440293.1_9 Forward -252 -238 13.1803 0.216
NP_442680.1_5 Reverse -84 -103 4.07754 0.227
NP_442297.1_10 Reverse -86 -105 17.404 0.11
NP_440054.1_4 Reverse -369 -388 14.4541 0.135
NP_441489.1_3 Reverse -94 -108 8.79688 0.232
NP_440081.1_2 Reverse -103 -122 19.2075 0.165
NP_442582.1_3 Forward -157 -143 12.6166 0.284
NP_442862.1_3 Forward -147 -130 6.13536 0.267
NP_441275.1_3 Reverse -138 -152 21.5341 0.0286
NP_440628.1_1 Reverse -58 -68 13.6803 0.279
NP_442703.1_8 Forward -339 -321 10.7364 0.266
NP_441635.1_2 Reverse -76 -95 10.074 0.283
NP_441207.1_7 Reverse -101 -115 8.67452 0.282
NP_441207.1_7 Forward -173 -159 7.7064 0.295
NP_440258.1_3 Forward -382 -363 -1.37718 0.18
NP_440175.1_7 Forward -103 -85 8.97275 0.282
NP_440216.1_9 Reverse -317 -326 5.3096 0.298
NP_442116.1_6 Reverse -167 -184 10.7472 0.215
NP_442116.1_6 Reverse -101 -118 5.87715 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCCTTCCTTTTCGACAATTCCTTTTTTAAGGAAAATATTATTTCTCTAAAAACTCCCACATCCCTTTTTTTGCTTGCCTTTGAGAATGTAGATATATCGACTGTCTCTCCTCGTAAGTTCAGTCTTTTAAACATACTCCTCATGCTTGTCTGGCTCTGGTCTAACACTAATCCTAACCAGATACTCACAAACTTAAATGTGTCTAATACTGGGTAGTCATCTTTAGGAAAATTAGATAGATAAGTTTTGACAATATGTCCAAAATTTGATATCATCTCTTCAATTATTCTAATATTTCTGCCCTTTATTCTATCATTTTAAAGGGCTTTTTTTCTCTTTATAACTATCGTTCAACACTTCTGATTTCATACAACTGATGAGTTCAACAGAAATTGGAC

CDS

ATGAAAATAGATTATAAATTAACTCTCTTATTGTTTTGTTTATGTGTACCGGGTGTAATCGCTAGTTCATTTTTAATGTTGTCTTTAGTTGTCGATTCAACTGCAATTCCTGTATCTTTACAAACTCTGCAAATTGCAAATCTGATCCAAGGAGCATTGTTTGTTTTACTAGCAGCAACATTGGGTTCAATACTAACTAAAAGGGTTGGACTATGCTCACCAACGCTCTCTGCCCTTCTCAACCATGGCAGGGTTATTCATGCGTTCTATCCTCAACTTATCTCCGGGCTAGTAGGTGGATTAATAGGTGTAGCGTGTAGCCATTATCATTGGTTTTCACTTTCTTTCGCCCCCTCCACTGGCTAA

Protein

MKIDYKLTLLLFCLCVPGVIASSFLMLSLVVDSTAIPVSLQTLQIANLIQGALFVLLAATLGSILTKRVGLCSPTLSALLNHGRVIHAFYPQLISGLVGGLIGVACSHYHWFSLSFAPSTG