Your browser is old and dusty. Try Google Chrome!

Details for slr0342

ORF slr0342
Accession NP_442079.1
Symbol petB
Category Cytochrome b6/f complex
Definition cytochrome b6
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -292 -306 16.7159 0.0276
NP_441061.1_2 Reverse -262 -276 0.294584 0.213
NP_441061.1_2 Forward -299 -285 -1.8687 0.274
NP_440557.1_1 Reverse -292 -311 6.58763 0.153
NP_440795.1_7 Forward -299 -292 14.6904 0.0123
NP_440795.1_7 Reverse -292 -299 14.6904 0.0123
NP_441418.1_6 Reverse -291 -310 28.3188 0.000107
NP_441418.1_6 Reverse -294 -313 -28.9099 0.213
NP_441418.1_6 Forward -300 -281 -29.9915 0.249
NP_441418.1_6 Reverse -297 -316 -30.7781 0.296
NP_440897.1_6 Forward -300 -281 1.76863 0.17
NP_441453.1_1 Forward -307 -289 4.34495 0.26
NP_441453.1_4 Reverse -291 -299 16.539 0.00633
NP_441453.1_4 Forward -300 -292 16.539 0.00633
NP_441453.1_8 Reverse -164 -181 9.67528 0.239
NP_441818.1_9 Reverse -295 -314 -3.63879 0.228
NP_440226.1_1 Forward -300 -281 6.39097 0.129
NP_440226.1_1 Reverse -291 -310 4.916 0.174
NP_440150.1_6 Reverse -288 -307 5.40766 0.229
NP_442655.1_10 Reverse -288 -307 -19.2734 0.282
NP_441721.1_6 Forward -121 -102 7.57094 0.281
NP_442173.1_1 Forward -299 -291 15.4574 0.00633
NP_442173.1_1 Reverse -292 -300 15.4574 0.00633
NP_442752.1_4 Forward -300 -293 13.8055 0.0199
NP_442752.1_4 Reverse -291 -298 13.8055 0.0199
NP_442752.1_4 Reverse -385 -392 5.25066 0.256
NP_443027.1_4 Forward -302 -292 14.828 0.0437
NP_443027.1_4 Reverse -289 -299 13.943 0.0452
NP_441812.1_2 Forward -128 -109 12.3892 0.271
NP_442975.1_10 Forward -304 -290 5.60385 0.216
NP_442975.1_10 Reverse -287 -301 3.44058 0.259
NP_441470.1_5 Reverse -119 -138 10.1721 0.262
NP_441225.1_4 Forward -101 -82 -1.96717 0.237
NP_440784.1_7 Forward -299 -292 15.9687 0.0123
NP_440784.1_7 Reverse -292 -299 15.9687 0.0123
NP_440061.1_9 Forward -302 -288 8.84875 0.161
NP_440110.1_8 Reverse -289 -308 2.45773 0.211
NP_441476.1_5 Forward -305 -286 -0.688862 0.2
NP_439979.1_2 Reverse -291 -310 15.8307 0.138
NP_442062.1_8 Forward -300 -290 19.4496 0.000558
NP_442062.1_8 Reverse -291 -301 19.4496 0.000558
NP_441859.1_3 Reverse -290 -309 10.3234 0.121
NP_441859.1_3 Forward -280 -261 6.68515 0.171
NP_441859.1_3 Forward -301 -282 1.08032 0.296
NP_441802.1_1 Reverse -169 -188 8.55425 0.22
NP_440304.1_4 Forward -302 -292 10.8948 0.051
NP_440304.1_4 Reverse -289 -299 9.91146 0.051
NP_442242.1_4 Forward -299 -292 14.3954 0.0124
NP_442242.1_4 Reverse -292 -299 14.3954 0.0124
NP_440044.1_8 Forward -299 -280 -0.295539 0.217
NP_441781.1_7 Forward -187 -168 4.12936 0.187
NP_440765.1_1 Forward -318 -299 14.6508 0.146
NP_439918.1_2 Reverse -36 -55 2.75272 0.2
NP_439918.1_3 Reverse -288 -307 2.26107 0.297
NP_441210.1_10 Reverse -161 -179 17.8171 0.256
NP_440370.1_10 Forward -309 -290 6.68596 0.284
NP_440132.1_1 Reverse -289 -307 15.2604 0.107
NP_442110.1_7 Reverse -291 -305 3.44117 0.21
NP_441925.1_4 Forward -319 -300 -12.9809 0.257
NP_440856.1_4 Forward -307 -288 -2.36049 0.209
NP_440856.1_4 Reverse -284 -303 -5.60541 0.294
NP_440856.1_7 Reverse -288 -307 -0.0988766 0.167
NP_441083.1_5 Forward -300 -290 11.3864 0.0159
NP_441083.1_5 Reverse -291 -301 11.3864 0.0159
NP_441083.1_5 Forward -400 -390 8.82982 0.03
NP_442827.1_8 Forward -52 -33 6.98015 0.0988
NP_441738.1_2 Forward -298 -291 15.28 0.0102
NP_441738.1_2 Reverse -293 -300 15.28 0.0102
NP_441738.1_2 Reverse -60 -67 8.1019 0.204
NP_441955.1_8 Forward -306 -289 14.5918 0.199
NP_441955.1_8 Forward -176 -159 6.23369 0.281
NP_440209.1_1 Reverse -291 -299 18.1123 0.00295
NP_440209.1_1 Forward -300 -292 18.1123 0.00295
NP_442889.1_8 Reverse -288 -302 10.0287 0.0916
NP_441713.1_1 Reverse -285 -304 -14.7502 0.259
NP_441713.1_5 Reverse -293 -312 5.99764 0.271
NP_441770.1_1 Forward -313 -294 11.405 0.277
NP_441716.1_1 Reverse -291 -305 10.226 0.0968
NP_442111.1_4 Reverse -290 -304 10.521 0.0535
NP_442111.1_4 Forward -301 -287 9.63603 0.0593
NP_440906.1_5 Forward -299 -292 15.8704 0.0124
NP_440906.1_5 Reverse -292 -299 15.8704 0.0124
NP_440906.1_9 Reverse -318 -337 12.88 0.296
NP_440747.1_10 Forward -303 -291 7.70879 0.00236
NP_440747.1_10 Reverse -288 -300 -2.1243 0.0225
NP_441130.1_10 Forward -302 -288 12.0943 0.1
NP_441486.1_1 Forward -303 -289 3.14618 0.0662
NP_441486.1_1 Reverse -288 -302 1.67122 0.103
NP_442634.1_4 Reverse -289 -303 6.19444 0.0508
NP_440470.1_5 Forward -165 -146 5.49036 0.296
NP_440842.1_6 Forward -281 -262 12.3883 0.25
NP_440842.1_6 Forward -317 -298 10.1267 0.289
NP_441014.1_8 Forward -314 -295 -7.17871 0.276
NP_441014.1_10 Reverse -290 -309 -0.39464 0.25
NP_442848.1_1 Forward -306 -292 -1.5737 0.263
NP_442848.1_1 Reverse -285 -299 -4.03198 0.279
NP_442848.1_4 Forward -338 -324 11.0127 0.274
NP_441012.1_4 Forward -304 -291 7.19745 0.272
NP_443018.1_3 Forward -299 -292 14.8871 0.0123
NP_443018.1_3 Reverse -292 -299 14.8871 0.0123
NP_443018.1_3 Reverse -247 -254 5.34899 0.212
NP_441316.1_7 Forward -302 -287 -3.26502 0.273
NP_441634.1_8 Forward -302 -288 3.93283 0.14
NP_440376.1_1 Forward -300 -291 19.4693 0.000692
NP_440376.1_1 Reverse -291 -300 19.4693 0.000692
NP_442687.1_7 Forward -301 -291 15.8113 0.0125
NP_442687.1_7 Reverse -290 -300 15.8113 0.0125
NP_442485.1_3 Forward -311 -292 -1.27885 0.256
NP_442485.1_3 Reverse -289 -308 -2.26216 0.262
NP_442485.1_3 Forward -317 -298 -2.55715 0.262
NP_441846.1_10 Reverse -20 -39 -19.3717 0.256
NP_441846.1_10 Reverse -21 -40 -22.2233 0.257
NP_440642.1_10 Forward -183 -169 4.32555 0.259
NP_441013.1_2 Reverse -110 -128 -2.14413 0.282
NP_441422.1_7 Forward -52 -35 -5.36936 0.247
NP_442658.1_1 Reverse -289 -299 18.7607 0.00222
NP_442658.1_1 Forward -302 -292 15.9091 0.00966
NP_442198.1_7 Reverse -288 -307 10.1267 0.248
NP_440141.1_4 Reverse -294 -313 -2.0655 0.296
NP_441971.1_7 Reverse -85 -104 19.2723 0.206
NP_441855.2_4 Forward -308 -289 11.0656 0.231
NP_442782.1_2 Reverse -291 -305 0.88457 0.282
NP_441414.1_9 Forward -300 -281 20.1573 0.00643
NP_441478.1_10 Forward -115 -97 6.70489 0.245
NP_442937.1_5 Reverse -298 -317 8.16093 0.231
NP_442937.1_5 Reverse -286 -305 7.7676 0.241
NP_441958.1_5 Forward -301 -291 12.2714 0.00183
NP_441958.1_5 Reverse -290 -300 12.2714 0.00183
NP_440203.1_5 Forward -42 -32 9.81266 0.245
NP_440269.1_1 Reverse -250 -268 16.1454 0.286
NP_442690.1_1 Forward -165 -146 -11.1119 0.223
NP_442911.1_2 Reverse -281 -300 8.35759 0.0211
NP_442911.1_2 Forward -310 -291 7.96426 0.0225
NP_441580.1_6 Reverse -280 -299 -4.72043 0.235
NP_441580.1_6 Forward -311 -292 -5.80207 0.235
NP_440153.1_5 Forward -299 -285 0.786239 0.289
NP_440153.1_8 Forward -315 -302 -2.144 0.235
NP_442119.1_9 Forward -301 -282 12.1925 0.245
NP_442064.1_4 Reverse -281 -300 11.0117 0.192
NP_440993.1_2 Forward -305 -289 10.0883 0.106
NP_440993.1_2 Reverse -286 -302 2.8118 0.262
NP_442995.1_5 Reverse -286 -305 9.63589 0.291
NP_441099.1_5 Forward -310 -291 6.88262 0.0431
NP_441099.1_5 Forward -269 -250 -8.94866 0.209
NP_441099.1_5 Reverse -281 -300 -11.7019 0.288
NP_442002.1_9 Forward -301 -294 10.7572 0.185
NP_442002.1_9 Reverse -290 -297 10.7572 0.185
NP_441938.1_1 Reverse -289 -308 8.94757 0.229
NP_441294.1_7 Forward -316 -302 11.4584 0.143
NP_442438.1_10 Forward -305 -291 10.9143 0.0478
NP_442438.1_10 Reverse -286 -300 6.19444 0.119
NP_441000.1_6 Forward -301 -287 4.71948 0.0933
NP_441000.1_6 Reverse -290 -304 -4.03198 0.225
NP_441000.1_6 Forward -260 -246 -5.21195 0.266
NP_442771.1_1 Reverse -289 -307 2.37909 0.0709
NP_442771.1_1 Forward -302 -284 -8.83064 0.208
NP_440147.1_4 Forward -302 -289 11.524 0.0326
NP_440147.1_4 Reverse -289 -302 2.08423 0.21
NP_441550.1_8 Reverse -289 -299 10.501 0.066
NP_441550.1_8 Forward -302 -292 6.0761 0.214
NP_441916.1_7 Forward -300 -290 18.4663 0.00144
NP_441916.1_7 Reverse -291 -301 18.4663 0.00144
NP_441041.1_4 Reverse -291 -310 12.4875 0.0234
NP_441041.1_7 Reverse -288 -300 10.1386 0.102
NP_441041.1_7 Forward -303 -291 7.61196 0.162
NP_442396.1_5 Reverse -287 -300 8.67241 0.151
NP_443063.1_7 Reverse -290 -306 6.15506 0.288
NP_441725.1_4 Forward -305 -291 3.63724 0.278
NP_441725.1_5 Reverse -292 -302 11.2881 0.0247
NP_441725.1_5 Forward -299 -289 9.02648 0.0553
NP_439966.1_7 Forward -302 -292 18.4657 0.00473
NP_439966.1_7 Reverse -289 -299 17.4824 0.00636
NP_439966.1_7 Forward -37 -27 10.206 0.0958
NP_439966.1_9 Reverse -289 -298 10.7178 0.0863
NP_439966.1_9 Forward -302 -293 0.983037 0.253
NP_442941.1_3 Reverse -292 -302 11.4848 0.0116
NP_442941.1_3 Forward -299 -289 2.53664 0.14
NP_440289.1_2 Forward -303 -290 5.13249 0.0636
NP_440289.1_2 Reverse -288 -301 3.46087 0.078
NP_440983.1_5 Forward -312 -293 0.491109 0.214
NP_440983.1_5 Forward -315 -296 -7.76869 0.291
NP_442281.1_1 Forward -305 -291 20.4518 0.00192
NP_442281.1_1 Forward -275 -261 3.63724 0.224
NP_442281.1_1 Reverse -286 -300 1.76896 0.29
NP_441334.1_7 Reverse -289 -308 -18.8801 0.275
NP_001035871.2_7 Forward -172 -162 15.418 0.161
NP_440437.1_1 Forward -306 -287 -0.787193 0.187
NP_442012.1_1 Reverse -285 -304 4.81767 0.16
NP_442012.1_1 Forward -306 -287 0.982764 0.226
NP_441556.1_4 Forward -309 -290 19.0673 0.0935
NP_441556.1_4 Forward -312 -293 17.5248 0.113
NP_440498.1_1 Forward -309 -291 8.57394 0.0786
NP_441644.1_6 Forward -300 -290 10.1076 0.0628
NP_441644.1_6 Reverse -291 -301 10.1076 0.0628
NP_440867.1_10 Forward -369 -350 11.3075 0.25
NP_442215.1_2 Reverse -289 -305 3.89344 0.0903
NP_442029.1_1 Reverse -301 -320 -10.0303 0.218
NP_440253.1_2 Reverse -291 -309 4.73903 0.1
NP_440253.1_2 Forward -300 -282 -1.65248 0.245
NP_440253.1_4 Forward -263 -244 14.3558 0.217
NP_440929.1_8 Forward -300 -291 19.2726 0.000701
NP_440929.1_8 Reverse -291 -300 19.2726 0.000701
NP_442933.1_10 Forward -300 -291 17.601 0.00325
NP_442933.1_10 Reverse -291 -300 17.601 0.00325
NP_441751.2_8 Reverse -292 -306 -0.197071 0.125
NP_441751.2_8 Forward -299 -285 -1.5737 0.129
NP_442554.1_8 Forward -299 -289 16.008 0.0065
NP_442554.1_8 Reverse -292 -302 13.8447 0.0145
NP_441762.1_7 Forward -301 -289 21.5735 0.00342
NP_441762.1_7 Reverse -290 -302 12.0354 0.0142
NP_442142.1_4 Forward -303 -290 19.6848 0.0179
NP_442142.1_4 Forward -262 -249 9.06515 0.103
NP_442142.1_4 Reverse -288 -301 8.47516 0.113
NP_442142.1_4 Forward -309 -296 6.21356 0.17
NP_442142.1_4 Forward -312 -299 6.0169 0.175
NP_442142.1_4 Forward -315 -302 3.46031 0.255
NP_442292.1_1 Forward -299 -290 9.63616 0.0183
NP_442292.1_1 Reverse -292 -301 9.63616 0.0183
NP_442476.1_6 Forward -299 -285 19.3708 0.0268
NP_442381.1_8 Reverse -288 -307 -5.60541 0.148
NP_443009.1_5 Reverse -290 -301 11.6612 0.0602
NP_443009.1_5 Forward -301 -290 11.6612 0.0602
NP_442301.1_2 Forward -310 -291 6.88182 0.262
NP_442408.2_1 Reverse -291 -310 0.196116 0.202
NP_441715.1_4 Reverse -292 -302 16.303 0.0117
NP_441715.1_4 Forward -299 -289 9.32148 0.097
NP_440158.1_8 Reverse -289 -308 16.9124 0.12
NP_440158.1_8 Reverse -259 -278 12.3892 0.222
NP_440183.1_9 Forward -367 -348 -14.7502 0.27
NP_440379.1_5 Reverse -288 -307 -8.26035 0.25
NP_441468.1_1 Forward -299 -292 15.8704 0.0124
NP_441468.1_1 Reverse -292 -299 15.8704 0.0124
NP_441020.2_6 Reverse -289 -306 25.3099 0.000186
NP_441020.2_6 Forward -302 -285 10.1669 0.151
NP_441015.1_10 Reverse -298 -317 -1.18052 0.171
NP_441015.1_10 Reverse -292 -311 -8.55534 0.276
NP_441673.1_1 Forward -300 -291 20.8459 0.000698
NP_441673.1_1 Reverse -291 -300 20.8459 0.000698
NP_441826.1_2 Forward -306 -292 10.521 0.0471
NP_441826.1_2 Reverse -285 -299 0.786239 0.172
NP_442490.1_9 Reverse -291 -310 -7.96535 0.282
NP_441764.1_8 Forward -215 -205 12.842 0.284
NP_442868.1_6 Reverse -289 -299 8.53483 0.0555
NP_442868.1_6 Forward -302 -292 0.963343 0.205
NP_442719.1_2 Forward -360 -342 -4.79978 0.216
NP_442719.1_2 Forward -120 -102 -5.29143 0.218
NP_441056.1_1 Reverse -291 -310 -7.17871 0.271
NP_442227.1_2 Forward -316 -297 5.60432 0.202
NP_442227.1_2 Forward -307 -288 -2.36049 0.272
NP_442227.1_2 Forward -42 -23 -2.75381 0.28
NP_442361.1_3 Forward -306 -293 17.1289 0.0481
NP_442808.1_1 Forward -301 -291 18.4657 0.00201
NP_442808.1_1 Reverse -290 -300 18.4657 0.00201
NP_442808.1_1 Forward -36 -26 2.63453 0.26
NP_441101.1_1 Reverse -289 -307 15.7521 0.231
NP_441101.1_10 Forward -304 -285 -4.72043 0.281
NP_440031.1_10 Reverse -160 -179 3.44104 0.256
NP_440031.1_10 Forward -174 -155 1.47442 0.27
NP_442542.1_2 Reverse -289 -302 12.409 0.114
NP_442542.1_2 Forward -363 -350 7.6891 0.173
NP_442113.1_10 Forward -319 -300 -3.73712 0.217
NP_442050.1_5 Forward -302 -292 9.12434 0.193
NP_442050.1_5 Reverse -289 -299 8.23937 0.234
NP_442342.1_9 Reverse -289 -305 2.22182 0.29
NP_440558.1_2 Forward -309 -290 -2.36049 0.226
NP_440111.2_2 Reverse -295 -314 0.491109 0.212
NP_442789.1_4 Reverse -289 -308 7.57094 0.111
NP_442593.1_6 Reverse -159 -178 19.935 0.082
NP_441518.1_3 Forward -310 -291 -7.17871 0.152
NP_441878.1_6 Forward -301 -291 10.4031 0.0176
NP_441878.1_6 Reverse -290 -300 10.4031 0.0176
NP_441036.1_8 Forward -301 -291 17.7779 0.000554
NP_441036.1_8 Reverse -290 -300 17.7779 0.000554
NP_442503.1_10 Reverse -157 -176 17.0107 0.279
NP_441557.1_5 Forward -300 -291 19.9609 0.000699
NP_441557.1_5 Reverse -291 -300 19.9609 0.000699
NP_441557.1_8 Forward -179 -169 15.5158 0.18
NP_441445.1_1 Reverse -294 -313 3.44104 0.213
NP_441590.1_4 Forward -287 -268 1.57197 0.3
NP_442066.2_4 Forward -300 -281 -9.24366 0.296
NP_442066.2_9 Reverse -287 -300 10.639 0.154
NP_441308.1_8 Forward -302 -292 10.1081 0.22
NP_441308.1_8 Reverse -289 -299 9.22315 0.226
NP_442183.1_1 Reverse -291 -305 19.1741 0.0065
NP_442183.1_1 Forward -300 -286 13.5693 0.0423
NP_441574.1_1 Reverse -291 -310 4.12936 0.139
NP_440276.1_8 Forward -184 -165 10.1275 0.232
NP_441467.1_5 Forward -216 -206 17.9746 0.199
NP_442347.1_2 Forward -299 -290 11.1111 0.056
NP_442347.1_2 Reverse -292 -301 11.1111 0.056
NP_442645.1_2 Forward -267 -248 -17.8968 0.266
NP_441037.1_4 Reverse -289 -299 16.2838 0.0168
NP_441037.1_4 Forward -302 -292 7.02532 0.237
NP_440235.1_6 Forward -245 -235 17.4963 0.176
NP_441633.1_3 Forward -302 -289 13.3923 0.018
NP_441633.1_3 Reverse -289 -302 3.5592 0.0699
NP_440136.1_2 Forward -299 -292 15.9687 0.0123
NP_440136.1_2 Reverse -292 -299 15.9687 0.0123
NP_442590.1_10 Reverse -250 -269 9.24257 0.2
NP_442590.1_10 Reverse -300 -319 3.04771 0.297
NP_442998.1_5 Reverse -366 -376 9.51814 0.238
NP_442998.1_5 Reverse -120 -130 8.53483 0.261
NP_442998.1_10 Forward -298 -291 15.5754 0.0102
NP_442998.1_10 Reverse -293 -300 15.5754 0.0102
NP_440899.1_2 Forward -311 -292 6.29183 0.268
NP_440299.1_1 Forward -304 -291 20.1765 0.00128
NP_440299.1_1 Reverse -287 -300 16.3416 0.0105
NP_441799.1_1 Reverse -287 -301 12.8803 0.0385
NP_441799.1_1 Forward -304 -290 6.58715 0.167
NP_441007.1_5 Reverse -292 -311 11.5042 0.214
NP_441007.1_10 Reverse -286 -299 1.69091 0.203
NP_441007.1_10 Reverse -301 -314 -0.275709 0.273
NP_442201.1_10 Reverse -37 -56 -14.7502 0.288
NP_441449.1_8 Forward -314 -295 14.9535 0.21
NP_442333.2_5 Forward -281 -262 -5.40875 0.214
NP_440256.1_1 Forward -303 -284 4.81767 0.0411
NP_440256.1_1 Reverse -288 -307 -7.17871 0.231
NP_441362.1_2 Forward -211 -192 5.55684 0.243
NP_441559.1_3 Forward -46 -27 13.7649 0.279
NP_441559.1_8 Forward -305 -291 2.5562 0.143
NP_440915.1_6 Reverse -287 -301 12.1926 0.0218
NP_440915.1_6 Forward -304 -290 5.70279 0.0879
NP_440915.1_6 Reverse -44 -58 -2.65535 0.278
NP_441179.1_9 Forward -308 -298 9.22267 0.28
NP_441296.1_9 Forward -186 -173 13.9817 0.2
NP_440717.1_3 Forward -397 -383 12.6836 0.227
NP_441704.1_8 Forward -311 -292 6.88182 0.254
NP_442069.1_7 Forward -317 -298 13.3716 0.201
NP_440749.1_6 Forward -196 -177 19.764 0.0171
NP_442866.1_1 Reverse -286 -305 14.6508 0.0714
NP_442866.1_1 Reverse -256 -275 5.50599 0.129
NP_441464.1_1 Forward -314 -295 8.25926 0.261
NP_441464.1_8 Forward -300 -286 5.01447 0.26
NP_440702.1_2 Forward -342 -323 -0.983855 0.257
NP_440702.1_2 Reverse -295 -314 -3.04881 0.257
NP_440702.1_5 Reverse -21 -40 10.5209 0.0964
NP_441939.1_3 Reverse -292 -311 7.07928 0.212
NP_441199.1_6 Forward -304 -285 5.50599 0.152
NP_440677.1_1 Forward -309 -290 14.2574 0.125
NP_442386.1_9 Reverse -290 -299 15.7322 0.0144
NP_442386.1_9 Forward -301 -292 15.7322 0.0144
NP_441750.1_1 Reverse -297 -316 -12.8819 0.3
NP_441340.1_5 Forward -299 -292 15.6737 0.0124
NP_441340.1_5 Reverse -292 -299 15.6737 0.0124
NP_442791.1_5 Reverse -18 -37 -11.9969 0.29
NP_440168.1_9 Reverse -289 -308 -0.39387 0.273
NP_441132.1_8 Reverse -21 -40 11.7008 0.132
NP_442240.1_2 Reverse -257 -276 -16.0285 0.235
NP_440161.1_3 Reverse -289 -308 9.3409 0.249
NP_440161.1_3 Forward -302 -283 7.86593 0.285
NP_440586.1_1 Reverse -284 -303 -4.52377 0.278
NP_440586.1_8 Forward -299 -292 13.2151 0.026
NP_440586.1_8 Reverse -292 -299 13.2151 0.026
NP_440586.1_8 Forward -278 -271 8.88855 0.205
NP_442251.1_6 Forward -299 -292 15.2804 0.0124
NP_442251.1_6 Reverse -292 -299 15.2804 0.0124
NP_440192.1_5 Reverse -296 -315 7.17762 0.215
NP_441262.1_3 Reverse -291 -298 14.7888 0.0223
NP_441262.1_3 Forward -300 -293 14.7888 0.0223
NP_443051.1_1 Reverse -290 -299 10.4228 0.00754
NP_443051.1_1 Forward -301 -292 10.4228 0.00754
NP_439996.1_6 Reverse -296 -315 25.5996 0.00324
NP_441232.1_10 Reverse -280 -299 16.0274 0.045
NP_439937.1_8 Reverse -289 -308 12.9791 0.149
NP_439937.1_8 Forward -302 -283 -2.65548 0.261
NP_439937.1_9 Forward -301 -284 10.5595 0.0407
NP_440408.1_7 Forward -229 -210 7.07928 0.292
NP_440626.1_1 Forward -299 -280 8.84842 0.28
NP_440439.1_1 Forward -303 -290 15.5556 0.0137
NP_440439.1_1 Reverse -288 -301 9.55739 0.0454
NP_439943.1_4 Forward -376 -357 3.93269 0.287
NP_440372.1_2 Forward -299 -292 16.3621 0.0124
NP_440372.1_2 Reverse -292 -299 16.3621 0.0124
NP_440171.1_3 Reverse -87 -106 4.52268 0.284
NP_441138.1_5 Forward -149 -136 3.02202 0.297
NP_441181.1_6 Reverse -292 -310 10.6389 0.219
NP_441181.1_6 Forward -342 -324 6.41066 0.219
NP_441789.1_7 Forward -310 -291 -4.03287 0.28
NP_440316.1_10 Reverse -164 -174 7.25653 0.251
NP_441803.1_2 Forward -305 -286 0.491109 0.251
NP_439977.1_5 Reverse -285 -304 6.68596 0.128
NP_440139.1_1 Reverse -285 -304 16.2232 0.0474
NP_441572.1_7 Reverse -285 -304 -4.6221 0.24
NP_442384.1_10 Reverse -291 -304 15.7522 0.00946
NP_442384.1_10 Forward -300 -287 8.9674 0.059
NP_442384.1_10 Forward -45 -32 1.88757 0.243
NP_442114.1_4 Forward -300 -289 12.1534 0.107
NP_441877.1_7 Forward -305 -286 -0.689632 0.295
NP_441018.1_7 Forward -332 -313 7.17762 0.276
NP_442790.1_4 Reverse -39 -58 -5.70374 0.144
NP_442790.1_4 Reverse -282 -301 -9.047 0.179
NP_442262.1_10 Forward -299 -292 14.1988 0.0123
NP_442262.1_10 Reverse -292 -299 14.1988 0.0123
NP_442262.1_10 Reverse -247 -254 7.6106 0.274
NP_441689.1_5 Forward -302 -292 8.53436 0.132
NP_442244.1_6 Forward -346 -327 1.76941 0.291
NP_442244.1_6 Reverse -288 -307 -0.590531 0.291
NP_442244.1_9 Forward -48 -29 11.4058 0.162
NP_440163.1_10 Forward -303 -293 16.303 0.0762
NP_440344.1_10 Forward -307 -290 15.3785 0.00465
NP_440344.1_10 Reverse -284 -301 7.80699 0.0123
NP_440282.1_10 Forward -310 -291 2.3594 0.156
NP_440531.1_6 Forward -278 -259 -5.21209 0.294
NP_440487.1_1 Reverse -288 -307 6.58763 0.102
NP_441965.1_10 Reverse -288 -304 12.1532 0.107
NP_441965.1_10 Reverse -258 -274 5.36841 0.209
NP_440297.1_9 Reverse -292 -302 9.32148 0.0917
NP_440297.1_9 Forward -299 -289 -0.216628 0.282
NP_440350.1_5 Reverse -197 -216 -2.26216 0.225
NP_442280.1_10 Forward -106 -88 7.49983 0.268
NP_442078.1_3 Reverse -112 -131 21.6314 0.00952
NP_440999.1_1 Forward -317 -298 9.93006 0.139
NP_440999.1_9 Forward -304 -290 4.12949 0.117
NP_440888.1_2 Forward -300 -286 17.8952 0.00302
NP_440888.1_2 Reverse -291 -305 14.9452 0.0137
NP_440888.1_2 Forward -57 -43 7.86545 0.179
NP_442948.1_2 Reverse -290 -309 14.8474 0.106
NP_440575.1_8 Forward -379 -360 11.8975 0.0794
NP_441543.1_2 Forward -299 -290 18.486 0.00236
NP_441543.1_2 Reverse -292 -301 18.486 0.00236
NP_442845.1_2 Reverse -159 -173 4.81781 0.251
NP_442845.1_2 Reverse -285 -299 3.93283 0.272
NP_441551.1_5 Reverse -287 -303 6.35103 0.273
NP_441319.1_8 Forward -306 -288 7.09898 0.263
NP_441469.1_8 Reverse -290 -299 16.126 0.00797
NP_441469.1_8 Forward -301 -292 16.126 0.00797
NP_442337.1_6 Reverse -296 -315 18.6207 0.0936
NP_442646.1_7 Reverse -20 -39 3.73603 0.277
NP_442578.1_7 Forward -299 -292 14.5921 0.026
NP_442578.1_7 Reverse -292 -299 14.5921 0.026
NP_441462.1_2 Forward -300 -290 11.5831 0.00406
NP_441462.1_2 Reverse -291 -301 11.5831 0.00406
NP_441462.1_4 Forward -46 -27 5.70265 0.141
NP_441621.1_7 Reverse -289 -303 15.8309 0.0266
NP_441621.1_7 Forward -302 -288 6.19444 0.068
NP_441621.1_7 Forward -311 -297 -4.81863 0.246
NP_443062.1_1 Forward -300 -282 15.664 0.0359
NP_443062.1_1 Reverse -291 -309 9.521 0.133
NP_443062.1_6 Forward -308 -289 15.7324 0.0697
NP_441601.1_2 Forward -321 -302 -3.54046 0.28
NP_440519.1_8 Reverse -36 -52 3.30346 0.247
NP_442204.1_1 Forward -304 -293 9.69511 0.0736
NP_442204.1_6 Reverse -297 -316 12.6841 0.138
NP_442487.1_2 Forward -320 -301 3.83357 0.232
NP_442872.1_1 Forward -317 -298 -9.63698 0.241
NP_440516.1_8 Forward -300 -291 16.9127 0.00442
NP_440516.1_8 Reverse -291 -300 16.9127 0.00442
NP_442428.1_4 Reverse -290 -309 2.26107 0.266
NP_442428.1_5 Forward -299 -292 15.8704 0.0124
NP_442428.1_5 Reverse -292 -299 15.8704 0.0124
NP_442428.1_8 Reverse -296 -315 -1.86883 0.289
NP_441443.1_7 Reverse -294 -313 2.45773 0.218
NP_441443.1_10 Forward -304 -286 1.98502 0.275
NP_440673.1_3 Forward -298 -291 12.4288 0.0426
NP_440673.1_3 Reverse -293 -300 12.4288 0.0426
NP_440865.1_9 Reverse -32 -51 -2.85214 0.189
NP_441052.1_2 Forward -300 -290 10.5014 0.0285
NP_441052.1_2 Reverse -291 -301 10.5014 0.0285
NP_442219.1_9 Forward -299 -290 8.35786 0.0681
NP_442219.1_9 Reverse -292 -301 8.35786 0.0681
NP_440436.1_4 Forward -299 -290 18.1905 0.00233
NP_440436.1_4 Reverse -292 -301 18.1905 0.00233
NP_441884.1_8 Forward -301 -282 1.17943 0.138
NP_441884.1_8 Reverse -290 -309 -6.88371 0.239
NP_441884.1_9 Reverse -288 -307 -4.6221 0.0594
NP_441719.1_4 Forward -299 -292 16.3621 0.0124
NP_441719.1_4 Reverse -292 -299 16.3621 0.0124
NP_441733.1_10 Reverse -288 -301 17.2272 0.0382
NP_441733.1_10 Forward -303 -290 7.78743 0.15
NP_441004.1_1 Reverse -294 -313 -11.7019 0.241
NP_441004.1_1 Reverse -291 -310 -11.8986 0.243
NP_441004.1_1 Reverse -285 -304 -16.7168 0.287
NP_441004.1_1 Reverse -167 -186 -18.0934 0.297
NP_442366.1_3 Reverse -290 -308 8.86894 0.0611
NP_440129.1_10 Forward -307 -293 16.0275 0.0373
NP_442873.1_3 Forward -310 -291 18.8781 0.0794
NP_441115.1_4 Forward -301 -283 9.55647 0.21
NP_442206.1_10 Reverse -291 -306 14.1396 0.0799
NP_443054.1_2 Forward -302 -288 12.586 0.0722
NP_443054.1_2 Reverse -176 -190 5.21113 0.237
NP_443054.1_2 Forward -272 -258 -0.0987402 0.284
NP_441966.1_6 Reverse -84 -103 4.916 0.289
NP_441851.1_10 Forward -301 -291 16.008 0.00552
NP_441851.1_10 Reverse -290 -300 16.008 0.00552
NP_442208.1_5 Reverse -39 -58 -8.06369 0.275
NP_442208.1_8 Reverse -268 -286 16.1454 0.235
NP_442622.1_1 Reverse -290 -309 -12.7836 0.276
NP_442011.1_1 Forward -301 -282 5.50599 0.197
NP_442515.1_1 Forward -301 -287 -1.8687 0.266
NP_441982.1_6 Reverse -119 -128 12.6763 0.274
NP_440463.1_8 Reverse -296 -315 6.62858 0.269
NP_442689.1_8 Forward -161 -144 -5.95935 0.279
NP_440940.1_7 Forward -310 -292 14.9646 0.067
NP_441349.1_10 Reverse -281 -300 -3.83545 0.152
NP_440432.1_9 Forward -299 -284 -1.79006 0.167
NP_442843.1_1 Reverse -27 -46 -11.0136 0.285
NP_439960.1_10 Forward -307 -289 3.3624 0.163
NP_440474.1_8 Forward -299 -285 15.8302 0.0547
NP_442450.1_5 Forward -302 -292 9.32148 0.115
NP_442168.1_5 Forward -299 -280 -2.26216 0.264
NP_440588.1_2 Reverse -282 -301 -1.96717 0.158
NP_440588.1_2 Forward -309 -290 -2.0655 0.16
NP_440588.1_2 Reverse -304 -323 -6.49039 0.283
NP_442006.1_2 Reverse -297 -314 -13.4325 0.197
NP_442006.1_2 Reverse -165 -182 -16.9724 0.267
NP_440483.1_1 Reverse -21 -40 -8.65367 0.292
NP_441570.1_1 Reverse -291 -309 10.3439 0.00901
NP_441570.1_1 Forward -300 -282 -13.6489 0.224
NP_441078.1_4 Forward -300 -291 19.6659 0.0007
NP_441078.1_4 Reverse -291 -300 19.6659 0.0007
NP_442729.1_5 Reverse -296 -306 14.0414 0.22
NP_442729.1_8 Reverse -287 -300 10.1474 0.125
NP_442729.1_8 Forward -304 -291 8.08242 0.125
NP_440539.1_9 Reverse -112 -131 -5.70374 0.286
NP_440707.1_9 Reverse -298 -317 3.93269 0.263
NP_442443.1_1 Forward -330 -311 -2.55715 0.258
NP_442443.1_1 Reverse -298 -317 -4.52377 0.272
NP_441091.1_5 Forward -280 -261 5.211 0.258
NP_440526.1_3 Forward -299 -288 2.51647 0.267
NP_441432.1_8 Reverse -290 -299 8.25953 0.0755
NP_441432.1_8 Forward -301 -292 8.25953 0.0755
NP_442320.1_8 Reverse -285 -299 15.2409 0.011
NP_442320.1_8 Forward -306 -292 4.62115 0.0472
NP_441732.1_2 Forward -304 -288 2.32015 0.0253
NP_440578.1_8 Reverse -291 -310 10.7175 0.284
NP_441945.1_10 Reverse -290 -309 7.47261 0.284
NP_440913.1_1 Reverse -244 -262 8.37728 0.185
NP_442400.1_10 Reverse -115 -128 8.75154 0.278
NP_440713.1_4 Forward -310 -291 6.78429 0.185
NP_442489.1_7 Forward -300 -291 20.1576 0.000695
NP_442489.1_7 Reverse -291 -300 20.1576 0.000695
NP_442079.1_1 Forward -158 -139 27.0405 0.00156
NP_442079.1_7 Forward -299 -280 17.6007 0.0744
NP_442079.1_7 Reverse -292 -311 9.43923 0.112
NP_440559.1_1 Reverse -292 -301 8.75118 0.0586
NP_440559.1_1 Forward -299 -290 8.75118 0.0586
NP_441659.2_8 Forward -300 -290 11.9764 0.0147
NP_441659.2_8 Reverse -291 -301 11.9764 0.0147
NP_441659.2_8 Reverse -352 -362 0.471689 0.264
NP_441022.1_1 Forward -380 -371 12.4095 0.232
NP_442849.1_1 Reverse -170 -184 8.25939 0.282
NP_442346.1_5 Forward -301 -291 9.02648 0.118
NP_442346.1_5 Reverse -290 -300 9.02648 0.118
NP_440545.1_3 Reverse -287 -304 7.70866 0.0488
NP_440545.1_3 Forward -304 -287 -2.12444 0.179
NP_440545.1_3 Forward -48 -31 -4.38605 0.224
NP_441856.1_7 Reverse -297 -316 13.0775 0.219
NP_441923.1_6 Reverse -298 -312 15.8309 0.168
NP_440486.1_6 Reverse -290 -309 8.84924 0.235
NP_441653.1_2 Forward -311 -292 12.7098 0.0959
NP_440010.1_4 Forward -310 -291 2.55527 0.222
NP_440847.1_8 Reverse -378 -397 14.5524 0.272
NP_442603.1_7 Reverse -291 -305 8.3571 0.176
NP_441233.1_2 Reverse -295 -314 12.3892 0.262
NP_441888.1_7 Forward -305 -291 13.3726 0.0743
NP_441888.1_7 Reverse -286 -300 2.94952 0.225
NP_441888.1_7 Forward -40 -26 2.35953 0.225
NP_441948.1_4 Forward -307 -289 8.37728 0.0623
NP_441833.1_4 Forward -299 -292 15.9687 0.0124
NP_441833.1_4 Reverse -292 -299 15.9687 0.0124
NP_442162.1_9 Forward -299 -292 16.2637 0.0124
NP_442162.1_9 Reverse -292 -299 16.2637 0.0124
NP_442796.1_10 Reverse -42 -61 8.55425 0.267
NP_440671.1_4 Forward -306 -292 13.4709 0.0806
NP_442199.1_5 Forward -308 -289 -1.96717 0.184
NP_442140.1_3 Forward -299 -289 17.4829 0.0159
NP_442140.1_3 Reverse -292 -302 8.33817 0.119
NP_442140.1_3 Forward -269 -259 4.99491 0.232
NP_441609.1_1 Forward -130 -111 2.45773 0.189
NP_441671.1_1 Reverse -250 -269 -0.197208 0.273
NP_440875.1_9 Forward -298 -288 9.44274 0.233
NP_440875.1_9 Reverse -293 -303 9.05339 0.233
NP_440875.1_9 Forward -268 -258 7.98268 0.251
NP_442547.1_9 Reverse -32 -50 17.4492 0.29
NP_441813.1_3 Reverse -159 -178 15.6917 0.238
NP_441813.1_5 Forward -302 -292 17.188 0.00979
NP_441813.1_5 Reverse -289 -299 10.0098 0.0208
NP_441227.1_6 Reverse -88 -107 12.7825 0.293
NP_440590.1_4 Forward -299 -286 3.26421 0.0749
NP_440590.1_4 Reverse -292 -305 -2.24233 0.239
NP_440590.1_4 Reverse -20 -33 -4.11062 0.258
NP_440567.1_1 Forward -299 -285 19.1741 0.0136
NP_440567.1_1 Reverse -292 -306 12.4876 0.023
NP_442497.1_10 Forward -299 -290 10.4228 0.0087
NP_442497.1_10 Reverse -292 -301 10.4228 0.0087
NP_440821.1_4 Forward -302 -292 19.0562 0.00399
NP_440821.1_4 Reverse -289 -299 18.7612 0.00422
NP_441239.1_9 Reverse -289 -301 18.6235 0.0114
NP_441239.1_9 Forward -302 -290 15.8703 0.0178
NP_441951.1_4 Reverse -291 -310 0.884433 0.293
NP_440400.1_1 Forward -292 -273 -0.689632 0.285
NP_440400.1_1 Forward -54 -35 -2.55791 0.285
NP_441892.1_1 Forward -309 -292 -0.846137 0.192
NP_440665.1_1 Reverse -294 -313 -2.75381 0.183
NP_440665.1_1 Forward -312 -293 -4.22878 0.186
NP_440665.1_1 Reverse -291 -310 -6.1954 0.202
NP_440604.1_6 Forward -300 -281 -3.24547 0.225
NP_442044.1_1 Forward -270 -251 -5.01543 0.18
NP_442270.1_6 Reverse -290 -308 16.0471 0.279
NP_441508.1_1 Forward -165 -146 15.9397 0.101
NP_442643.1_1 Reverse -285 -304 -9.24366 0.231
NP_443035.1_10 Forward -367 -350 5.05372 0.282
NP_440949.1_7 Forward -308 -289 12.6833 0.214
NP_442138.1_10 Reverse -291 -310 6.88262 0.073
NP_440546.1_4 Forward -300 -290 11.8882 0.0679
NP_440546.1_4 Reverse -291 -301 11.8882 0.0679
NP_440546.1_4 Reverse -261 -271 10.4338 0.109
NP_440546.1_4 Reverse -165 -175 6.65249 0.288
NP_440024.1_5 Forward -344 -325 14.3558 0.151
NP_440675.1_1 Reverse -288 -307 3.04771 0.258
NP_440462.1_4 Reverse -299 -313 7.07942 0.278
NP_440462.1_6 Reverse -289 -299 17.9746 0.00578
NP_440462.1_6 Forward -302 -292 15.418 0.0142
NP_442340.1_3 Reverse -37 -56 -9.53865 0.275
NP_440868.1_4 Reverse -287 -299 9.97041 0.0405
NP_440868.1_4 Forward -304 -292 8.6921 0.0582
NP_441249.1_8 Reverse -21 -40 1.67108 0.284
NP_441474.1_1 Forward -310 -291 16.4199 0.0944
NP_441474.1_1 Forward -313 -294 0.785326 0.253
NP_441474.1_1 Forward -280 -261 -2.06626 0.27
NP_440812.1_4 Reverse -116 -135 13.8621 0.25
NP_442402.1_2 Forward -183 -169 13.8636 0.263
NP_442402.1_6 Reverse -168 -177 15.7327 0.241
NP_441848.1_7 Forward -379 -360 -2.65624 0.27
NP_441084.1_6 Reverse -163 -177 14.4828 0.0972
NP_440696.1_3 Reverse -287 -305 -3.22577 0.284
NP_442039.1_4 Forward -299 -292 15.1821 0.0124
NP_442039.1_4 Reverse -292 -299 15.1821 0.0124
NP_442039.1_7 Reverse -117 -127 11.4848 0.257
NP_442039.1_7 Reverse -167 -177 10.4031 0.257
NP_441811.1_4 Forward -302 -283 18.4857 0.0523
NP_442837.1_3 Forward -299 -292 15.7721 0.0124
NP_442837.1_3 Reverse -292 -299 15.7721 0.0124
NP_440160.1_2 Reverse -160 -179 -4.13045 0.26
NP_440160.1_3 Forward -312 -293 18.9765 0.109
NP_442053.1_1 Forward -300 -291 18.3876 0.0007
NP_442053.1_1 Reverse -291 -300 18.3876 0.0007
NP_440505.1_3 Reverse -289 -299 14.1397 0.0235
NP_440505.1_3 Forward -302 -292 13.8447 0.0247
NP_440505.1_3 Reverse -169 -179 5.09324 0.246
NP_442360.1_5 Reverse -166 -176 15.0247 0.172
NP_442532.1_7 Forward -300 -286 6.58777 0.171
NP_442174.1_9 Reverse -289 -308 11.3075 0.164
NP_440914.1_1 Forward -300 -290 8.6151 0.186
NP_440914.1_1 Reverse -291 -301 8.6151 0.186
NP_441011.1_8 Forward -299 -290 16.9127 0.00602
NP_441011.1_8 Reverse -292 -301 16.9127 0.00602
NP_442533.1_1 Reverse -294 -313 -12.2919 0.236
NP_442533.1_1 Reverse -33 -52 -17.7001 0.293
NP_442533.1_6 Forward -300 -291 17.2076 0.00137
NP_442533.1_6 Reverse -291 -300 17.2076 0.00137
NP_442232.1_3 Reverse -283 -302 -12.3902 0.282
NP_442232.1_3 Reverse -169 -188 -15.3402 0.291
NP_442322.1_4 Forward -400 -383 -7.5333 0.284
NP_442322.1_4 Forward -39 -22 -7.72996 0.286
NP_442229.1_1 Reverse -289 -303 10.5204 0.184
NP_441482.1_7 Forward -306 -292 8.16106 0.0189
NP_439944.1_9 Forward -299 -289 10.4031 0.0887
NP_439944.1_9 Reverse -292 -302 10.3048 0.0887
NP_440816.1_2 Reverse -119 -138 15.1481 0.141
NP_441028.1_6 Forward -178 -168 3.8145 0.281
NP_442202.1_4 Reverse -289 -303 15.4531 0.183
NP_440116.1_5 Forward -303 -286 4.56207 0.192
NP_441527.1_7 Forward -135 -116 8.84842 0.282
NP_441680.1_4 Forward -314 -295 0.491109 0.246
NP_440608.1_6 Forward -314 -295 3.14526 0.29
NP_441602.1_3 Reverse -286 -305 -3.93378 0.256
NP_441602.1_4 Forward -311 -292 8.94757 0.279
NP_441170.1_4 Reverse -282 -300 8.27895 0.194
NP_441972.1_5 Forward -311 -292 -3.3438 0.199
NP_441972.1_5 Reverse -292 -311 -7.96535 0.256
NP_441972.1_5 Reverse -37 -56 -8.16202 0.258
NP_441972.1_5 Forward -299 -280 -10.0303 0.296
NP_441106.1_1 Reverse -290 -299 18.191 0.0028
NP_441106.1_1 Forward -301 -292 18.191 0.0028
NP_441106.1_1 Forward -271 -262 2.06468 0.298
NP_439903.1_6 Reverse -288 -307 1.76863 0.24
NP_441286.1_1 Forward -301 -289 5.25052 0.0259
NP_441286.1_1 Reverse -290 -302 4.95553 0.027
NP_440670.1_8 Forward -300 -291 18.3876 0.000699
NP_440670.1_8 Reverse -291 -300 18.3876 0.000699
NP_440670.1_8 Forward -361 -352 3.53964 0.257
NP_440886.1_7 Forward -301 -291 17.7774 0.0011
NP_440886.1_7 Reverse -290 -300 17.7774 0.0011
NP_440886.1_7 Forward -313 -303 6.66608 0.115
NP_440886.1_7 Forward -310 -300 5.38779 0.185
NP_441001.1_10 Reverse -296 -315 6.29264 0.249
NP_439995.1_5 Reverse -281 -300 23.4022 0.0262
NP_441399.1_6 Forward -50 -31 10.4217 0.297
NP_442072.1_9 Reverse -253 -271 -21.6137 0.211
NP_442072.1_9 Forward -301 -283 -21.8103 0.212
NP_442072.1_9 Reverse -290 -308 -23.187 0.284
NP_441753.1_10 Forward -309 -290 4.81767 0.193
NP_441753.1_10 Reverse -282 -301 3.14605 0.221
NP_441403.1_4 Forward -127 -109 10.2456 0.282
NP_441808.1_8 Reverse -291 -310 9.83255 0.242
NP_441808.1_8 Reverse -294 -313 9.0459 0.259
NP_440907.2_8 Forward -299 -289 17.4824 0.00685
NP_440907.2_8 Reverse -292 -302 7.84605 0.117
NP_441463.1_3 Reverse -281 -300 24.1889 0.00292
NP_441463.1_3 Forward -310 -291 10.1275 0.0481
NP_441463.1_6 Forward -302 -288 6.3193 0.274
NP_441626.1_2 Forward -299 -292 15.7721 0.0124
NP_441626.1_2 Reverse -292 -299 15.7721 0.0124
NP_442365.1_5 Forward -299 -280 17.109 0.0642
NP_442365.1_7 Forward -304 -285 5.70265 0.127
NP_442794.1_1 Forward -304 -292 10.1671 0.0721
NP_442615.1_1 Reverse -282 -300 -1.45582 0.128
NP_441962.1_4 Reverse -286 -305 -4.42544 0.158
NP_441962.1_4 Forward -305 -286 -6.1954 0.175
NP_440387.1_1 Reverse -291 -307 14.6115 0.00635
NP_440387.1_1 Forward -300 -284 9.20332 0.0281
NP_441431.1_2 Forward -303 -289 8.65209 0.209
NP_441836.1_2 Reverse -285 -304 -3.73712 0.244
NP_442224.1_1 Forward -317 -298 1.17943 0.233
NP_441174.1_2 Forward -303 -289 17.8958 0.0405
NP_440114.1_10 Forward -300 -286 10.0294 0.155
NP_441510.2_7 Forward -306 -292 11.602 0.28
NP_440766.1_4 Forward -304 -290 17.7975 0.0255
NP_440766.1_4 Reverse -266 -280 1.47456 0.23
NP_442743.1_5 Reverse -292 -311 7.27595 0.164
NP_442930.1_1 Reverse -232 -242 9.22267 0.289
NP_439910.1_2 Forward -308 -291 -21.3973 0.183
NP_440502.1_3 Forward -178 -168 14.5691 0.212
NP_440457.1_1 Forward -304 -292 8.29878 0.101
NP_440457.1_1 Reverse -287 -299 7.90546 0.101
NP_440987.1_4 Forward -211 -192 4.71934 0.239
NP_440798.1_6 Forward -299 -286 2.87088 0.159
NP_442680.1_5 Forward -217 -198 7.10594 0.201
NP_440801.1_9 Forward -177 -163 16.3258 0.227
NP_440801.1_10 Forward -304 -285 4.62101 0.289
NP_441984.1_3 Reverse -161 -179 9.75391 0.201
NP_442509.1_9 Forward -300 -290 16.2041 0.00739
NP_442509.1_9 Reverse -291 -301 16.2041 0.00739
NP_442514.1_5 Forward -182 -163 -4.22953 0.238
NP_440185.1_9 Reverse -376 -393 17.8367 0.183
NP_440554.1_4 Reverse -292 -302 14.6313 0.02
NP_440554.1_4 Forward -299 -289 13.943 0.0218
NP_442862.1_3 Forward -130 -113 6.62702 0.263
NP_442862.1_3 Reverse -194 -211 6.23369 0.267
NP_441845.1_6 Forward -312 -294 -0.669169 0.274
NP_441885.1_5 Forward -300 -290 11.4848 0.00668
NP_441885.1_5 Reverse -291 -301 11.4848 0.00668
NP_442341.1_7 Reverse -290 -304 17.7975 0.0111
NP_442341.1_7 Forward -301 -287 11.6026 0.0534
NP_441173.1_9 Forward -127 -119 13.2937 0.17
NP_442395.2_4 Forward -301 -282 25.073 0.00845
NP_442395.2_4 Reverse -290 -309 -0.0996487 0.282
NP_440191.1_4 Forward -107 -97 14.2146 0.266
NP_440423.1_6 Reverse -172 -191 -21.4367 0.294
NP_443000.1_7 Forward -302 -292 8.73149 0.0437
NP_443000.1_7 Reverse -289 -299 2.04498 0.226
NP_440507.2_3 Forward -309 -290 10.3234 0.208
NP_443059.1_10 Forward -314 -295 2.16195 0.239
NP_441842.1_10 Reverse -284 -298 14.1593 0.0636
NP_441842.1_10 Forward -307 -293 7.37441 0.258
NP_440275.1_3 Reverse -289 -299 17.9746 0.0082
NP_440275.1_3 Forward -302 -292 8.4365 0.0602
NP_440091.1_1 Reverse -287 -299 12.7237 0.0353
NP_440091.1_1 Forward -304 -292 1.41561 0.197
NP_441307.1_6 Reverse -291 -310 5.50599 0.277
NP_441902.1_3 Forward -219 -209 14.7309 0.211
NP_440679.1_5 Reverse -294 -313 5.01433 0.298
NP_440679.1_10 Reverse -293 -312 3.24438 0.092
NP_440679.1_10 Forward -307 -288 -17.9951 0.276
NP_440679.1_10 Reverse -299 -318 -20.945 0.289
NP_441207.1_7 Forward -211 -197 11.8693 0.241
NP_442753.1_5 Reverse -304 -323 13.4708 0.148
NP_439962.1_4 Forward -308 -289 -3.73712 0.257
NP_440175.1_7 Forward -344 -326 14.5355 0.147
NP_440149.1_8 Reverse -291 -310 13.5691 0.0277
NP_440216.1_1 Forward -300 -286 6.58777 0.0145
NP_440216.1_1 Reverse -291 -305 -2.26202 0.0484
NP_440172.1_1 Forward -300 -290 8.73149 0.0586
NP_440172.1_1 Reverse -291 -301 8.73149 0.0586
NP_442418.1_1 Forward -251 -232 19.6656 0.106
NP_442015.1_10 Forward -304 -291 19.1938 0.00444
NP_441226.1_7 Forward -299 -292 14.4934 0.0123
NP_441226.1_7 Reverse -292 -299 14.4934 0.0123
NP_441226.1_7 Reverse -352 -359 6.52862 0.253
NP_441111.1_7 Forward -299 -291 18.7023 0.00294
NP_441111.1_7 Reverse -292 -300 18.7023 0.00294
NP_441766.1_2 Forward -300 -291 17.5026 0.00297
NP_441766.1_2 Reverse -291 -300 17.5026 0.00297
NP_442417.1_5 Reverse -291 -305 21.3374 0.00922
NP_440416.1_1 Forward -300 -281 -7.96535 0.23
NP_440416.1_9 Forward -307 -288 -4.42544 0.0776
NP_440416.1_9 Reverse -284 -303 -16.8151 0.223
NP_443052.1_8 Reverse -281 -300 -10.1286 0.203
NP_443052.1_9 Forward -313 -294 -4.42544 0.258
NP_440072.1_5 Reverse -297 -315 -3.32411 0.277
NP_441940.1_1 Forward -55 -36 14.6499 0.207
NP_442403.1_9 Reverse -288 -307 8.75091 0.191
NP_442154.1_1 Reverse -289 -307 -3.91409 0.125
NP_442154.1_1 Reverse -298 -316 -4.30741 0.125
NP_442154.1_1 Reverse -292 -310 -6.27403 0.135
NP_442154.1_1 Reverse -34 -52 -8.04399 0.155
NP_442154.1_1 Reverse -295 -313 -15.7138 0.224
NP_442154.1_1 Reverse -27 -45 -17.5821 0.26
NP_442154.1_1 Forward -342 -324 -18.1721 0.278
NP_440261.1_5 Forward -299 -286 -10.5021 0.201
NP_440261.1_5 Reverse -292 -305 -10.5021 0.201
NP_440261.1_5 Forward -278 -265 -11.4854 0.262
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAGATCAGCCTCGCCCCAACTAAAATTTTGTACCCTGGGACGGTTGGCAAATATACACTGATTGTTGTTCTGGCAGGTGTAATGACCCACCACCACCACGGCGATCGCCGCACTAAGGACACCGATCAAACCGAGGGCCGCACGATCAATGGGTTCAGAAAAATATTTAGCGAGCATGGATAGAGGAGCAAAATTTAGAACAGAATCACAGCCGGACTTCCCTTTCCCCAGGGCTTGAAGCTGTGTTACATTTTGTGATGAGTAGTTCTCATTTTTGCCAAGTTTGGGAGCTTTTCCACCCTTGGTCAAACCGTCATAGTACGCTGATTATATGCGATTTTACGGCTCCGCCGGAGTCAACCCCCTCCATCCCTGATCCTTAAGAGAAGTCTAGCTTCA

CDS

ATGTTTTCAAAAGAAGTCACCGAATCAAAAGTTTTTCAATGGTTCAATGATCGTCTGGAAGTGCAAGCCATCTCCGATGACATTGCCAGCAAATACGTTCCTCCCCACGTCAATATTTTTTACTGTCTGGGGGGCCTGACCCTGACCTGCTTCCTGATCCAGTTTGCCACTGGGTTCGCCATGACCTTCTACTACAAACCCACGGTCACGGAAGCCTTCGCCTCTGTCCAATACATCATGAATGAAGTCAACTTTGGTTGGCTGATTCGCTCCATTCACCGTTGGTCCGCCAGCATGATGGTGCTGATGATGATTCTCCACGTTTTTCGGGTTTACCTCACCGGTGGTTTCAAGAAGCCCCGGGAATTGACCTGGGTTGTGGGTGTAATGCTAGCCGTCACCACTGTCACCTTTGGTGTAACCGGTTACTCCCTTCCCTGGGACCAGGTGGGTTACTGGGCGGTAAAAATCGTTTCCGGTGTACCGGCCGCTATTCCCGTGGTTGGGGATCAATTGGTGACCCTCATGCGAGGTAGTGAAAGCGTTGGTCAGGCTACCTTGACCCGCTTCTACAGCCTCCACACCTTCGTGCTTCCCTGGGCGATCGCCGTGTTGCTGTTGTTGCACTTCCTGATGATCCGCAAACAAGGCATTTCCGGTCCTTTGTAA

Protein

MFSKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFLIQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPWAIAVLLLLHFLMIRKQGISGPL