Your browser is old and dusty. Try Google Chrome!

Details for slr0347

ORF slr0347
Accession NP_442086.1
Symbol
Category probable permease protein of ABC transporter
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -218 -204 3.34284 0.165
NP_440795.1_7 Forward -218 -211 14.6904 0.0123
NP_440795.1_7 Reverse -211 -218 14.6904 0.0123
NP_440795.1_7 Reverse -205 -212 6.92228 0.26
NP_441418.1_6 Reverse -210 -229 -18.7818 0.0837
NP_441418.1_6 Reverse -159 -178 -30.3848 0.274
NP_440815.1_5 Forward -292 -273 3.6377 0.286
NP_442291.1_5 Forward -220 -204 1.5335 0.144
NP_440897.1_6 Forward -219 -200 -2.75457 0.221
NP_441453.1_1 Forward -226 -208 6.31156 0.239
NP_441453.1_4 Reverse -210 -218 16.539 0.00633
NP_441453.1_4 Forward -219 -211 16.539 0.00633
NP_441453.1_7 Reverse -185 -192 12.1338 0.295
NP_442151.1_6 Forward -219 -205 7.76774 0.19
NP_442151.1_6 Reverse -210 -224 7.66941 0.192
NP_441818.1_1 Forward -218 -207 15.6928 0.0257
NP_441818.1_9 Reverse -172 -191 -3.3438 0.222
NP_441818.1_9 Reverse -305 -324 -10.6203 0.296
NP_440226.1_1 Reverse -210 -229 14.6508 0.0293
NP_440226.1_1 Forward -219 -200 3.6377 0.218
NP_442169.1_1 Reverse -192 -211 0.687771 0.261
NP_441630.1_7 Forward -302 -283 9.93088 0.251
NP_440996.1_3 Forward -232 -214 11.4255 0.23
NP_442173.1_1 Forward -218 -210 15.4574 0.00633
NP_442173.1_1 Reverse -211 -219 15.4574 0.00633
NP_442752.1_4 Forward -219 -212 13.8055 0.0199
NP_442752.1_4 Reverse -210 -217 13.8055 0.0199
NP_442752.1_4 Reverse -191 -198 6.52896 0.154
NP_443027.1_4 Reverse -208 -218 13.1564 0.0521
NP_443027.1_4 Forward -221 -211 5.87989 0.294
NP_439997.1_6 Reverse -45 -64 11.7008 0.212
NP_441812.1_2 Reverse -85 -104 16.9124 0.222
NP_442975.1_10 Forward -223 -209 19.0751 0.00482
NP_440784.1_7 Forward -218 -211 15.9687 0.0123
NP_440784.1_7 Reverse -211 -218 15.9687 0.0123
NP_442909.1_7 Forward -218 -204 12.8803 0.129
NP_440061.1_9 Forward -221 -207 20.8451 0.00314
NP_440061.1_9 Forward -206 -192 6.58715 0.239
NP_440110.1_8 Reverse -306 -325 5.70265 0.162
NP_441054.1_2 Reverse -343 -362 9.53756 0.292
NP_441476.1_5 Forward -224 -205 -3.63879 0.239
NP_441476.1_5 Forward -297 -278 -7.96535 0.295
NP_439979.1_2 Reverse -174 -193 8.35759 0.258
NP_440878.1_9 Forward -229 -210 1.67108 0.177
NP_442062.1_8 Reverse -210 -220 19.4496 0.000558
NP_442062.1_8 Forward -219 -209 17.3846 0.00193
NP_442062.1_8 Reverse -195 -205 8.33817 0.0769
NP_441859.1_3 Reverse -158 -177 9.14342 0.131
NP_440304.1_4 Reverse -208 -218 9.91146 0.051
NP_440304.1_4 Forward -221 -211 1.84832 0.299
NP_442242.1_4 Forward -218 -211 14.3954 0.0124
NP_442242.1_4 Reverse -211 -218 14.3954 0.0124
NP_440044.1_8 Forward -218 -199 10.7175 0.0551
NP_440044.1_8 Forward -188 -169 0.0977854 0.206
NP_441935.1_1 Reverse -196 -215 6.68596 0.264
NP_441208.1_1 Reverse -151 -170 11.6025 0.0848
NP_441208.1_9 Reverse -207 -221 6.78443 0.229
NP_441208.1_9 Reverse -379 -393 5.70279 0.262
NP_441594.1_6 Reverse -201 -220 3.53937 0.227
NP_440370.1_10 Reverse -201 -220 13.4708 0.121
NP_442110.1_1 Reverse -162 -181 19.5326 0.124
NP_442110.1_7 Forward -219 -205 7.07942 0.126
NP_440330.1_2 Reverse -183 -202 21.7306 0.0371
NP_440856.1_4 Reverse -203 -222 -4.32711 0.253
NP_441083.1_5 Forward -219 -209 20.3345 0.00053
NP_441083.1_5 Reverse -210 -220 11.3864 0.0159
NP_442827.1_8 Forward -227 -208 0.981987 0.191
NP_441434.1_7 Reverse -212 -226 11.406 0.13
NP_441738.1_2 Forward -217 -210 15.28 0.0102
NP_441738.1_2 Reverse -212 -219 15.28 0.0102
NP_441738.1_4 Forward -229 -210 4.12936 0.243
NP_441558.1_5 Reverse -208 -227 21.8289 0.00248
NP_441942.1_6 Reverse -203 -222 14.3777 0.245
NP_440209.1_1 Reverse -210 -218 18.1123 0.00295
NP_440209.1_1 Forward -219 -211 18.1123 0.00295
NP_440655.1_10 Forward -363 -344 16.1249 0.259
NP_442136.1_4 Reverse -165 -184 18.0915 0.0954
NP_442889.1_8 Forward -222 -208 11.7003 0.0733
NP_442889.1_8 Reverse -110 -124 4.22722 0.27
NP_441713.1_1 Reverse -204 -223 -9.047 0.164
NP_441770.1_10 Forward -170 -151 10.6192 0.232
NP_440178.1_7 Forward -220 -201 -12.3902 0.121
NP_442570.1_2 Forward -226 -207 11.9958 0.0964
NP_441716.1_1 Forward -219 -205 13.7659 0.0689
NP_443013.1_4 Reverse -278 -297 14.2574 0.178
NP_442111.1_4 Reverse -209 -223 9.2427 0.0619
NP_440906.1_5 Forward -218 -211 15.8704 0.0124
NP_440906.1_5 Reverse -211 -218 15.8704 0.0124
NP_441209.1_8 Reverse -348 -366 13.9163 0.12
NP_440747.1_10 Reverse -207 -219 7.51213 0.00286
NP_440747.1_10 Forward -222 -210 5.34885 0.0141
NP_441130.1_10 Forward -221 -207 11.3077 0.107
NP_441486.1_1 Reverse -207 -221 13.8643 0.00743
NP_441486.1_1 Forward -222 -208 4.81781 0.0406
NP_441014.1_10 Reverse -209 -228 7.66846 0.144
NP_442848.1_1 Reverse -204 -218 14.0609 0.0216
NP_442848.1_4 Reverse -149 -163 10.6193 0.282
NP_442848.1_5 Forward -220 -202 1.39578 0.276
NP_441012.1_4 Forward -76 -63 8.27909 0.272
NP_441012.1_4 Reverse -65 -78 7.88576 0.272
NP_443018.1_3 Forward -218 -211 14.8871 0.0123
NP_443018.1_3 Reverse -211 -218 14.8871 0.0123
NP_443018.1_3 Reverse -114 -121 7.11894 0.16
NP_443018.1_3 Forward -171 -164 6.62729 0.168
NP_441634.1_8 Reverse -208 -222 -2.95034 0.295
NP_441634.1_8 Forward -221 -207 -3.63866 0.295
NP_441634.1_9 Reverse -179 -198 12.0933 0.219
NP_441182.1_3 Reverse -273 -291 12.8022 0.256
NP_440376.1_1 Forward -219 -210 19.4693 0.000692
NP_440376.1_1 Reverse -210 -219 19.4693 0.000692
NP_441588.1_4 Reverse -212 -222 14.238 0.0773
NP_442687.1_7 Forward -220 -210 15.8113 0.0125
NP_442687.1_7 Reverse -209 -219 8.92815 0.0994
NP_441077.1_2 Forward -367 -348 0.429291 0.299
NP_442589.1_5 Reverse -111 -130 13.0775 0.265
NP_442485.1_3 Forward -221 -202 -4.91709 0.286
NP_440781.1_1 Reverse -177 -191 13.1759 0.266
NP_441422.1_7 Forward -221 -204 6.33202 0.0992
NP_441950.1_7 Reverse -276 -295 -0.787193 0.191
NP_442296.1_5 Forward -87 -68 0.196116 0.291
NP_442658.1_1 Forward -221 -211 15.9091 0.00966
NP_442658.1_1 Reverse -208 -218 9.616 0.147
NP_442658.1_1 Forward -206 -196 9.51767 0.151
NP_441855.2_4 Forward -227 -208 10.1015 0.261
NP_441855.2_4 Forward -300 -281 9.52306 0.275
NP_442205.1_9 Reverse -204 -220 -0.728113 0.264
NP_441414.1_9 Reverse -210 -229 -2.26216 0.112
NP_441256.1_8 Reverse -376 -395 5.40766 0.272
NP_442937.1_5 Forward -224 -205 14.6508 0.0737
NP_442937.1_5 Reverse -175 -194 11.5042 0.136
NP_441958.1_5 Forward -220 -210 12.2714 0.00183
NP_441958.1_5 Reverse -209 -219 12.2714 0.00183
NP_440203.1_5 Forward -178 -168 10.1076 0.239
NP_440203.1_5 Forward -216 -206 9.02601 0.275
NP_439905.1_1 Forward -218 -205 10.1474 0.216
NP_440984.1_7 Forward -224 -210 7.76774 0.163
NP_442376.1_2 Reverse -205 -224 -13.1769 0.286
NP_442911.1_2 Reverse -200 -219 -3.24547 0.11
NP_442911.1_2 Forward -229 -210 -9.73531 0.262
NP_441580.1_6 Forward -230 -211 2.0644 0.117
NP_440153.1_5 Forward -218 -204 2.85119 0.219
NP_440153.1_8 Forward -219 -206 5.03416 0.18
NP_443055.1_6 Reverse -202 -220 1.10005 0.237
NP_443055.1_6 Forward -227 -209 -1.9482 0.285
NP_441099.1_5 Reverse -200 -219 -2.75381 0.126
NP_441099.1_5 Forward -191 -172 -6.58872 0.163
NP_441099.1_5 Forward -229 -210 -10.6203 0.258
NP_442002.1_9 Forward -220 -213 10.7572 0.185
NP_442002.1_9 Reverse -158 -165 9.08556 0.289
NP_441294.1_7 Forward -223 -209 11.5544 0.137
NP_441294.1_7 Reverse -206 -220 8.86667 0.274
NP_441646.1_1 Forward -226 -207 0.392778 0.251
NP_442438.1_10 Reverse -205 -219 21.5341 0.01
NP_442431.1_10 Reverse -193 -211 2.0841 0.243
NP_441000.1_6 Forward -220 -206 3.14618 0.118
NP_441000.1_6 Reverse -209 -223 -3.73699 0.225
NP_442771.1_1 Forward -354 -336 -10.4039 0.258
NP_440484.1_3 Reverse -208 -222 10.1277 0.242
NP_441674.1_6 Forward -218 -199 19.174 0.0368
NP_440147.1_4 Forward -221 -208 22.0454 0.00117
NP_440147.1_4 Reverse -208 -221 0.904263 0.244
NP_441175.1_7 Reverse -343 -362 6.09597 0.264
NP_441550.1_8 Reverse -208 -218 16.7941 0.00906
NP_441550.1_8 Forward -221 -211 8.3377 0.124
NP_441916.1_7 Reverse -210 -220 18.4663 0.00144
NP_441916.1_7 Forward -219 -209 10.3048 0.0261
NP_441041.1_4 Reverse -210 -229 -4.13045 0.13
NP_441041.1_7 Forward -222 -210 9.55551 0.109
NP_442396.1_5 Forward -223 -210 9.95071 0.128
NP_442396.1_5 Forward -239 -226 6.4108 0.238
NP_442004.1_6 Forward -219 -205 18.3875 0.0534
NP_442004.1_6 Forward -204 -190 5.70279 0.184
NP_442004.1_6 Reverse -283 -297 5.1128 0.197
NP_442004.1_6 Forward -292 -278 1.96621 0.276
NP_441725.1_4 Forward -173 -159 7.47213 0.23
NP_441725.1_5 Forward -218 -208 9.02648 0.0553
NP_441725.1_5 Reverse -211 -221 2.04498 0.115
NP_439966.1_7 Reverse -208 -218 14.8275 0.0177
NP_439966.1_7 Forward -221 -211 9.91099 0.0968
NP_439966.1_9 Forward -221 -212 0.884706 0.253
NP_439966.1_9 Reverse -208 -217 0.884706 0.253
NP_442941.1_3 Forward -218 -208 10.9931 0.0116
NP_442941.1_3 Reverse -211 -221 2.63497 0.14
NP_440289.1_2 Forward -222 -209 3.06754 0.0811
NP_440289.1_2 Reverse -207 -220 -4.50394 0.288
NP_440983.1_5 Forward -216 -197 8.25926 0.151
NP_440260.1_8 Reverse -201 -219 -3.12744 0.249
NP_440260.1_8 Reverse -322 -340 -4.60241 0.273
NP_441678.1_4 Reverse -154 -173 14.0608 0.16
NP_442281.1_1 Forward -209 -195 7.57046 0.0969
NP_442281.1_1 Forward -224 -210 4.03056 0.21
NP_442281.1_1 Forward -297 -283 1.5723 0.296
NP_441334.1_7 Forward -221 -202 -13.0786 0.188
NP_440177.1_9 Reverse -196 -215 11.6025 0.259
NP_442012.1_1 Reverse -277 -296 14.4541 0.058
NP_442012.1_1 Reverse -204 -223 13.6675 0.058
NP_442012.1_1 Forward -298 -279 -0.787193 0.267
NP_441087.1_6 Forward -353 -335 -1.45654 0.265
NP_441556.1_7 Forward -215 -196 -0.886293 0.3
NP_440498.1_1 Forward -228 -210 -2.83245 0.248
NP_441644.1_6 Forward -219 -209 17.3841 0.00127
NP_441644.1_6 Reverse -210 -220 10.1076 0.0628
NP_442215.1_2 Forward -221 -205 -4.36636 0.232
NP_442029.1_6 Reverse -175 -194 10.3242 0.182
NP_440253.1_2 Reverse -210 -228 2.18243 0.142
NP_440253.1_2 Forward -219 -201 -1.84914 0.252
NP_440929.1_8 Forward -219 -210 19.2726 0.000701
NP_440929.1_8 Reverse -210 -219 19.2726 0.000701
NP_442933.1_10 Forward -219 -210 17.601 0.00325
NP_442933.1_10 Reverse -210 -219 17.601 0.00325
NP_441751.2_8 Forward -218 -204 5.1128 0.0448
NP_442926.1_1 Reverse -178 -197 0.58944 0.23
NP_442554.1_8 Forward -218 -208 18.0729 0.00543
NP_442554.1_8 Reverse -211 -221 13.2547 0.0187
NP_442554.1_8 Forward -77 -67 4.0116 0.2
NP_442863.1_3 Reverse -179 -197 13.1955 0.251
NP_441762.1_7 Forward -220 -208 11.8387 0.0142
NP_441762.1_7 Reverse -209 -221 10.1671 0.0142
NP_441762.1_7 Forward -169 -157 -6.74586 0.284
NP_442142.1_4 Reverse -207 -220 6.90188 0.153
NP_442142.1_4 Forward -222 -209 4.64028 0.214
NP_442142.1_4 Reverse -66 -79 3.26365 0.262
NP_442292.1_1 Forward -218 -209 18.486 0.00229
NP_442292.1_1 Reverse -211 -220 9.63616 0.0183
NP_442476.1_6 Forward -218 -204 20.6491 0.0216
NP_443009.1_5 Reverse -209 -220 18.3477 0.00265
NP_443009.1_5 Forward -293 -282 9.79292 0.0884
NP_443009.1_5 Reverse -282 -293 9.69459 0.0913
NP_443009.1_5 Reverse -194 -205 7.62965 0.124
NP_442301.1_2 Forward -209 -190 11.5033 0.159
NP_442301.1_2 Forward -220 -201 6.09517 0.263
NP_441715.1_4 Reverse -211 -221 9.41981 0.097
NP_441715.1_4 Forward -218 -208 7.84651 0.107
NP_440357.1_3 Forward -221 -202 0.687771 0.28
NP_440357.1_9 Forward -173 -154 19.9606 0.204
NP_441198.1_8 Forward -294 -284 15.2245 0.0427
NP_441198.1_8 Reverse -281 -291 12.1971 0.15
NP_441198.1_8 Reverse -193 -203 11.3181 0.211
NP_440379.1_5 Reverse -201 -220 -10.1286 0.276
NP_441468.1_1 Forward -218 -211 15.8704 0.0124
NP_441468.1_1 Reverse -211 -218 15.8704 0.0124
NP_441020.2_6 Reverse -208 -225 7.61033 0.225
NP_441015.1_10 Reverse -178 -197 0.196116 0.167
NP_441015.1_10 Reverse -205 -224 -1.96717 0.176
NP_441015.1_10 Reverse -175 -194 -2.65548 0.18
NP_441673.1_1 Forward -219 -210 20.8459 0.000698
NP_441673.1_1 Reverse -210 -219 20.8459 0.000698
NP_441826.1_2 Reverse -204 -218 3.14618 0.115
NP_442868.1_6 Reverse -208 -218 17.4829 0.012
NP_442868.1_6 Forward -221 -211 0.865012 0.205
NP_441612.1_2 Forward -219 -209 8.54929 0.21
NP_442427.1_8 Forward -228 -209 11.7992 0.152
NP_442808.1_1 Forward -220 -210 18.4657 0.00201
NP_442808.1_1 Reverse -209 -219 8.63269 0.0481
NP_442808.1_1 Forward -206 -196 1.84789 0.281
NP_442692.1_1 Forward -191 -172 -2.55715 0.274
NP_440145.1_3 Reverse -200 -219 7.7676 0.0466
NP_442050.1_5 Reverse -208 -218 15.6142 0.01
NP_440334.1_2 Reverse -17 -30 14.3756 0.252
NP_440630.1_3 Reverse -193 -212 3.53937 0.224
NP_440558.1_2 Forward -208 -189 9.14423 0.103
NP_440558.1_2 Reverse -201 -220 -0.885524 0.205
NP_440558.1_2 Forward -244 -225 -3.3438 0.234
NP_440558.1_2 Forward -81 -62 -5.40875 0.258
NP_441518.1_3 Reverse -200 -219 -12.5869 0.263
NP_441878.1_6 Forward -220 -210 10.4031 0.0176
NP_441878.1_6 Reverse -209 -219 10.4031 0.0176
NP_441036.1_8 Forward -220 -210 17.7779 0.000554
NP_441036.1_8 Reverse -209 -219 8.33817 0.174
NP_442650.1_2 Forward -219 -205 4.71948 0.163
NP_441557.1_5 Forward -219 -210 19.9609 0.000699
NP_441557.1_5 Reverse -210 -219 19.9609 0.000699
NP_441557.1_9 Reverse -254 -268 17.8958 0.264
NP_441445.1_1 Reverse -201 -220 9.63589 0.104
NP_441445.1_1 Forward -228 -209 2.45773 0.233
NP_441590.1_4 Forward -212 -193 11.0117 0.249
NP_441590.1_4 Forward -208 -189 3.83357 0.29
NP_442419.1_2 Reverse -205 -224 -1.86883 0.246
NP_442183.1_1 Forward -219 -205 5.89945 0.198
NP_441574.1_1 Forward -231 -212 -2.55715 0.226
NP_441574.1_1 Reverse -378 -397 -6.39206 0.277
NP_441574.1_1 Reverse -171 -190 -6.68705 0.277
NP_441549.1_9 Reverse -277 -295 -9.51896 0.252
NP_442347.1_2 Forward -218 -209 12.4878 0.056
NP_442347.1_2 Reverse -211 -220 11.1111 0.056
NP_442347.1_2 Forward -167 -158 3.34298 0.284
NP_442645.1_2 Reverse -202 -221 8.84924 0.0177
NP_441037.1_4 Forward -221 -211 14.7245 0.028
NP_441037.1_4 Reverse -208 -218 9.55921 0.21
NP_442508.1_8 Reverse -270 -287 11.5436 0.256
NP_442317.1_6 Forward -118 -99 3.34271 0.263
NP_441633.1_3 Forward -221 -208 13.1956 0.018
NP_441633.1_3 Reverse -208 -221 1.39592 0.109
NP_440136.1_2 Forward -218 -211 15.9687 0.0123
NP_440136.1_2 Reverse -211 -218 15.9687 0.0123
NP_442998.1_5 Reverse -118 -128 10.1081 0.225
NP_442998.1_10 Forward -217 -210 15.5754 0.0102
NP_442998.1_10 Reverse -212 -219 15.5754 0.0102
NP_440299.1_1 Reverse -206 -219 15.7516 0.0142
NP_440299.1_1 Forward -223 -210 10.9334 0.0529
NP_440299.1_1 Reverse -65 -78 4.05029 0.221
NP_441799.1_1 Reverse -206 -220 17.8952 0.00999
NP_441799.1_1 Forward -223 -209 12.2903 0.0441
NP_441007.1_10 Reverse -205 -218 11.229 0.0646
NP_441007.1_10 Reverse -148 -161 8.57408 0.112
NP_441007.1_10 Reverse -172 -185 -0.865694 0.295
NP_440256.1_1 Reverse -207 -226 -6.78538 0.22
NP_440256.1_1 Reverse -66 -85 -8.06369 0.251
NP_441559.1_8 Forward -209 -195 -5.90027 0.271
NP_441559.1_8 Forward -224 -210 -6.39192 0.277
NP_441559.1_8 Reverse -68 -82 -7.76856 0.299
NP_440915.1_6 Forward -296 -282 5.89945 0.0879
NP_440915.1_6 Reverse -206 -220 2.85119 0.111
NP_441704.1_8 Reverse -199 -218 14.9449 0.096
NP_442069.1_7 Forward -221 -202 10.2251 0.291
NP_442866.1_1 Reverse -178 -197 -3.44213 0.221
NP_440748.1_5 Forward -202 -183 -2.95047 0.286
NP_441464.1_8 Forward -219 -205 10.1277 0.183
NP_441464.1_8 Forward -162 -148 7.86607 0.205
NP_441464.1_8 Reverse -210 -224 4.91614 0.26
NP_441494.1_6 Reverse -190 -203 8.9674 0.227
NP_441494.1_6 Forward -297 -284 6.90245 0.272
NP_442993.1_1 Reverse -210 -226 -8.10294 0.153
NP_440677.1_6 Reverse -60 -79 7.96426 0.277
NP_442386.1_9 Forward -220 -211 15.7322 0.0144
NP_442386.1_9 Reverse -209 -218 13.8639 0.0289
NP_442386.1_9 Forward -205 -196 8.16077 0.209
NP_441340.1_5 Forward -218 -211 15.6737 0.0124
NP_441340.1_5 Reverse -211 -218 15.6737 0.0124
NP_442791.1_5 Reverse -202 -221 -9.44032 0.279
NP_440161.1_3 Reverse -208 -227 10.1275 0.232
NP_440586.1_1 Reverse -140 -159 -6.1954 0.297
NP_440586.1_8 Forward -218 -211 13.2151 0.026
NP_440586.1_8 Reverse -211 -218 13.2151 0.026
NP_440586.1_8 Reverse -70 -77 5.8403 0.283
NP_442251.1_6 Forward -218 -211 15.2804 0.0124
NP_442251.1_6 Reverse -211 -218 15.2804 0.0124
NP_440192.1_4 Forward -221 -202 12.6963 0.169
NP_440192.1_4 Reverse -193 -212 9.20356 0.279
NP_441262.1_3 Reverse -210 -217 14.7888 0.0223
NP_441262.1_3 Forward -219 -212 14.7888 0.0223
NP_440027.1_3 Forward -219 -201 6.90155 0.22
NP_443051.1_1 Reverse -209 -218 10.4228 0.00754
NP_443051.1_1 Forward -220 -211 10.4228 0.00754
NP_441232.1_10 Reverse -199 -218 9.53756 0.133
NP_439937.1_8 Reverse -202 -221 9.24257 0.19
NP_439937.1_9 Forward -293 -276 3.28305 0.0798
NP_439937.1_9 Forward -220 -203 3.08639 0.0798
NP_439937.1_9 Forward -294 -277 -0.158515 0.113
NP_439937.1_9 Reverse -282 -299 -10.5815 0.231
NP_439937.1_9 Forward -206 -189 -14.4164 0.287
NP_439937.1_9 Forward -194 -177 -14.6131 0.287
NP_442294.1_3 Forward -118 -104 14.2569 0.248
NP_441167.1_6 Forward -301 -282 18.5831 0.158
NP_440408.1_7 Forward -62 -43 9.73422 0.255
NP_440626.1_1 Reverse -211 -230 8.94676 0.28
NP_440439.1_1 Reverse -207 -220 10.8357 0.0339
NP_442239.1_8 Reverse -171 -190 5.60432 0.269
NP_440372.1_2 Forward -218 -211 16.3621 0.0124
NP_440372.1_2 Reverse -211 -218 16.3621 0.0124
NP_441181.1_6 Reverse -196 -214 3.75572 0.263
NP_441789.1_7 Forward -209 -190 7.37347 0.193
NP_441789.1_7 Forward -197 -178 -3.63955 0.277
NP_440378.1_7 Forward -183 -164 10.9142 0.274
NP_439977.1_10 Forward -219 -200 13.4708 0.299
NP_441572.1_9 Reverse -29 -48 20.1564 0.0572
NP_440267.1_2 Forward -173 -159 4.91554 0.289
NP_442887.1_5 Forward -86 -67 -11.4069 0.264
NP_442384.1_10 Forward -219 -206 11.9173 0.0319
NP_442384.1_10 Reverse -210 -223 7.09911 0.0875
NP_442384.1_10 Reverse -343 -356 5.03416 0.139
NP_442384.1_10 Forward -78 -65 1.88757 0.243
NP_442085.1_2 Reverse -20 -39 26.1555 0.0022
NP_442085.1_4 Reverse -77 -91 19.3708 0.19
NP_441877.1_7 Forward -197 -178 2.26028 0.233
NP_441877.1_7 Forward -173 -154 2.26028 0.233
NP_441018.1_3 Reverse -51 -70 11.995 0.286
NP_441018.1_7 Reverse -200 -219 10.5209 0.202
NP_442262.1_10 Forward -218 -211 14.1988 0.0123
NP_442262.1_10 Reverse -211 -218 14.1988 0.0123
NP_442262.1_10 Forward -171 -164 10.1672 0.162
NP_442262.1_10 Reverse -114 -121 8.20058 0.25
NP_441689.1_5 Reverse -208 -218 5.87944 0.197
NP_440163.1_10 Reverse -66 -76 14.6313 0.0997
NP_440344.1_10 Forward -226 -209 -0.551145 0.0435
NP_440344.1_10 Reverse -203 -220 -2.12444 0.0609
NP_440344.1_10 Forward -299 -282 -13.0392 0.273
NP_440282.1_10 Forward -88 -69 -9.14533 0.272
NP_440531.1_6 Reverse -202 -221 -0.590531 0.216
NP_440531.1_8 Reverse -178 -197 4.03102 0.269
NP_442910.1_1 Forward -299 -280 -1.57384 0.254
NP_442910.1_1 Reverse -203 -222 -7.08038 0.254
NP_440826.1_5 Forward -57 -39 15.1894 0.231
NP_441965.1_3 Reverse -200 -219 11.7992 0.0966
NP_441965.1_10 Reverse -207 -223 2.12349 0.289
NP_440297.1_9 Reverse -211 -221 -0.118297 0.282
NP_440297.1_9 Forward -218 -208 -0.216628 0.282
NP_440297.1_9 Forward -77 -67 -0.41329 0.283
NP_441592.1_4 Forward -219 -200 -0.0988766 0.237
NP_441896.1_3 Reverse -201 -220 10.2259 0.0847
NP_441896.1_3 Reverse -150 -169 -3.04881 0.294
NP_440937.1_5 Reverse -177 -196 11.5042 0.275
NP_440999.1_9 Forward -193 -179 2.35953 0.151
NP_440888.1_2 Forward -219 -205 18.9768 0.00173
NP_440888.1_2 Reverse -210 -224 8.16044 0.171
NP_440600.1_4 Forward -227 -209 -6.37237 0.285
NP_442033.1_10 Forward -221 -202 -8.65367 0.205
NP_441759.1_2 Reverse -202 -221 1.96607 0.189
NP_441917.1_2 Reverse -193 -211 5.42735 0.288
NP_441543.1_2 Reverse -211 -220 18.486 0.00236
NP_441543.1_2 Forward -218 -209 16.9127 0.00359
NP_442845.1_2 Reverse -204 -218 16.4209 0.0636
NP_442845.1_2 Forward -219 -205 4.32615 0.261
NP_442845.1_2 Reverse -57 -71 3.53951 0.287
NP_441551.1_3 Forward -352 -333 18.7807 0.23
NP_441918.1_7 Reverse -342 -361 8.65258 0.229
NP_441469.1_8 Forward -220 -211 16.126 0.00797
NP_441469.1_8 Reverse -209 -218 6.48957 0.227
NP_442315.1_8 Reverse -346 -360 24.3857 0.00593
NP_443064.1_6 Forward -219 -209 12.5669 0.0796
NP_443064.1_6 Forward -292 -282 8.78555 0.271
NP_442578.1_5 Forward -181 -162 -0.590531 0.3
NP_442578.1_7 Forward -218 -211 14.5921 0.026
NP_442578.1_7 Reverse -211 -218 14.5921 0.026
NP_440710.1_1 Forward -207 -189 -2.43913 0.191
NP_440220.1_4 Forward -38 -19 -2.45958 0.271
NP_441462.1_2 Forward -219 -209 11.5831 0.00406
NP_441462.1_2 Reverse -210 -220 11.5831 0.00406
NP_441621.1_7 Reverse -208 -222 -3.24533 0.188
NP_441621.1_7 Forward -221 -207 -3.34366 0.188
NP_443062.1_1 Forward -122 -104 7.57085 0.172
NP_443062.1_1 Reverse -210 -228 4.35311 0.264
NP_440519.1_8 Reverse -190 -206 7.43336 0.202
NP_440519.1_8 Reverse -178 -194 6.45005 0.21
NP_442204.1_1 Reverse -339 -350 -0.432984 0.299
NP_440516.1_2 Forward -225 -207 -2.43913 0.299
NP_440516.1_8 Forward -219 -210 16.9127 0.00442
NP_440516.1_8 Reverse -210 -219 16.9127 0.00442
NP_442428.1_5 Forward -218 -211 15.8704 0.0124
NP_442428.1_5 Reverse -211 -218 15.8704 0.0124
NP_441443.1_7 Forward -309 -290 -3.24547 0.288
NP_442823.1_8 Reverse -69 -88 15.6341 0.188
NP_440673.1_2 Reverse -200 -219 19.7546 0.0396
NP_440673.1_3 Forward -217 -210 12.4288 0.0426
NP_440673.1_3 Reverse -212 -219 12.4288 0.0426
NP_440673.1_3 Forward -166 -159 7.51227 0.252
NP_440077.1_5 Reverse -323 -342 16.2241 0.145
NP_441052.1_2 Forward -219 -209 19.9412 0.00106
NP_441052.1_2 Reverse -210 -220 10.5014 0.0285
NP_442219.1_8 Reverse -200 -219 13.6752 0.152
NP_442219.1_9 Forward -218 -209 17.7976 0.00718
NP_442219.1_9 Reverse -211 -220 8.35786 0.0681
NP_440436.1_4 Reverse -211 -220 18.1905 0.00233
NP_440436.1_4 Forward -218 -209 17.2072 0.00233
NP_441884.1_9 Forward -222 -203 -12.3902 0.138
NP_442086.1_3 Forward -218 -199 16.4207 0.0667
NP_442086.1_4 Forward -71 -52 17.5874 0.209
NP_442086.1_10 Forward -288 -270 21.2586 0.0289
NP_441719.1_4 Forward -218 -211 16.3621 0.0124
NP_441719.1_4 Reverse -211 -218 16.3621 0.0124
NP_441733.1_8 Reverse -192 -211 11.2092 0.274
NP_441733.1_10 Reverse -207 -220 10.639 0.106
NP_441004.1_1 Reverse -201 -220 -9.24366 0.206
NP_442366.1_5 Forward -222 -212 13.3526 0.0775
NP_440296.1_4 Reverse -185 -204 17.5811 0.183
NP_443054.1_2 Reverse -208 -222 1.86788 0.245
NP_441851.1_10 Forward -220 -210 16.008 0.00552
NP_441851.1_10 Reverse -209 -219 15.8113 0.00552
NP_441851.1_10 Reverse -282 -292 13.8447 0.0266
NP_442622.1_5 Forward -221 -202 -4.52377 0.2
NP_441501.1_6 Forward -214 -195 16.6174 0.27
NP_442515.1_1 Reverse -209 -223 5.40779 0.107
NP_442515.1_1 Forward -220 -206 2.5562 0.133
NP_441396.1_5 Reverse -277 -286 8.65285 0.21
NP_441396.1_5 Reverse -276 -285 7.37455 0.279
NP_440593.1_3 Reverse -205 -224 -5.70374 0.264
NP_441349.1_10 Reverse -200 -219 -5.01543 0.189
NP_441409.1_6 Reverse -259 -278 -9.047 0.178
NP_440389.1_2 Reverse -210 -229 11.7008 0.287
NP_440432.1_9 Reverse -211 -226 -1.39674 0.167
NP_442843.1_1 Reverse -211 -230 1.57275 0.165
NP_442843.1_1 Reverse -136 -155 -11.9969 0.296
NP_442843.1_6 Reverse -18 -37 2.65439 0.29
NP_439960.1_10 Forward -196 -178 -2.14413 0.25
NP_440474.1_8 Forward -218 -204 6.68548 0.22
NP_442450.1_5 Forward -221 -211 7.55152 0.13
NP_442168.1_5 Forward -218 -199 -1.18052 0.264
NP_440588.1_2 Reverse -201 -220 -1.47551 0.155
NP_439950.1_1 Reverse -381 -390 13.1761 0.277
NP_442006.1_2 Reverse -369 -386 -17.2674 0.271
NP_442006.1_3 Reverse -166 -184 -5.48739 0.298
NP_441003.1_9 Forward -355 -336 10.2259 0.213
NP_441570.1_1 Forward -219 -201 -6.56903 0.0807
NP_441570.1_1 Reverse -190 -208 -8.63398 0.117
NP_441570.1_1 Reverse -210 -228 -14.3372 0.226
NP_441078.1_4 Forward -219 -210 19.6659 0.0007
NP_441078.1_4 Reverse -210 -219 19.6659 0.0007
NP_442729.1_5 Reverse -68 -78 7.84651 0.261
NP_442729.1_8 Reverse -222 -235 4.93583 0.273
NP_442443.1_1 Forward -342 -323 -3.83545 0.267
NP_442443.1_1 Forward -299 -280 -6.88371 0.299
NP_440526.1_3 Forward -218 -207 10.6779 0.0646
NP_441432.1_8 Reverse -209 -218 16.8143 0.00595
NP_441432.1_8 Forward -220 -211 8.25953 0.0755
NP_443024.1_3 Reverse -193 -203 10.2065 0.289
NP_442320.1_8 Reverse -204 -218 7.76774 0.0186
NP_442320.1_8 Forward -225 -211 -1.96703 0.0847
NP_442344.1_7 Reverse -211 -230 -6.39206 0.171
NP_441732.1_2 Forward -223 -207 2.91013 0.0145
NP_440760.1_1 Reverse -210 -229 -12.0953 0.091
NP_440760.1_1 Forward -219 -200 -14.4552 0.131
NP_442797.1_7 Reverse -182 -200 8.86894 0.186
NP_442797.1_7 Forward -220 -202 5.32902 0.216
NP_440199.1_10 Reverse -66 -76 6.46988 0.299
NP_441057.1_4 Reverse -21 -39 -0.964162 0.272
NP_442353.1_4 Forward -225 -206 3.73524 0.21
NP_442010.1_1 Forward -139 -121 9.16315 0.246
NP_440713.1_4 Reverse -200 -219 7.17762 0.184
NP_442489.1_7 Forward -219 -210 20.1576 0.000695
NP_442489.1_7 Reverse -210 -219 20.1576 0.000695
NP_442079.1_7 Reverse -211 -230 13.6675 0.079
NP_440559.1_1 Forward -218 -209 17.4043 0.00658
NP_440559.1_1 Reverse -211 -220 8.75118 0.0586
NP_442763.1_10 Forward -297 -278 1.0811 0.282
NP_441659.2_8 Forward -219 -209 18.1713 0.00133
NP_441659.2_8 Reverse -210 -220 11.9764 0.0147
NP_441659.2_8 Forward -327 -317 -0.314959 0.298
NP_441040.1_2 Reverse -29 -48 -15.0452 0.286
NP_441040.1_5 Forward -224 -205 7.07928 0.229
NP_439956.1_7 Reverse -199 -218 1.17943 0.292
NP_441800.1_7 Forward -39 -21 5.52568 0.177
NP_442346.1_5 Reverse -209 -219 16.6963 0.00248
NP_442346.1_5 Reverse -68 -78 12.8614 0.0349
NP_442346.1_5 Forward -220 -210 9.02648 0.118
NP_440545.1_3 Reverse -206 -223 -0.747806 0.157
NP_440545.1_3 Forward -223 -206 -3.40274 0.203
NP_440459.1_2 Reverse -181 -198 8.98696 0.243
NP_440459.1_2 Forward -228 -211 8.69197 0.253
NP_441653.1_2 Forward -230 -211 5.07576 0.248
NP_442027.1_1 Reverse -343 -361 17.286 0.134
NP_441585.1_5 Forward -211 -192 1.6703 0.284
NP_441585.1_5 Forward -88 -69 -0.29631 0.291
NP_441888.1_7 Forward -209 -195 11.0127 0.0977
NP_441948.1_4 Forward -226 -208 15.8504 0.0224
NP_441833.1_4 Forward -218 -211 15.9687 0.0124
NP_441833.1_4 Reverse -211 -218 15.9687 0.0124
NP_442162.1_9 Forward -218 -211 16.2637 0.0124
NP_442162.1_9 Reverse -211 -218 16.2637 0.0124
NP_442404.1_9 Forward -289 -275 8.55376 0.296
NP_442140.1_3 Reverse -211 -221 16.2046 0.0255
NP_442140.1_3 Forward -218 -208 13.5497 0.0542
NP_441696.1_6 Forward -218 -199 1.76941 0.285
NP_441671.1_10 Reverse -199 -218 3.93269 0.219
NP_441671.1_10 Reverse -277 -296 2.75272 0.247
NP_441671.1_10 Reverse -188 -207 0.392778 0.281
NP_441813.1_5 Forward -221 -211 9.91146 0.021
NP_441813.1_5 Reverse -208 -218 8.73149 0.0367
NP_440590.1_4 Forward -218 -205 11.524 0.0197
NP_440590.1_4 Reverse -211 -224 10.4424 0.027
NP_440567.1_1 Forward -218 -204 23.304 0.00964
NP_442497.1_8 Forward -36 -17 14.9449 0.231
NP_442497.1_10 Forward -218 -209 10.4228 0.0087
NP_442497.1_10 Reverse -211 -220 10.4228 0.0087
NP_440821.1_4 Reverse -208 -218 17.9746 0.00497
NP_440821.1_4 Forward -221 -211 10.2065 0.0163
NP_441239.1_9 Forward -221 -209 12.3303 0.0477
NP_441239.1_9 Reverse -208 -220 9.67541 0.0987
NP_441239.1_9 Forward -183 -171 3.18557 0.292
NP_441951.1_9 Forward -121 -102 1.0811 0.254
NP_440400.1_1 Forward -190 -171 -0.689632 0.285
NP_442044.1_1 Forward -297 -278 -3.3438 0.176
NP_442193.1_1 Reverse -192 -210 7.78729 0.28
NP_441017.1_8 Reverse -192 -207 8.92802 0.239
NP_442629.1_3 Reverse -179 -198 10.5209 0.148
NP_440354.1_7 Reverse -204 -222 6.214 0.286
NP_440391.1_5 Forward -193 -174 10.4225 0.188
NP_442809.1_6 Reverse -283 -302 5.70265 0.256
NP_440546.1_4 Reverse -210 -220 11.8882 0.0679
NP_440546.1_4 Reverse -69 -79 10.9186 0.101
NP_440546.1_4 Forward -219 -209 10.046 0.109
NP_440546.1_6 Reverse -200 -219 13.4708 0.195
NP_440462.1_4 Reverse -368 -382 8.75105 0.257
NP_440462.1_6 Reverse -208 -218 10.3048 0.0396
NP_440462.1_6 Forward -221 -211 9.02648 0.0498
NP_440462.1_6 Forward -174 -164 2.43831 0.287
NP_442592.1_3 Reverse -214 -233 23.9922 0.0311
NP_440868.1_4 Reverse -206 -218 17.0502 0.0124
NP_440868.1_4 Forward -223 -211 8.39711 0.0602
NP_442479.1_3 Forward -84 -65 8.06259 0.166
NP_441582.1_5 Reverse -208 -227 3.83357 0.255
NP_441868.1_4 Reverse -203 -217 13.7659 0.282
NP_441868.1_4 Reverse -277 -291 11.5043 0.295
NP_441474.1_1 Forward -210 -191 -3.24622 0.296
NP_442402.1_4 Reverse -78 -97 -7.6711 0.278
NP_439942.1_7 Reverse -269 -288 -0.0988766 0.228
NP_439942.1_7 Reverse -193 -212 -5.60541 0.279
NP_442039.1_4 Forward -218 -211 15.1821 0.0124
NP_442039.1_4 Reverse -211 -218 15.1821 0.0124
NP_441811.1_8 Reverse -204 -218 9.34103 0.227
NP_440825.1_7 Reverse -211 -221 12.4217 0.155
NP_442837.1_3 Forward -218 -211 15.7721 0.0124
NP_442837.1_3 Reverse -211 -218 15.7721 0.0124
NP_442053.1_1 Forward -219 -210 18.3876 0.0007
NP_442053.1_1 Reverse -210 -219 18.3876 0.0007
NP_440505.1_3 Reverse -208 -218 16.598 0.00683
NP_440505.1_3 Forward -221 -211 6.76487 0.169
NP_441701.1_3 Reverse -174 -191 9.18362 0.245
NP_440914.1_1 Forward -219 -209 17.5935 0.000537
NP_440914.1_1 Reverse -210 -220 8.6151 0.186
NP_441011.1_8 Reverse -211 -220 16.9127 0.00602
NP_441011.1_8 Forward -218 -209 8.25953 0.144
NP_442533.1_6 Forward -219 -210 17.2076 0.00137
NP_442533.1_6 Reverse -210 -219 17.2076 0.00137
NP_442533.1_6 Reverse -69 -78 4.62128 0.179
NP_442533.1_6 Forward -72 -63 4.0313 0.194
NP_442533.1_6 Forward -235 -226 1.47469 0.298
NP_442541.1_10 Forward -219 -205 3.63724 0.254
NP_442232.1_3 Reverse -187 -206 -4.6221 0.163
NP_442232.1_3 Reverse -202 -221 -11.6036 0.282
NP_442232.1_3 Reverse -277 -296 -12.7836 0.282
NP_442232.1_3 Reverse -188 -207 -15.2418 0.289
NP_442322.1_4 Forward -208 -191 -6.55 0.277
NP_442229.1_1 Reverse -208 -222 9.53707 0.184
NP_441482.1_7 Forward -225 -211 -10.6202 0.211
NP_439944.1_9 Forward -218 -208 19.1546 0.00329
NP_442202.1_4 Reverse -208 -222 14.0957 0.234
NP_440115.1_6 Reverse -207 -217 17.9746 0.0163
NP_440115.1_6 Reverse -156 -166 4.69992 0.288
NP_440115.1_6 Forward -295 -285 4.60159 0.293
NP_439965.1_1 Reverse -201 -220 -2.85214 0.177
NP_441347.1_5 Reverse -204 -218 9.6354 0.269
NP_440608.1_6 Forward -218 -199 8.84842 0.238
NP_441170.1_4 Reverse -201 -219 1.69077 0.299
NP_441972.1_5 Reverse -211 -230 -2.0655 0.178
NP_441106.1_1 Forward -220 -211 18.191 0.0028
NP_441106.1_1 Reverse -209 -218 9.63616 0.0311
NP_442306.1_10 Reverse -205 -224 -11.0136 0.114
NP_441286.1_1 Forward -220 -208 12.1337 0.0104
NP_441286.1_1 Reverse -209 -221 6.03717 0.0258
NP_440670.1_8 Forward -219 -210 18.3876 0.000699
NP_440670.1_8 Reverse -210 -219 18.3876 0.000699
NP_440886.1_7 Forward -220 -210 17.7774 0.0011
NP_440886.1_7 Reverse -209 -219 7.94438 0.0805
NP_440886.1_7 Forward -184 -174 3.61784 0.272
NP_442614.1_2 Forward -219 -205 12.7826 0.145
NP_442382.1_7 Forward -232 -213 4.03102 0.26
NP_442072.1_9 Reverse -209 -227 -23.3836 0.292
NP_442401.1_2 Forward -220 -201 22.3197 0.0238
NP_440907.2_8 Reverse -211 -221 14.2375 0.0312
NP_440907.2_8 Forward -218 -208 10.8943 0.0969
NP_440907.2_8 Forward -291 -281 5.97777 0.182
NP_442264.1_2 Reverse -149 -166 5.15205 0.284
NP_441463.1_3 Reverse -200 -219 -3.93378 0.189
NP_441463.1_3 Forward -229 -210 -6.29373 0.243
NP_441463.1_3 Reverse -185 -204 -6.98204 0.253
NP_441463.1_6 Reverse -61 -75 6.99573 0.265
NP_441626.1_2 Forward -218 -211 15.7721 0.0124
NP_441626.1_2 Reverse -211 -218 15.7721 0.0124
NP_442365.1_7 Forward -217 -198 -5.70374 0.277
NP_440107.1_5 Forward -220 -201 -1.67217 0.178
NP_442794.1_1 Forward -284 -272 3.08724 0.286
NP_442615.1_1 Forward -228 -210 4.44404 0.0465
NP_442615.1_1 Reverse -201 -219 -2.63579 0.146
NP_441962.1_4 Forward -218 -199 12.3892 0.0495
NP_441962.1_4 Reverse -205 -224 2.65439 0.102
NP_441962.1_4 Reverse -190 -209 -8.16202 0.196
NP_440387.1_1 Forward -219 -203 6.25339 0.0282
NP_440387.1_1 Reverse -210 -226 -2.5964 0.148
NP_441431.1_2 Reverse -207 -221 11.307 0.141
NP_442647.1_7 Forward -197 -184 14.9656 0.169
NP_441993.1_1 Reverse -204 -223 3.01872 0.244
NP_441174.1_2 Reverse -207 -221 15.1426 0.126
NP_442352.1_8 Forward -211 -197 15.1419 0.273
NP_440114.1_10 Reverse -210 -224 9.83269 0.16
NP_440114.1_10 Forward -219 -205 8.45605 0.202
NP_442684.1_2 Forward -71 -52 14.4541 0.288
NP_441858.1_2 Reverse -294 -313 12.6672 0.243
NP_441552.1_3 Reverse -203 -222 17.5998 0.123
NP_440766.1_4 Reverse -206 -220 7.66941 0.0884
NP_441237.1_9 Forward -218 -208 14.9263 0.0242
NP_439910.1_2 Forward -227 -210 -3.99273 0.0691
NP_442867.1_8 Reverse -290 -309 6.4893 0.26
NP_440457.1_1 Reverse -206 -218 9.77374 0.092
NP_440798.1_6 Reverse -211 -224 4.64084 0.144
NP_440798.1_6 Forward -218 -205 3.5592 0.15
NP_442297.1_3 Forward -206 -187 9.34008 0.256
NP_442509.1_9 Reverse -210 -220 16.2041 0.00739
NP_442509.1_9 Forward -219 -209 8.14104 0.192
NP_440554.1_4 Reverse -211 -221 7.35486 0.103
NP_440554.1_4 Forward -218 -208 6.37155 0.123
NP_441885.1_5 Forward -219 -209 20.9245 0.000538
NP_441885.1_5 Reverse -210 -220 11.4848 0.00668
NP_440478.1_10 Forward -221 -207 10.521 0.193
NP_442341.1_7 Forward -220 -206 10.226 0.0678
NP_442341.1_7 Reverse -209 -223 9.34103 0.0751
NP_442341.1_9 Forward -221 -207 6.0955 0.243
NP_441756.1_5 Reverse -231 -250 -4.91709 0.297
NP_443000.1_7 Reverse -208 -218 10.4031 0.0345
NP_443000.1_7 Forward -221 -211 1.94665 0.226
NP_440507.2_3 Reverse -171 -190 9.53674 0.218
NP_442513.1_5 Reverse -202 -221 9.14342 0.266
NP_441842.1_1 Forward -217 -204 18.8982 0.0142
NP_441842.1_10 Reverse -203 -217 14.0609 0.0636
NP_440275.1_3 Reverse -208 -218 17.6796 0.0102
NP_440275.1_3 Forward -221 -211 8.33817 0.0602
NP_440091.1_1 Reverse -206 -218 17.7386 0.013
NP_440091.1_1 Forward -223 -211 1.41561 0.197
NP_441307.1_4 Reverse -181 -200 8.35759 0.177
NP_443060.1_5 Reverse -202 -221 10.815 0.175
NP_442451.1_2 Forward -212 -193 -7.4737 0.236
NP_442451.1_2 Reverse -202 -221 -7.76869 0.239
NP_441122.1_1 Reverse -65 -80 3.42148 0.281
NP_439962.1_4 Forward -161 -142 6.58763 0.155
NP_439962.1_4 Forward -221 -202 -6.1954 0.281
NP_439962.1_4 Forward -212 -193 -8.26035 0.292
NP_440149.1_8 Reverse -210 -229 4.71934 0.0809
NP_440149.1_8 Reverse -174 -193 -4.03212 0.201
NP_440149.1_8 Forward -219 -200 -6.78538 0.261
NP_440149.1_8 Reverse -265 -284 -8.06369 0.298
NP_441875.1_10 Forward -325 -311 13.7659 0.23
NP_441105.1_3 Forward -303 -284 -7.08038 0.245
NP_442373.1_2 Reverse -187 -206 -11.3086 0.293
NP_440216.1_1 Reverse -210 -224 5.50613 0.0196
NP_440216.1_1 Forward -219 -205 -0.295402 0.0284
NP_440216.1_9 Reverse -115 -124 6.39124 0.289
NP_440172.1_1 Forward -219 -209 15.0247 0.00945
NP_440172.1_1 Reverse -210 -220 8.73149 0.0586
NP_440172.1_1 Reverse -159 -169 2.7333 0.268
NP_440167.1_3 Reverse -200 -219 18.9773 0.0628
NP_442015.1_10 Reverse -206 -219 2.87088 0.187
NP_442015.1_10 Reverse -339 -352 2.2809 0.196
NP_442015.1_10 Forward -223 -210 1.78924 0.204
NP_441226.1_7 Forward -218 -211 14.4934 0.0123
NP_441226.1_7 Reverse -211 -218 14.4934 0.0123
NP_441757.1_3 Reverse -209 -228 0.196116 0.197
NP_440413.1_5 Forward -286 -267 15.5349 0.213
NP_441111.1_7 Forward -218 -210 18.7023 0.00294
NP_441111.1_7 Reverse -211 -219 18.7023 0.00294
NP_442379.1_10 Reverse -203 -220 -0.551145 0.223
NP_441766.1_2 Forward -219 -210 17.5026 0.00297
NP_441766.1_2 Reverse -210 -219 17.5026 0.00297
NP_440416.1_1 Forward -219 -200 -14.5535 0.291
NP_443052.1_8 Reverse -200 -219 -8.752 0.179
NP_442154.1_1 Reverse -196 -214 -1.84914 0.123
NP_442154.1_1 Reverse -202 -220 -11.5839 0.215
NP_442154.1_1 Reverse -367 -385 -18.6637 0.284
NP_442154.1_1 Reverse -193 -211 -18.8604 0.286
NP_442154.1_6 Reverse -203 -222 2.3594 0.234
NP_442564.1_10 Forward -347 -333 10.1277 0.296
NP_440261.1_5 Forward -218 -205 -2.73398 0.0924
NP_440261.1_5 Reverse -211 -224 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATGGTTGAGTAAATCCTCCACCCCATTAACGCAATTAAAAAAAGTCTGACCATCATCCTGGCCCGAATATAGGGCCCCCGTATGGAACCAACCCTCCAATTTGCCGGAGGAATCCCCCCCCAAATGGCTATTTTGTTCTAACAACTGCACTGACAGGTTAGTATGGCGGGCCACATATTCGGCGATCGCCACCCCAGCAATGCCTCCCCCAATGACGGCCACATCGACCCGATTGATTGCCGCCGCACCAACTTGAACCATAAACTATGCTGAATTTATCCATGGGAGCTTTAACCCCCCTATTCTAGATTCAATCCGGTAAACCATGGCCATGCATAAGCACGGCAAACAGAGCTCAAGCTCACCGGAAACTCTGCCACTATAGACTTTCCTCTTCCC

CDS

ATGACCACTCTGTACAATCTGCTCGCCATTCTCCGTAAAGAGCTACTAAGTTATTTTGGTTCTCCTTTTGCCTATGGCATTGCCGCCATTTTTTGGTTAATGTCGGGAATTTTCTTTTCTTTGATGCTCAGTCAAATTATCTCCAACGTTGAGTTTTTGCGGCAGTCGGGGGTTTCTGAGCCAGTGGATGTGGCGGGGGATTTTCTTTCTAGTTATTTAGGCTTAATTATTTCGTTGATTTTAGTACTACTACCTGCCCTTTCCATGGGACTGTACGCAGAAGAAAGAAAGCGAGGCACCCTGGAATTATTGGCCACCTCCCCAGTCACCAATTGGGTGGTGGCGGTGGGCAAATTAATGGGGGCATTACTGTTTTTCTCAGTGTTGTTAGTTCCCCTATGGATTTATCAAATCATTATCTTTTCTGCGGCTAATCCTCCCCTACCAAGCGGTTTAGTGCTAGTGGCCAATGGGGCGGTAATTCTAGTGGCGGCGGCGGTGCTTTCCCTAGGCATGTTCATTTCTTCTCTGACGGAAAACGTGATAATTGCCTACATTCTCACCTTCGTTTTAATTTTGATGCTTTGGATTATGGATGTATTTGCCCAAAACCTAGGCGGGGCGATCGCCGATGTCTTCGCCTACCTTTCCCTTTTCCAAAGTTACCAAGATTTAATTAACGGAGTAATCAATAGTAAAAGCTGTGTGTTATTTGCCAGCTACATTTTTCTGGGTATTTTCCTCACTGCCCAGTCCATCGAAGCCCTAAGATTTCAACGTTCTTAA

Protein

MTTLYNLLAILRKELLSYFGSPFAYGIAAIFWLMSGIFFSLMLSQIISNVEFLRQSGVSEPVDVAGDFLSSYLGLIISLILVLLPALSMGLYAEERKRGTLELLATSPVTNWVVAVGKLMGALLFFSVLLVPLWIYQIIIFSAANPPLPSGLVLVANGAVILVAAAVLSLGMFISSLTENVIIAYILTFVLILMLWIMDVFAQNLGGAIADVFAYLSLFQSYQDLINGVINSKSCVLFASYIFLGIFLTAQSIEALRFQRS