Your browser is old and dusty. Try Google Chrome!

Details for slr0350

ORF slr0350
Accession NP_442091.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY523e: 2441031 - 2441901]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -332 -318 -0.787057 0.239
NP_440557.1_1 Forward -90 -71 2.45773 0.234
NP_440795.1_7 Forward -332 -325 14.6904 0.0123
NP_440795.1_7 Reverse -325 -332 14.6904 0.0123
NP_441418.1_6 Forward -333 -314 -28.0249 0.203
NP_442291.1_5 Reverse -323 -339 -3.08806 0.234
NP_442291.1_7 Reverse -306 -320 10.521 0.241
NP_440897.1_6 Reverse -362 -381 -1.18128 0.187
NP_440897.1_6 Reverse -207 -226 -5.01617 0.298
NP_441453.1_4 Reverse -324 -332 16.539 0.00633
NP_441453.1_4 Forward -333 -325 16.539 0.00633
NP_442151.1_6 Forward -333 -319 8.75105 0.164
NP_442151.1_6 Reverse -324 -338 7.57108 0.194
NP_442151.1_6 Reverse -76 -90 5.50613 0.274
NP_441818.1_9 Reverse -230 -249 -3.24547 0.221
NP_441818.1_9 Reverse -224 -243 -8.752 0.281
NP_440226.1_1 Reverse -324 -343 7.96426 0.0959
NP_440226.1_1 Forward -333 -314 7.7676 0.1
NP_440226.1_2 Reverse -6 -24 17.4124 0.0782
NP_441098.1_3 Forward -33 -14 -7.17178 0.285
NP_441098.1_8 Reverse -47 -66 2.45773 0.284
NP_440996.1_3 Forward -92 -74 23.0286 0.00685
NP_442287.1_5 Reverse -388 -398 18.2696 0.19
NP_442173.1_1 Forward -332 -324 15.4574 0.00633
NP_442173.1_1 Reverse -325 -333 15.4574 0.00633
NP_442752.1_4 Forward -333 -326 13.8055 0.0199
NP_442752.1_4 Reverse -324 -331 13.8055 0.0199
NP_443027.1_4 Forward -335 -325 13.2547 0.0521
NP_443027.1_4 Forward -81 -71 6.46988 0.275
NP_439997.1_6 Reverse -37 -56 10.0292 0.212
NP_441812.1_3 Forward -237 -223 12.0943 0.21
NP_441812.1_3 Forward -271 -257 10.816 0.216
NP_441812.1_3 Reverse -323 -337 10.4227 0.222
NP_442975.1_10 Reverse -320 -334 9.93039 0.0607
NP_442975.1_10 Forward -337 -323 3.93223 0.249
NP_440074.1_6 Forward -21 -2 10.6184 0.268
NP_440784.1_7 Forward -332 -325 15.9687 0.0123
NP_440784.1_7 Reverse -325 -332 15.9687 0.0123
NP_441934.1_8 Reverse -233 -252 12.1925 0.292
NP_440061.1_9 Reverse -322 -336 11.5037 0.109
NP_440061.1_9 Forward -335 -321 9.24208 0.149
NP_440061.1_9 Reverse -163 -177 7.57046 0.202
NP_440061.1_9 Forward -298 -284 5.01387 0.298
NP_441054.1_4 Forward -89 -71 -3.22577 0.26
NP_442062.1_8 Forward -333 -323 17.3846 0.00193
NP_442062.1_8 Reverse -324 -334 10.3048 0.0493
NP_441859.1_3 Reverse -179 -198 2.55527 0.258
NP_440304.1_4 Forward -335 -325 10.8948 0.051
NP_440304.1_4 Reverse -322 -332 1.84832 0.299
NP_442242.1_4 Forward -332 -325 14.3954 0.0124
NP_442242.1_4 Reverse -325 -332 14.3954 0.0124
NP_440044.1_8 Forward -332 -313 3.44104 0.13
NP_440044.1_8 Forward -96 -77 -3.3438 0.282
NP_440307.1_2 Forward -281 -262 2.85105 0.262
NP_441208.1_9 Reverse -321 -335 7.57108 0.221
NP_442110.1_7 Reverse -324 -338 2.5562 0.222
NP_441491.1_6 Forward -384 -370 15.0773 0.271
NP_440856.1_4 Forward -340 -321 18.289 0.0211
NP_441083.1_5 Forward -333 -323 20.3345 0.00053
NP_441083.1_5 Reverse -324 -334 11.2881 0.0159
NP_441738.1_2 Forward -331 -324 15.28 0.0102
NP_441738.1_2 Reverse -326 -333 15.28 0.0102
NP_441558.1_5 Forward -335 -316 5.211 0.257
NP_440209.1_1 Reverse -324 -332 18.1123 0.00295
NP_440209.1_1 Forward -333 -325 18.1123 0.00295
NP_442889.1_8 Forward -336 -322 11.307 0.0733
NP_442889.1_10 Forward -20 -1 15.0359 0.149
NP_440447.1_5 Forward -180 -170 12.4681 0.291
NP_440447.1_6 Reverse -236 -254 3.55906 0.191
NP_440331.1_5 Forward -66 -47 20.4523 0.000117
NP_441716.1_1 Reverse -362 -376 3.04785 0.282
NP_442111.1_4 Reverse -323 -337 13.1759 0.0394
NP_441624.1_7 Reverse -304 -318 6.6861 0.275
NP_441163.1_1 Forward -252 -235 5.83964 0.267
NP_440906.1_5 Forward -332 -325 15.8704 0.0124
NP_440906.1_5 Reverse -325 -332 15.8704 0.0124
NP_440747.1_10 Forward -336 -324 17.1486 0.000663
NP_440747.1_10 Reverse -321 -333 14.887 0.00223
NP_441854.1_10 Forward -283 -264 -0.000545616 0.286
NP_441486.1_1 Reverse -321 -335 -2.45868 0.175
NP_441486.1_1 Forward -336 -322 -2.55701 0.175
NP_442634.1_4 Reverse -322 -336 -1.27871 0.149
NP_442634.1_4 Forward -335 -321 -1.8687 0.149
NP_441265.1_3 Forward -339 -325 0.392915 0.248
NP_443018.1_3 Forward -332 -325 14.8871 0.0123
NP_443018.1_3 Reverse -325 -332 14.8871 0.0123
NP_440376.1_1 Forward -333 -324 19.4693 0.000692
NP_440376.1_1 Reverse -324 -333 19.4693 0.000692
NP_441588.1_4 Forward -331 -321 15.9097 0.0369
NP_442687.1_7 Forward -334 -324 9.02648 0.0994
NP_442687.1_7 Reverse -323 -333 8.92815 0.0994
NP_440066.1_5 Forward -251 -232 8.84842 0.256
NP_442946.1_6 Reverse -156 -175 17.1404 0.291
NP_440642.1_10 Reverse -33 -47 5.40719 0.241
NP_441013.1_2 Forward -246 -228 -2.63579 0.285
NP_440360.1_9 Reverse -339 -358 5.60432 0.282
NP_442658.1_1 Forward -335 -325 14.2375 0.0237
NP_442658.1_1 Reverse -322 -332 6.76441 0.214
NP_442782.1_2 Reverse -324 -338 8.84938 0.198
NP_442782.1_2 Forward -91 -77 1.17956 0.282
NP_441414.1_9 Forward -333 -314 -10.0303 0.275
NP_442937.1_5 Reverse -319 -338 10.3242 0.165
NP_442937.1_5 Reverse -353 -372 6.78429 0.27
NP_441958.1_5 Forward -334 -324 21.2195 0.000805
NP_441958.1_5 Reverse -323 -333 12.2714 0.00183
NP_440203.1_5 Forward -143 -133 10.501 0.224
NP_440984.1_7 Forward -338 -324 16.0275 0.0466
NP_440984.1_7 Reverse -319 -333 7.57108 0.166
NP_439990.1_5 Forward -179 -166 6.60746 0.227
NP_442690.1_1 Reverse -79 -98 -15.4385 0.28
NP_440153.1_5 Reverse -325 -339 5.01447 0.193
NP_442064.1_1 Forward -203 -184 -11.8003 0.262
NP_443055.1_6 Reverse -316 -334 7.88485 0.152
NP_440993.1_2 Forward -338 -322 2.41848 0.265
NP_440993.1_3 Forward -343 -324 7.66846 0.141
NP_440602.1_2 Reverse -319 -338 8.75091 0.195
NP_440138.1_1 Forward -245 -227 8.17984 0.214
NP_441099.1_5 Reverse -314 -333 -3.24547 0.131
NP_442002.1_1 Reverse -233 -251 -8.14232 0.263
NP_441646.1_1 Reverse -355 -374 1.76941 0.228
NP_441646.1_1 Reverse -317 -336 0.58944 0.247
NP_441000.1_6 Reverse -323 -337 -3.83532 0.225
NP_440484.1_3 Forward -335 -321 12.1926 0.242
NP_440147.1_4 Reverse -322 -335 18.4072 0.00407
NP_440147.1_4 Forward -335 -322 10.344 0.0355
NP_441550.1_8 Forward -335 -325 15.8108 0.0132
NP_441550.1_8 Reverse -322 -332 14.6309 0.0132
NP_441916.1_7 Reverse -324 -334 18.9579 0.00144
NP_441916.1_7 Forward -333 -323 10.3048 0.0261
NP_440465.1_4 Reverse -323 -342 12.0942 0.217
NP_441041.1_7 Forward -336 -324 13.3454 0.0485
NP_442396.1_5 Reverse -320 -333 12.2123 0.0913
NP_442004.1_6 Forward -377 -363 4.12949 0.224
NP_441725.1_4 Forward -338 -324 4.03056 0.278
NP_441725.1_5 Forward -332 -322 2.04498 0.115
NP_441725.1_5 Reverse -325 -335 1.94665 0.115
NP_439966.1_7 Forward -335 -325 14.3359 0.0203
NP_439966.1_7 Reverse -322 -332 7.25606 0.15
NP_440736.1_3 Forward -335 -316 2.16274 0.282
NP_442941.1_3 Reverse -325 -335 19.2529 0.00262
NP_442941.1_3 Forward -332 -322 11.0914 0.0116
NP_440289.1_2 Forward -336 -323 3.16588 0.0811
NP_441076.1_3 Reverse -9 -28 13.3716 0.148
NP_440260.1_8 Reverse -315 -333 1.78911 0.183
NP_441514.1_4 Reverse -339 -358 12.4059 0.292
NP_442281.1_1 Forward -338 -324 16.9119 0.00698
NP_442281.1_1 Reverse -319 -333 9.93039 0.0648
NP_440177.1_9 Reverse -316 -335 17.3057 0.165
NP_442256.1_2 Forward -335 -317 -7.25734 0.214
NP_442982.1_5 Forward -343 -324 -0.885524 0.262
NP_441644.1_6 Reverse -324 -334 19.0557 0.000803
NP_441644.1_6 Forward -333 -323 17.3841 0.00127
NP_442215.1_2 Reverse -322 -338 -0.43312 0.167
NP_442215.1_2 Forward -200 -184 -2.00642 0.191
NP_441810.1_5 Forward -252 -233 6.39097 0.297
NP_442029.1_6 Reverse -319 -338 7.57094 0.223
NP_440253.1_2 Forward -333 -315 17.1287 0.0115
NP_440253.1_2 Reverse -244 -262 -0.177514 0.204
NP_440929.1_8 Forward -333 -324 19.2726 0.000701
NP_440929.1_8 Reverse -324 -333 19.2726 0.000701
NP_442933.1_10 Forward -333 -324 17.601 0.00325
NP_442933.1_10 Reverse -324 -333 17.601 0.00325
NP_441751.2_8 Reverse -325 -339 -2.26202 0.132
NP_442554.1_8 Reverse -325 -335 17.2863 0.00543
NP_442554.1_8 Forward -332 -322 15.3197 0.00882
NP_442554.1_8 Reverse -71 -81 2.43831 0.272
NP_441762.1_7 Forward -334 -322 0.530633 0.0747
NP_441762.1_7 Reverse -323 -335 -6.84419 0.284
NP_442142.1_4 Forward -336 -323 12.9 0.0406
NP_442142.1_4 Forward -322 -309 3.55864 0.251
NP_442142.1_4 Reverse -321 -334 3.55864 0.251
NP_442292.1_1 Forward -332 -323 18.486 0.00229
NP_442292.1_1 Reverse -325 -334 17.5026 0.00435
NP_442292.1_1 Reverse -71 -80 3.7363 0.192
NP_442476.1_6 Reverse -325 -339 3.63784 0.155
NP_442381.1_8 Forward -336 -317 1.76941 0.103
NP_441523.1_9 Reverse -234 -248 18.9775 0.262
NP_443009.1_5 Reverse -323 -334 14.5128 0.02
NP_443009.1_5 Forward -334 -323 10.1862 0.0792
NP_442408.2_1 Forward -390 -371 0.196116 0.202
NP_441715.1_4 Reverse -325 -335 16.7946 0.0106
NP_441715.1_4 Forward -332 -322 7.94484 0.107
NP_440730.1_4 Reverse -361 -380 -3.3438 0.297
NP_441448.1_1 Reverse -106 -125 4.22769 0.279
NP_442076.1_5 Forward -51 -32 6.78429 0.256
NP_441198.1_5 Forward -331 -318 13.3917 0.206
NP_440379.1_5 Forward -253 -234 -10.522 0.28
NP_440379.1_6 Reverse -324 -343 11.4058 0.191
NP_440464.1_10 Forward -332 -322 13.0082 0.169
NP_441468.1_1 Forward -332 -325 15.8704 0.0124
NP_441468.1_1 Reverse -325 -332 15.8704 0.0124
NP_441673.1_1 Forward -333 -324 20.8459 0.000698
NP_441673.1_1 Reverse -324 -333 20.8459 0.000698
NP_442253.1_5 Reverse -358 -375 -7.13932 0.298
NP_441330.1_1 Forward -338 -319 5.99764 0.0278
NP_441637.1_9 Reverse -290 -308 4.9357 0.245
NP_442063.1_9 Forward -62 -43 7.47261 0.19
NP_442868.1_6 Forward -335 -325 10.4031 0.038
NP_442868.1_6 Reverse -322 -332 9.81313 0.038
NP_441612.1_2 Forward -333 -323 8.54929 0.21
NP_441911.1_7 Forward -20 -1 37.8559 0.000000595
NP_442808.1_1 Forward -334 -324 8.73102 0.0481
NP_442808.1_1 Reverse -323 -333 8.63269 0.0481
NP_440145.1_3 Forward -343 -324 2.0644 0.121
NP_440145.1_3 Reverse -314 -333 0.0977854 0.138
NP_442542.1_2 Reverse -242 -255 7.88576 0.168
NP_442050.1_5 Forward -335 -325 15.9091 0.0091
NP_442050.1_5 Reverse -322 -332 7.64939 0.243
NP_441048.1_6 Forward -19 -5 14.1444 0.296
NP_441518.1_3 Reverse -314 -333 -11.0136 0.255
NP_441878.1_6 Forward -334 -324 10.5014 0.0176
NP_441878.1_6 Reverse -323 -333 10.4031 0.0176
NP_441878.1_6 Reverse -361 -371 -7.19813 0.21
NP_441036.1_3 Reverse -324 -343 -1.18052 0.198
NP_441036.1_8 Forward -334 -324 15.713 0.00724
NP_441036.1_8 Reverse -323 -333 8.33817 0.174
NP_441557.1_5 Forward -333 -324 19.9609 0.000699
NP_441557.1_5 Reverse -324 -333 19.9609 0.000699
NP_441590.1_4 Reverse -261 -280 11.405 0.249
NP_441433.1_8 Reverse -324 -343 -1.86883 0.263
NP_442419.1_2 Forward -249 -230 3.93269 0.19
NP_440101.1_10 Reverse -224 -243 4.12936 0.225
NP_442183.1_1 Forward -333 -319 8.25939 0.119
NP_442347.1_2 Forward -332 -323 12.4878 0.056
NP_442347.1_2 Reverse -325 -334 3.34298 0.284
NP_442645.1_2 Reverse -316 -335 -21.83 0.29
NP_441037.1_4 Reverse -322 -332 7.9999 0.237
NP_441037.1_4 Forward -335 -325 7.22024 0.237
NP_441633.1_3 Reverse -322 -335 1.10092 0.109
NP_441633.1_3 Forward -335 -322 -3.71729 0.177
NP_441633.1_3 Forward -255 -242 -4.7006 0.209
NP_440136.1_2 Forward -332 -325 15.9687 0.0123
NP_440136.1_2 Reverse -325 -332 15.9687 0.0123
NP_442998.1_5 Reverse -8 -18 11.8781 0.176
NP_442998.1_5 Forward -48 -38 8.33817 0.264
NP_442998.1_10 Forward -331 -324 15.5754 0.0102
NP_442998.1_10 Reverse -326 -333 15.5754 0.0102
NP_440299.1_1 Reverse -320 -333 13.0967 0.0319
NP_441799.1_1 Reverse -320 -334 14.5519 0.0228
NP_441799.1_1 Forward -337 -323 14.3553 0.0242
NP_441799.1_1 Reverse -66 -80 5.01387 0.227
NP_442802.1_2 Forward -251 -232 11.995 0.298
NP_442504.1_4 Forward -28 -9 5.36764 0.114
NP_441007.1_10 Forward -338 -325 1.39592 0.203
NP_440256.1_1 Reverse -321 -340 4.22769 0.0459
NP_440256.1_1 Forward -336 -317 -0.983855 0.0988
NP_441362.1_5 Forward -29 -11 14.4905 0.144
NP_442904.1_5 Reverse -194 -208 19.7641 0.249
NP_441559.1_8 Forward -338 -324 1.47456 0.155
NP_440915.1_6 Reverse -320 -334 2.94952 0.11
NP_440915.1_6 Forward -337 -323 1.08123 0.147
NP_442785.1_7 Forward -335 -321 10.7177 0.228
NP_441464.1_8 Forward -333 -319 3.93283 0.283
NP_440026.1_7 Forward -338 -323 15.7129 0.188
NP_440695.1_6 Forward -19 -5 10.5083 0.265
NP_441939.1_3 Reverse -325 -344 12.6841 0.0997
NP_440677.1_6 Reverse -372 -391 11.8975 0.211
NP_442386.1_9 Reverse -323 -332 13.8639 0.0289
NP_442386.1_9 Forward -245 -236 6.9808 0.219
NP_442386.1_9 Forward -334 -325 6.39082 0.219
NP_441340.1_5 Forward -332 -325 15.6737 0.0124
NP_441340.1_5 Reverse -325 -332 15.6737 0.0124
NP_440168.1_4 Reverse -72 -91 -5.60541 0.255
NP_440327.1_6 Reverse -313 -332 5.99764 0.249
NP_442240.1_2 Reverse -325 -344 -10.817 0.137
NP_442950.1_1 Forward -28 -9 -1.08219 0.206
NP_441160.1_5 Forward -264 -245 -5.80207 0.288
NP_440586.1_1 Forward -95 -76 6.4893 0.182
NP_440586.1_8 Forward -332 -325 13.2151 0.026
NP_440586.1_8 Reverse -325 -332 13.2151 0.026
NP_442251.1_6 Forward -332 -325 15.2804 0.0124
NP_442251.1_6 Reverse -325 -332 15.2804 0.0124
NP_440192.1_4 Reverse -233 -252 9.30058 0.279
NP_442959.1_5 Reverse -287 -306 5.80098 0.268
NP_440684.1_9 Reverse -318 -332 11.7993 0.168
NP_441262.1_3 Reverse -324 -331 14.7888 0.0223
NP_441262.1_3 Forward -333 -326 14.7888 0.0223
NP_440027.1_3 Reverse -261 -279 8.47483 0.193
NP_440027.1_3 Forward -370 -352 4.04996 0.262
NP_440027.1_8 Reverse -321 -340 5.01354 0.285
NP_443051.1_1 Forward -334 -325 19.5676 0.00335
NP_443051.1_1 Reverse -323 -332 10.4228 0.00754
NP_441232.1_10 Reverse -313 -332 4.52268 0.195
NP_439937.1_9 Forward -255 -238 -12.6465 0.274
NP_440439.1_1 Forward -336 -323 10.934 0.0339
NP_439943.1_4 Forward -98 -79 8.45592 0.256
NP_439943.1_7 Reverse -319 -338 10.3242 0.167
NP_440372.1_2 Forward -332 -325 16.3621 0.0124
NP_440372.1_2 Reverse -325 -332 16.3621 0.0124
NP_441572.1_7 Forward -339 -320 -3.63879 0.217
NP_440267.1_2 Forward -338 -324 20.5501 0.00946
NP_442384.1_10 Reverse -324 -337 9.95071 0.047
NP_442384.1_10 Forward -333 -320 8.77074 0.0608
NP_441018.1_7 Forward -95 -76 20.8456 0.0268
NP_442790.1_4 Reverse -315 -334 -15.5368 0.294
NP_442262.1_10 Forward -332 -325 14.1988 0.0123
NP_442262.1_10 Reverse -325 -332 14.1988 0.0123
NP_441689.1_5 Forward -335 -325 8.3377 0.132
NP_441689.1_5 Reverse -322 -332 5.78111 0.197
NP_440531.1_6 Forward -341 -322 -5.11376 0.293
NP_440562.1_1 Forward -400 -381 11.2084 0.276
NP_440562.1_10 Reverse -315 -333 8.96727 0.284
NP_441965.1_10 Reverse -321 -337 2.32015 0.288
NP_441965.1_10 Forward -82 -66 2.12349 0.289
NP_440297.1_9 Reverse -311 -321 0.0783647 0.282
NP_440297.1_9 Forward -332 -322 -0.118297 0.282
NP_440297.1_9 Reverse -325 -335 -0.216628 0.282
NP_441592.1_4 Forward -333 -314 -3.83545 0.29
NP_440999.1_9 Forward -337 -323 0.687908 0.177
NP_440888.1_2 Reverse -324 -338 13.2736 0.0307
NP_440888.1_2 Forward -333 -319 8.06211 0.172
NP_442454.1_2 Reverse -8 -27 6.63627 0.291
NP_440792.1_5 Forward -332 -313 16.6174 0.113
NP_440600.1_4 Reverse -316 -334 -0.669169 0.155
NP_442948.1_2 Reverse -323 -342 6.88262 0.229
NP_440575.1_1 Reverse -13 -32 -1.8696 0.29
NP_441543.1_2 Forward -332 -323 16.9127 0.00359
NP_441543.1_2 Reverse -325 -334 15.9293 0.00518
NP_442845.1_2 Reverse -304 -318 5.99778 0.219
NP_441469.1_8 Forward -334 -325 6.5879 0.227
NP_441469.1_8 Reverse -323 -332 6.48957 0.227
NP_443064.1_6 Forward -333 -323 12.5669 0.0796
NP_443064.1_6 Reverse -324 -334 10.8217 0.13
NP_442578.1_7 Forward -332 -325 14.5921 0.026
NP_442578.1_7 Reverse -325 -332 14.5921 0.026
NP_441462.1_2 Reverse -324 -334 20.2362 0.000805
NP_441462.1_2 Forward -333 -323 11.5831 0.00406
NP_441462.1_5 Forward -50 -31 7.27595 0.213
NP_441621.1_7 Reverse -233 -247 -3.34366 0.188
NP_441621.1_7 Reverse -322 -336 -5.21195 0.248
NP_441929.1_3 Reverse -9 -28 2.55606 0.266
NP_443062.1_1 Reverse -324 -342 8.2534 0.157
NP_443062.1_6 Forward -99 -80 2.45773 0.255
NP_441410.1_4 Reverse -296 -315 7.4718 0.297
NP_442204.1_1 Forward -337 -326 11.3667 0.0565
NP_441560.1_8 Reverse -239 -258 12.7787 0.248
NP_440504.1_6 Forward -26 -8 11.0314 0.0768
NP_440516.1_8 Forward -333 -324 16.9127 0.00442
NP_440516.1_8 Reverse -324 -333 16.9127 0.00442
NP_442428.1_5 Forward -332 -325 15.8704 0.0124
NP_442428.1_5 Reverse -325 -332 15.8704 0.0124
NP_440673.1_3 Forward -331 -324 12.4288 0.0426
NP_440673.1_3 Reverse -326 -333 12.4288 0.0426
NP_441052.1_2 Forward -333 -323 19.9412 0.00106
NP_441052.1_2 Reverse -324 -334 10.4031 0.0285
NP_440992.1_2 Reverse -377 -396 9.0459 0.273
NP_442219.1_8 Reverse -314 -333 13.6752 0.152
NP_442219.1_9 Forward -332 -323 17.7976 0.00718
NP_442219.1_9 Reverse -325 -334 8.25953 0.0681
NP_440436.1_4 Forward -332 -323 17.2072 0.00233
NP_440436.1_4 Reverse -325 -334 9.24241 0.0871
NP_441884.1_8 Forward -287 -268 -7.17871 0.247
NP_442086.1_3 Reverse -325 -344 8.25926 0.235
NP_442864.1_3 Reverse -318 -337 9.83255 0.195
NP_440314.1_9 Forward -332 -313 9.0459 0.0343
NP_441719.1_4 Forward -332 -325 16.3621 0.0124
NP_441719.1_4 Reverse -325 -332 16.3621 0.0124
NP_442366.1_3 Reverse -323 -341 -5.88071 0.298
NP_442366.1_5 Reverse -321 -331 15.4175 0.0374
NP_441437.1_1 Forward -274 -255 7.96426 0.265
NP_442139.1_7 Forward -96 -77 12.5858 0.174
NP_440328.1_4 Reverse -318 -337 2.16274 0.209
NP_440094.1_9 Forward -92 -73 -1.37718 0.199
NP_443054.1_2 Forward -335 -321 -0.393733 0.294
NP_441851.1_3 Forward -281 -262 10.7175 0.253
NP_441851.1_10 Reverse -323 -333 15.8113 0.00552
NP_441851.1_10 Forward -334 -324 8.53483 0.114
NP_441851.1_10 Reverse -243 -253 4.99491 0.233
NP_442515.1_1 Forward -334 -320 3.44117 0.119
NP_442515.1_1 Reverse -323 -337 3.04785 0.125
NP_442689.1_8 Reverse -3 -20 -2.81276 0.235
NP_441349.1_10 Forward -343 -324 15.9291 0.0116
NP_441349.1_10 Reverse -314 -333 -8.35868 0.274
NP_441409.1_6 Forward -339 -320 -14.3569 0.255
NP_440432.1_9 Reverse -325 -340 4.20813 0.0746
NP_440432.1_9 Forward -332 -317 0.471552 0.159
NP_442843.1_1 Forward -332 -313 -11.3086 0.288
NP_442843.1_6 Forward -95 -76 2.16274 0.29
NP_440431.1_3 Reverse -69 -88 -9.53865 0.25
NP_442450.1_5 Reverse -322 -332 7.55152 0.13
NP_440588.1_2 Forward -342 -323 6.78429 0.0535
NP_442243.1_1 Forward -339 -321 12.0147 0.112
NP_441570.1_1 Forward -333 -315 -17.8771 0.295
NP_441078.1_4 Forward -333 -324 19.6659 0.0007
NP_441078.1_4 Reverse -324 -333 19.6659 0.0007
NP_442348.1_2 Reverse -381 -390 11.4061 0.235
NP_440707.1_6 Forward -341 -322 11.6017 0.254
NP_440526.1_3 Forward -332 -321 1.04151 0.267
NP_441432.1_8 Reverse -323 -332 16.8143 0.00595
NP_441432.1_8 Forward -334 -325 16.8143 0.00595
NP_441432.1_8 Reverse -188 -197 2.75299 0.287
NP_441432.1_9 Reverse -43 -56 14.7067 0.14
NP_442320.1_8 Reverse -318 -332 3.63784 0.0578
NP_442320.1_8 Forward -339 -325 -2.95034 0.1
NP_442344.1_7 Forward -332 -313 -4.42544 0.168
NP_441732.1_2 Forward -337 -321 -6.7263 0.0495
NP_440760.1_1 Forward -333 -314 -21.4367 0.237
NP_440199.1_4 Reverse -2 -20 14.0393 0.203
NP_442489.1_7 Forward -333 -324 20.1576 0.000695
NP_442489.1_7 Reverse -324 -333 20.1576 0.000695
NP_442079.1_7 Forward -332 -313 -0.295539 0.29
NP_440559.1_1 Forward -332 -323 17.4043 0.00658
NP_440559.1_1 Reverse -325 -334 8.65285 0.0586
NP_441659.2_8 Reverse -324 -334 20.9245 0.000805
NP_441659.2_8 Forward -333 -323 18.1713 0.00133
NP_440426.1_7 Forward -343 -324 0.884433 0.256
NP_442913.1_10 Reverse -315 -334 -2.26216 0.183
NP_442913.1_10 Forward -342 -323 -3.04881 0.198
NP_439912.1_6 Forward -199 -181 13.6872 0.227
NP_442346.1_5 Reverse -323 -333 16.6963 0.00248
NP_442346.1_5 Forward -334 -324 16.303 0.00248
NP_442346.1_5 Forward -80 -70 4.40493 0.29
NP_440545.1_3 Reverse -320 -337 1.90713 0.11
NP_441856.1_3 Reverse -321 -340 -1.47551 0.239
NP_441856.1_8 Forward -252 -233 17.109 0.179
NP_440555.1_1 Reverse -313 -332 0.786102 0.294
NP_441653.1_2 Reverse -71 -90 2.27338 0.295
NP_440010.1_4 Reverse -72 -91 4.42355 0.22
NP_440010.1_6 Reverse -313 -332 5.70265 0.231
NP_440010.1_10 Reverse -312 -331 6.39097 0.226
NP_442311.1_8 Forward -248 -229 15.3391 0.122
NP_441833.1_4 Forward -332 -325 15.9687 0.0124
NP_441833.1_4 Reverse -325 -332 15.9687 0.0124
NP_442799.1_8 Forward -37 -18 10.6204 0.172
NP_441329.1_6 Forward -38 -19 6.44528 0.179
NP_441329.1_6 Forward -57 -38 -2.0535 0.293
NP_441895.1_10 Forward -44 -25 -18.5851 0.282
NP_441895.1_10 Forward -61 -42 -27.8282 0.299
NP_442162.1_9 Forward -332 -325 16.2637 0.0124
NP_442162.1_9 Reverse -325 -332 16.2637 0.0124
NP_440671.1_4 Forward -339 -325 5.50613 0.281
NP_440224.1_1 Forward -344 -325 2.26107 0.132
NP_442073.1_6 Forward -342 -323 -0.787193 0.269
NP_442199.1_5 Forward -341 -322 7.37428 0.0719
NP_442140.1_3 Forward -332 -322 12.2714 0.0632
NP_442140.1_3 Reverse -325 -335 4.69992 0.238
NP_442914.1_4 Reverse -47 -66 13.175 0.205
NP_440875.1_9 Reverse -326 -336 16.5483 0.0145
NP_441813.1_5 Forward -335 -325 18.1713 0.00743
NP_441813.1_5 Reverse -322 -332 8.63316 0.0367
NP_440590.1_4 Forward -332 -319 0.707601 0.144
NP_440590.1_4 Reverse -325 -338 -5.38892 0.277
NP_440567.1_1 Forward -332 -318 3.53951 0.141
NP_440567.1_1 Reverse -325 -339 1.86788 0.191
NP_442497.1_10 Reverse -325 -334 17.601 0.00813
NP_442497.1_10 Forward -332 -323 10.4228 0.0087
NP_440821.1_4 Reverse -322 -332 9.41981 0.0286
NP_440821.1_4 Forward -335 -325 2.24165 0.131
NP_441239.1_9 Forward -335 -323 13.0187 0.0389
NP_441239.1_9 Reverse -308 -320 4.5622 0.251
NP_441239.1_9 Reverse -322 -334 3.38223 0.285
NP_442691.1_2 Reverse -258 -277 13.6675 0.0919
NP_442669.1_1 Forward -70 -51 31.7604 0.00000199
NP_442193.1_1 Forward -91 -73 7.09898 0.298
NP_442270.1_9 Reverse -313 -332 -10.0303 0.249
NP_441526.1_6 Reverse -233 -252 7.17762 0.258
NP_440546.1_4 Reverse -324 -334 13.5365 0.0459
NP_440546.1_4 Forward -333 -323 10.046 0.109
NP_440675.1_3 Forward -201 -182 5.80098 0.277
NP_440462.1_4 Reverse -234 -248 9.5377 0.243
NP_440462.1_6 Forward -335 -325 18.7612 0.00454
NP_440462.1_6 Reverse -322 -332 1.35667 0.294
NP_440868.1_4 Forward -337 -325 14.7886 0.0169
NP_440868.1_4 Reverse -320 -332 5.84051 0.0879
NP_442787.1_6 Reverse -375 -394 18.7807 0.08
NP_442479.1_5 Reverse -29 -48 7.48109 0.222
NP_442402.1_4 Forward -341 -322 -8.85106 0.284
NP_441848.1_4 Forward -45 -29 8.50558 0.288
NP_441848.1_4 Reverse -1 -17 7.55067 0.288
NP_441084.1_6 Forward -335 -321 17.1007 0.0523
NP_440696.1_3 Forward -280 -262 1.10079 0.22
NP_442039.1_4 Forward -332 -325 15.1821 0.0124
NP_442039.1_4 Reverse -325 -332 15.1821 0.0124
NP_440232.1_2 Forward -60 -41 -2.55715 0.171
NP_440825.1_7 Forward -332 -322 12.9096 0.152
NP_442837.1_3 Forward -332 -325 15.7721 0.0124
NP_442837.1_3 Reverse -325 -332 15.7721 0.0124
NP_442053.1_1 Forward -333 -324 18.3876 0.0007
NP_442053.1_1 Reverse -324 -333 18.3876 0.0007
NP_440505.1_3 Forward -335 -325 17.188 0.00332
NP_440505.1_3 Reverse -322 -332 9.22315 0.122
NP_440505.1_7 Reverse -317 -336 1.57275 0.249
NP_442532.1_1 Forward -27 -13 12.2515 0.215
NP_442532.1_4 Reverse -1 -19 12.5219 0.215
NP_440914.1_1 Forward -333 -323 17.5935 0.000537
NP_440914.1_1 Reverse -324 -334 16.3248 0.00196
NP_441011.1_8 Reverse -325 -334 16.6177 0.00602
NP_441011.1_8 Forward -332 -323 8.25953 0.144
NP_442101.1_10 Reverse -316 -335 -8.85033 0.242
NP_442101.1_10 Forward -341 -322 -13.5702 0.297
NP_442533.1_6 Forward -333 -324 17.2076 0.00137
NP_442533.1_6 Reverse -324 -333 17.2076 0.00137
NP_442533.1_6 Reverse -189 -198 2.458 0.255
NP_442533.1_6 Forward -319 -310 1.96635 0.28
NP_440854.1_2 Forward -38 -19 8.65258 0.26
NP_443016.1_1 Reverse -318 -337 4.12936 0.134
NP_441482.1_7 Forward -339 -325 -2.85201 0.1
NP_439944.1_9 Forward -332 -322 10.5014 0.0887
NP_439944.1_9 Reverse -325 -335 9.12481 0.1
NP_441697.1_5 Forward -20 -1 -10.6478 0.28
NP_440816.1_2 Forward -33 -14 13.2118 0.157
NP_440816.1_2 Forward -310 -291 6.33814 0.281
NP_441028.1_6 Reverse -23 -33 5.19112 0.265
NP_442202.1_10 Forward -246 -232 15.5359 0.138
NP_440116.1_8 Forward -332 -313 0.982764 0.0929
NP_441527.1_4 Forward -36 -17 4.24897 0.111
NP_441527.1_4 Forward -37 -18 -0.812105 0.146
NP_440115.1_6 Forward -336 -326 14.0414 0.0615
NP_440007.1_4 Forward -344 -325 19.3707 0.0716
NP_440007.1_9 Forward -337 -323 0.786239 0.29
NP_441106.1_1 Forward -334 -325 18.486 0.0028
NP_441106.1_1 Reverse -323 -332 9.63616 0.0311
NP_441825.1_4 Reverse -381 -391 12.4681 0.252
NP_439903.1_6 Forward -336 -317 4.03023 0.203
NP_442306.1_10 Forward -338 -319 -19.0768 0.197
NP_441286.1_1 Reverse -323 -335 5.93884 0.0258
NP_441286.1_1 Forward -334 -322 3.48056 0.0467
NP_440670.1_8 Forward -333 -324 18.3876 0.000699
NP_440670.1_8 Reverse -324 -333 18.3876 0.000699
NP_442881.1_3 Forward -246 -227 13.2733 0.283
NP_441705.1_3 Reverse -310 -329 1.0811 0.244
NP_440886.1_7 Forward -334 -324 8.04271 0.0805
NP_440886.1_7 Reverse -323 -333 7.94438 0.0805
NP_440028.1_6 Forward -324 -306 11.4255 0.261
NP_442125.1_2 Forward -42 -23 27.2371 0.000283
NP_440907.2_8 Reverse -325 -335 9.616 0.103
NP_440907.2_8 Forward -332 -322 7.64939 0.117
NP_441021.1_1 Forward -332 -313 -11.1119 0.257
NP_441021.1_8 Reverse -202 -220 7.39397 0.188
NP_440841.1_4 Reverse -322 -341 -5.80207 0.208
NP_441463.1_3 Reverse -314 -333 -7.76869 0.261
NP_441626.1_2 Forward -332 -325 15.7721 0.0124
NP_441626.1_2 Reverse -325 -332 15.7721 0.0124
NP_442794.1_1 Reverse -320 -332 9.38042 0.0795
NP_441401.1_5 Forward -321 -302 10.4559 0.297
NP_442615.1_1 Forward -342 -324 13.8838 0.0109
NP_442615.1_1 Reverse -315 -333 4.9357 0.0418
NP_440387.1_1 Forward -333 -317 15.2998 0.00554
NP_441431.1_2 Forward -336 -322 16.0269 0.04
NP_441431.1_8 Forward -279 -260 17.994 0.215
NP_441993.1_1 Reverse -318 -337 5.94244 0.192
NP_441993.1_1 Reverse -224 -243 1.84923 0.269
NP_440114.1_10 Reverse -324 -338 10.3243 0.148
NP_440114.1_10 Forward -333 -319 5.80112 0.292
NP_440293.1_3 Forward -282 -263 -6.39206 0.288
NP_439988.1_3 Reverse -231 -245 5.70279 0.278
NP_441237.1_9 Forward -332 -322 14.828 0.0242
NP_442930.1_1 Forward -19 -9 13.0576 0.239
NP_441133.1_1 Forward -276 -257 13.7658 0.24
NP_441133.1_1 Reverse -350 -369 12.1925 0.271
NP_442867.1_3 Reverse -8 -27 3.04771 0.193
NP_440457.1_1 Forward -337 -325 0.727295 0.25
NP_440798.1_1 Forward -19 -1 10.3485 0.294
NP_440798.1_6 Reverse -325 -338 10.5407 0.074
NP_440801.1_8 Forward -378 -359 7.96426 0.144
NP_440801.1_8 Forward -334 -315 3.53937 0.226
NP_441332.1_6 Forward -246 -236 10.9691 0.278
NP_441436.1_8 Reverse -323 -342 7.66927 0.293
NP_440473.1_1 Forward -336 -317 19.934 0.0285
NP_442509.1_9 Reverse -164 -174 9.321 0.192
NP_442509.1_9 Forward -333 -323 8.14104 0.192
NP_442509.1_9 Reverse -324 -334 8.04271 0.192
NP_442514.1_5 Reverse -259 -278 1.76863 0.178
NP_440554.1_4 Reverse -325 -335 17.9746 0.0131
NP_442737.1_5 Forward -92 -73 16.8542 0.116
NP_442737.1_5 Forward -80 -61 11.6185 0.284
NP_441885.1_5 Forward -333 -323 20.9245 0.000538
NP_441885.1_5 Reverse -324 -334 11.3864 0.00668
NP_441614.1_6 Reverse -184 -203 15.9282 0.275
NP_442341.1_9 Forward -335 -321 12.6836 0.0984
NP_442534.1_7 Forward -327 -308 8.65258 0.238
NP_440191.1_4 Reverse -25 -35 13.0511 0.282
NP_443000.1_7 Forward -335 -325 20.3345 0.00223
NP_443000.1_7 Reverse -322 -332 10.3048 0.0345
NP_441842.1_10 Reverse -317 -331 9.34103 0.192
NP_441842.1_10 Forward -86 -72 6.78443 0.272
NP_440275.1_3 Forward -335 -325 16.1063 0.0155
NP_440275.1_3 Reverse -322 -332 8.04317 0.0602
NP_440091.1_1 Reverse -320 -332 -0.452677 0.273
NP_441207.1_7 Forward -306 -292 12.6438 0.241
NP_440149.1_8 Forward -325 -306 -6.29373 0.246
NP_440149.1_8 Forward -333 -314 -6.88371 0.265
NP_441105.1_3 Forward -344 -325 1.27776 0.115
NP_441105.1_3 Reverse -299 -318 -4.03212 0.19
NP_441105.1_3 Forward -96 -77 -5.01543 0.211
NP_441105.1_3 Reverse -71 -90 -7.37537 0.251
NP_440216.1_1 Reverse -324 -338 24.9757 0.000528
NP_440216.1_1 Forward -333 -319 -2.75368 0.0574
NP_440172.1_1 Reverse -324 -334 17.5813 0.00421
NP_440172.1_1 Forward -333 -323 15.0247 0.00945
NP_440172.1_1 Forward -79 -69 2.83163 0.264
NP_442371.1_1 Reverse -333 -343 14.0409 0.191
NP_442418.1_4 Forward -22 -4 12.6069 0.217
NP_442788.1_4 Reverse -375 -394 19.2723 0.0827
NP_442015.1_10 Forward -337 -324 3.75586 0.178
NP_442015.1_10 Reverse -320 -333 1.49425 0.204
NP_441226.1_7 Forward -332 -325 14.4934 0.0123
NP_441226.1_7 Reverse -325 -332 14.4934 0.0123
NP_441111.1_7 Forward -332 -324 18.7023 0.00294
NP_441111.1_7 Reverse -325 -333 18.7023 0.00294
NP_441766.1_2 Forward -333 -324 17.5026 0.00297
NP_441766.1_2 Reverse -324 -333 17.5026 0.00297
NP_442417.1_5 Reverse -324 -338 4.52282 0.292
NP_440416.1_9 Reverse -317 -336 -16.6185 0.218
NP_442403.1_8 Forward -95 -76 6.58763 0.187
NP_442403.1_8 Forward -83 -64 1.47442 0.239
NP_442046.1_2 Reverse -339 -352 19.0633 0.0699
NP_440261.1_5 Reverse -325 -338 6.60746 0.0318
NP_440261.1_5 Forward -252 -239 -3.12731 0.115
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTCAGCATCAGCAAATCCCGTTCCTGGATGGTCAACTCCCACCACAGACTAAAATTAATTTTCACCAGGCGATCGCCAAATTGCCAGGGCTTAGGAAAATCACAATCAATTACCCGGGACTGTTTCGGCTGGGCCTGGAGTTTAACTAGCATCCGCCCCGAAGCCGGCATCAACTCTTTCAGACGACGAACTTCCGTTTCTTGGTCACTGCCTTGATAGGTTCCCTGGCGGTTCATAGTGATTTAAATCTTAGCTAGCATCGACTTCAAGTCTGACACATACTTTCGACAACGTTAAACAATAAATGTTGGCAATTGTTATGGCGATGTTTAAGAGCGTGTTTGAAAAGTAGGGTGAAGAATGGAAAATGGTGAAAAGAATAAAATTTTCACCATAATTA

CDS

ATGATAATTCGAGAATTTTACAGCACGGACATCACAGATAGCCAGTGGCAATTGGTAGAACCCCATTTACCCAAAGCAAAAACTGGGGGAAGAAAACGGAAAACTAGTCTGCGGGAGATACTCAATGCTATTTTTTACATGCTCAGAACGGGGTGTGCCTGGCGACTTCTGCCCCATGATTTTCCTAAATGGCGAACGGTCTATGGTTATTTCCAGCCATGGCACGAAGATGGTACCTGGAAAAAATTAAACCGTATCTTCCGTGAGAAAGTTCGGCTCAAAGCTGGAAGAAATACTCACCCTAGTGCCGGTTGTTTAGATTCACAGTCACTTAAAAAGGCTGGAACTGGCCAAGAAACTGGCTATGACGGCGGAAAAAAGGTCAATGGTCGTAAACGTACAATCCTCGTGGATACCATGGGATTACTTCTCGATGTTGTCGTCCATGGTGCCCATCGCTCCGACCATCAGGGTCTGATTCTACTTGCTACCTGGTTTGCTCCCCTTTGGCAGTGCCTGCAAGTTATATGGACTGATAGCACCTTTGGCGGAAAGGATTTTATCTATTGGGTGGAGCATACTTTTGGTTGGAATTTGAATGTCGTCAGCAAAAAGCAGGGACAAAAAGGTTTTGAAGTCTTACCCCGCCGTTGGGTAGTCGAGCGCACCTTTGCTTGGTTTGGTCGCTATCGTCGTTTAAGCAAGGATTATGAATATTTACCTACCACCAGTGAGACCATGCTCTATGTTGCCATGGTTCATCTCATGCTTCAAAGGCTTGCTTAA

Protein

MIIREFYSTDITDSQWQLVEPHLPKAKTGGRKRKTSLREILNAIFYMLRTGCAWRLLPHDFPKWRTVYGYFQPWHEDGTWKKLNRIFREKVRLKAGRNTHPSAGCLDSQSLKKAGTGQETGYDGGKKVNGRKRTILVDTMGLLLDVVVHGAHRSDHQGLILLATWFAPLWQCLQVIWTDSTFGGKDFIYWVEHTFGWNLNVVSKKQGQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYLPTTSETMLYVAMVHLMLQRLA