Your browser is old and dusty. Try Google Chrome!

Details for slr0326

ORF slr0326
Accession NP_441958.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -214 -200 8.25939 0.0917
NP_441061.1_2 Forward -107 -93 0.88457 0.197
NP_440557.1_1 Forward -214 -195 -0.983855 0.27
NP_440795.1_7 Forward -214 -207 14.6904 0.0123
NP_440795.1_7 Reverse -207 -214 14.6904 0.0123
NP_441418.1_6 Forward -108 -89 -12.6852 0.0683
NP_441418.1_6 Forward -215 -196 -19.8634 0.0979
NP_441418.1_6 Reverse -206 -225 -21.0434 0.136
NP_441418.1_6 Reverse -152 -171 -30.5815 0.286
NP_442291.1_7 Reverse -119 -133 9.63603 0.26
NP_440295.1_9 Reverse -321 -340 7.86593 0.089
NP_440897.1_6 Reverse -152 -171 7.17681 0.0874
NP_441453.1_1 Reverse -199 -217 10.4414 0.132
NP_441453.1_4 Reverse -206 -214 16.539 0.00633
NP_441453.1_4 Forward -215 -207 16.539 0.00633
NP_441453.1_4 Reverse -99 -107 14.7691 0.0119
NP_441453.1_4 Forward -108 -100 6.80426 0.121
NP_441453.1_7 Forward -224 -217 11.9372 0.298
NP_441623.1_1 Forward -167 -149 0.21581 0.227
NP_441623.1_1 Forward -168 -150 -0.0791831 0.228
NP_442151.1_4 Forward -310 -291 15.9291 0.294
NP_442151.1_6 Forward -215 -201 13.4709 0.0512
NP_442151.1_6 Reverse -206 -220 6.58777 0.228
NP_440561.1_4 Reverse -150 -169 12.6269 0.247
NP_441818.1_6 Reverse -199 -213 11.3077 0.253
NP_441818.1_9 Reverse -354 -373 -11.0136 0.3
NP_440226.1_1 Reverse -99 -118 7.86593 0.0975
NP_440226.1_1 Forward -215 -196 7.7676 0.1
NP_442169.1_1 Forward -138 -119 -0.983855 0.262
NP_441630.1_3 Forward -223 -204 7.86593 0.121
NP_442173.1_1 Forward -214 -206 15.4574 0.00633
NP_442173.1_1 Reverse -207 -215 15.4574 0.00633
NP_442173.1_1 Forward -107 -99 12.0158 0.0316
NP_442173.1_1 Reverse -100 -108 12.0158 0.0316
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_442752.1_4 Reverse -206 -213 13.8055 0.0199
NP_442752.1_4 Forward -108 -101 13.8055 0.0199
NP_442752.1_4 Forward -138 -131 5.25066 0.256
NP_442752.1_4 Forward -200 -193 4.95566 0.26
NP_443027.1_4 Reverse -204 -214 15.3197 0.0437
NP_441812.1_3 Forward -216 -202 7.9644 0.254
NP_442975.1_10 Reverse -202 -216 3.24392 0.26
NP_442975.1_10 Forward -219 -205 1.86729 0.29
NP_440784.1_7 Forward -214 -207 15.9687 0.0123
NP_440784.1_7 Reverse -207 -214 15.9687 0.0123
NP_440784.1_7 Forward -107 -100 6.23397 0.241
NP_440784.1_7 Reverse -100 -107 6.13563 0.241
NP_440061.1_9 Forward -110 -96 10.422 0.124
NP_440061.1_9 Forward -331 -317 5.89884 0.266
NP_440061.1_9 Reverse -204 -218 5.1122 0.294
NP_440061.1_9 Reverse -65 -79 4.91554 0.3
NP_440110.1_8 Reverse -348 -367 -3.3438 0.293
NP_441054.1_4 Forward -118 -100 -0.177514 0.18
NP_442062.1_8 Reverse -206 -216 17.6796 0.00193
NP_442062.1_8 Forward -215 -205 10.3048 0.0493
NP_442062.1_8 Forward -108 -98 8.23984 0.0793
NP_442062.1_8 Forward -138 -128 2.92996 0.292
NP_440761.1_4 Reverse -147 -166 -11.7019 0.196
NP_440304.1_4 Reverse -204 -214 18.9579 0.00406
NP_440304.1_4 Forward -217 -207 9.91146 0.051
NP_440304.1_4 Reverse -97 -107 8.1415 0.0859
NP_440304.1_4 Forward -121 -111 2.83163 0.299
NP_442242.1_4 Forward -214 -207 14.3954 0.0124
NP_442242.1_4 Reverse -207 -214 14.3954 0.0124
NP_440044.1_8 Forward -214 -195 2.26107 0.155
NP_440044.1_8 Forward -107 -88 -3.14714 0.28
NP_441035.1_3 Reverse -203 -222 7.96426 0.178
NP_442602.1_3 Forward -129 -110 -1.27885 0.237
NP_441208.1_9 Reverse -96 -110 18.9775 0.0647
NP_441208.1_9 Forward -218 -204 18.3875 0.0647
NP_441208.1_9 Reverse -183 -197 8.65272 0.219
NP_440132.1_1 Forward -217 -199 14.7688 0.118
NP_442110.1_7 Forward -215 -201 9.2427 0.0755
NP_441083.1_5 Reverse -206 -216 19.3512 0.000718
NP_441083.1_5 Forward -108 -98 16.7946 0.00546
NP_441083.1_5 Forward -215 -205 11.2881 0.0159
NP_441083.1_5 Reverse -99 -109 10.0098 0.0214
NP_441083.1_5 Forward -159 -149 1.84832 0.198
NP_441083.1_5 Forward -195 -185 -1.10161 0.295
NP_442827.1_8 Forward -223 -204 8.94676 0.0747
NP_442827.1_8 Reverse -198 -217 2.45694 0.159
NP_441434.1_7 Forward -213 -199 6.09611 0.225
NP_442245.1_6 Forward -143 -124 15.8307 0.232
NP_441738.1_2 Forward -213 -206 15.28 0.0102
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441738.1_2 Reverse -101 -108 15.28 0.0102
NP_441738.1_2 Reverse -69 -76 6.52862 0.261
NP_441558.1_5 Reverse -97 -116 12.4875 0.0677
NP_441558.1_5 Reverse -204 -223 10.9142 0.0895
NP_441558.1_5 Forward -217 -198 10.7175 0.0937
NP_440209.1_1 Reverse -206 -214 18.1123 0.00295
NP_440209.1_1 Forward -215 -207 18.1123 0.00295
NP_440209.1_1 Forward -108 -100 8.57422 0.0425
NP_440209.1_1 Reverse -99 -107 8.47588 0.0457
NP_442136.1_4 Reverse -101 -120 7.86512 0.295
NP_442889.1_8 Reverse -203 -217 9.24208 0.101
NP_440447.1_6 Forward -223 -205 0.314141 0.293
NP_441713.1_1 Reverse -200 -219 2.85105 0.0572
NP_441713.1_1 Reverse -93 -112 -7.27704 0.13
NP_441713.1_1 Forward -249 -230 -8.35868 0.148
NP_441713.1_1 Forward -114 -95 -12.6852 0.248
NP_440178.1_7 Forward -216 -197 -2.26216 0.0355
NP_440178.1_7 Forward -296 -277 -22.6167 0.268
NP_441716.1_1 Reverse -206 -220 13.8643 0.0689
NP_441716.1_1 Forward -108 -94 5.80112 0.216
NP_442111.1_4 Reverse -205 -219 13.4709 0.0383
NP_442111.1_4 Reverse -98 -112 9.83269 0.0575
NP_442111.1_4 Forward -109 -95 8.45605 0.0744
NP_441163.1_1 Forward -223 -206 3.97136 0.297
NP_440851.1_1 Reverse -57 -76 14.9449 0.257
NP_440906.1_5 Forward -214 -207 15.8704 0.0124
NP_440906.1_5 Reverse -207 -214 15.8704 0.0124
NP_440906.1_5 Forward -107 -100 6.23397 0.234
NP_440906.1_5 Reverse -100 -107 6.13563 0.241
NP_440747.1_10 Forward -111 -99 7.4138 0.00422
NP_440747.1_10 Forward -218 -206 5.54551 0.0128
NP_440747.1_10 Reverse -203 -215 -1.92764 0.0192
NP_440747.1_10 Reverse -96 -108 -2.02597 0.0196
NP_440747.1_10 Reverse -107 -119 -12.5474 0.297
NP_441130.1_10 Forward -217 -203 6.98109 0.173
NP_441130.1_10 Reverse -97 -111 4.32615 0.295
NP_441486.1_1 Reverse -203 -217 6.58777 0.0344
NP_441486.1_1 Forward -218 -204 -2.85201 0.175
NP_442634.1_2 Reverse -93 -112 0.687771 0.287
NP_442634.1_2 Forward -221 -202 0.0977854 0.293
NP_442634.1_4 Forward -110 -96 5.80112 0.051
NP_442634.1_4 Reverse -97 -111 4.62115 0.0764
NP_442634.1_4 Forward -217 -203 4.52282 0.0764
NP_442634.1_4 Reverse -204 -218 -3.63866 0.161
NP_441265.1_3 Reverse -93 -107 7.27608 0.181
NP_441265.1_3 Forward -221 -207 5.99778 0.181
NP_440842.1_6 Forward -217 -198 12.7816 0.242
NP_440842.1_10 Reverse -157 -171 14.4542 0.251
NP_440842.1_10 Forward -129 -115 9.63603 0.251
NP_441014.1_10 Reverse -190 -209 -1.08295 0.257
NP_442848.1_1 Reverse -200 -214 -4.32697 0.287
NP_443018.1_3 Forward -214 -207 14.8871 0.0123
NP_443018.1_3 Reverse -207 -214 14.8871 0.0123
NP_443018.1_3 Reverse -100 -107 11.7405 0.0655
NP_443018.1_3 Forward -107 -100 5.44732 0.193
NP_441316.1_7 Forward -217 -202 7.25639 0.107
NP_441316.1_7 Reverse -97 -112 4.79811 0.121
NP_441634.1_8 Forward -217 -203 -4.32697 0.295
NP_440376.1_1 Forward -215 -206 19.4693 0.000692
NP_440376.1_1 Reverse -206 -215 19.4693 0.000692
NP_440376.1_1 Forward -108 -99 15.7327 0.00625
NP_440376.1_1 Reverse -186 -195 11.6028 0.0241
NP_440376.1_1 Reverse -99 -108 9.63616 0.0385
NP_440376.1_1 Reverse -165 -174 3.04799 0.21
NP_440376.1_1 Reverse -366 -375 -1.18024 0.294
NP_441588.1_4 Forward -213 -203 6.66654 0.185
NP_442687.1_7 Forward -216 -206 18.5646 0.0028
NP_442687.1_7 Reverse -205 -215 9.02648 0.0994
NP_442687.1_7 Reverse -98 -108 8.73149 0.101
NP_442687.1_7 Forward -109 -99 6.76487 0.154
NP_442687.1_7 Forward -244 -234 5.48657 0.2
NP_442687.1_7 Forward -162 -152 4.10993 0.266
NP_442485.1_3 Reverse -323 -342 -2.45882 0.262
NP_441846.1_10 Reverse -324 -343 -21.83 0.256
NP_440642.1_10 Reverse -115 -129 12.2903 0.137
NP_441422.1_3 Forward -248 -229 17.9015 0.112
NP_441763.1_10 Reverse -195 -214 13.47 0.121
NP_440360.1_10 Reverse -119 -133 10.226 0.204
NP_440360.1_10 Forward -213 -199 4.03116 0.227
NP_442658.1_1 Reverse -204 -214 15.9091 0.00966
NP_442658.1_1 Forward -217 -207 14.8275 0.0188
NP_442658.1_1 Reverse -97 -107 8.04271 0.199
NP_442658.1_1 Reverse -127 -137 7.74772 0.209
NP_442658.1_1 Forward -197 -187 6.96107 0.214
NP_442658.1_9 Forward -251 -232 11.4058 0.286
NP_441855.2_4 Reverse -91 -110 9.33025 0.282
NP_442782.1_2 Reverse -326 -340 8.06273 0.202
NP_442782.1_2 Forward -138 -124 6.88276 0.217
NP_442782.1_2 Forward -302 -288 0.491246 0.289
NP_442782.1_2 Reverse -165 -179 -0.000409212 0.297
NP_442205.1_9 Reverse -200 -216 -1.21977 0.264
NP_441414.1_9 Forward -108 -89 -9.44032 0.259
NP_441414.1_9 Forward -215 -196 -10.227 0.279
NP_441256.1_8 Reverse -319 -338 2.75272 0.285
NP_442937.1_5 Forward -398 -379 6.39097 0.28
NP_442321.1_1 Reverse -204 -223 -0.590531 0.174
NP_442321.1_1 Reverse -150 -169 -8.752 0.295
NP_441958.1_2 Forward -224 -205 21.1406 0.147
NP_441958.1_3 Forward -371 -352 18.3873 0.216
NP_441958.1_5 Reverse -205 -215 21.2195 0.000805
NP_441958.1_5 Forward -216 -206 20.5312 0.000966
NP_441958.1_5 Forward -109 -99 18.9579 0.00183
NP_441958.1_5 Reverse -98 -108 10.6981 0.0112
NP_441127.1_1 Forward -242 -228 12.3893 0.215
NP_440203.1_5 Reverse -209 -219 9.81266 0.245
NP_440203.1_5 Reverse -69 -79 9.321 0.263
NP_439905.1_1 Forward -214 -201 9.45906 0.219
NP_439905.1_1 Reverse -100 -113 7.49244 0.258
NP_440995.1_8 Forward -225 -206 1.17943 0.264
NP_440984.1_7 Reverse -201 -215 10.4227 0.126
NP_439990.1_5 Forward -224 -211 13.4906 0.0942
NP_439990.1_5 Forward -113 -100 7.59077 0.19
NP_439990.1_5 Reverse -201 -214 5.32916 0.298
NP_441338.2_5 Forward -251 -232 4.62101 0.289
NP_442376.1_2 Reverse -94 -113 -1.47551 0.202
NP_442376.1_8 Reverse -229 -243 14.2576 0.124
NP_442911.1_2 Forward -118 -99 -2.95047 0.105
NP_442911.1_2 Reverse -89 -108 -9.047 0.249
NP_442911.1_2 Reverse -142 -161 -9.44032 0.257
NP_442911.1_2 Reverse -196 -215 -9.53865 0.258
NP_441580.1_6 Reverse -195 -214 1.17943 0.12
NP_441580.1_9 Reverse -132 -151 8.45592 0.273
NP_441591.1_10 Reverse -204 -223 16.4207 0.0704
NP_440993.1_2 Forward -354 -338 1.92682 0.272
NP_440993.1_2 Reverse -94 -110 1.43517 0.279
NP_440138.1_6 Forward -178 -159 1.96529 0.273
NP_440138.1_6 Reverse -55 -74 0.883656 0.291
NP_441099.1_5 Reverse -196 -215 -5.70374 0.153
NP_442002.1_9 Forward -216 -209 14.1004 0.074
NP_442002.1_9 Reverse -372 -379 11.3472 0.185
NP_441712.1_1 Reverse -12 -31 9.23101 0.289
NP_441294.1_7 Forward -219 -205 17.6976 0.00714
NP_441646.1_1 Forward -202 -183 8.75091 0.14
NP_441646.1_1 Forward -222 -203 4.62101 0.191
NP_442438.1_10 Reverse -288 -302 8.06273 0.0832
NP_442438.1_10 Reverse -201 -215 2.75286 0.168
NP_442431.1_10 Forward -74 -56 2.28076 0.241
NP_441292.1_2 Forward -226 -207 16.3224 0.0115
NP_442231.1_2 Reverse -351 -370 17.3859 0.202
NP_441000.1_6 Forward -216 -202 -4.03198 0.225
NP_441000.1_6 Reverse -205 -219 -5.01529 0.257
NP_441000.1_6 Reverse -98 -112 -5.31028 0.273
NP_440605.1_4 Forward -225 -206 13.0855 0.25
NP_442771.1_1 Reverse -150 -168 -8.92897 0.21
NP_440147.1_4 Forward -217 -204 22.0454 0.00117
NP_440147.1_4 Forward -110 -97 18.2105 0.00465
NP_440147.1_4 Reverse -204 -217 4.05085 0.173
NP_440147.1_4 Reverse -97 -110 1.19926 0.235
NP_441550.1_8 Reverse -97 -107 18.8591 0.00654
NP_441550.1_8 Forward -217 -207 17.6791 0.00754
NP_441550.1_8 Reverse -204 -214 17.4824 0.00754
NP_441550.1_8 Forward -110 -100 14.5325 0.0141
NP_441916.1_7 Forward -215 -205 18.9579 0.00144
NP_441916.1_7 Reverse -206 -216 16.893 0.00407
NP_441916.1_7 Reverse -99 -109 9.32148 0.037
NP_441916.1_7 Forward -108 -98 7.15819 0.0745
NP_441916.1_7 Forward -302 -292 1.84832 0.272
NP_441041.1_4 Forward -215 -196 -0.0988766 0.0928
NP_441041.1_4 Reverse -99 -118 -9.34199 0.215
NP_441041.1_7 Reverse -203 -215 18.3015 0.00558
NP_441041.1_7 Forward -218 -206 11.9849 0.0689
NP_441041.1_7 Forward -111 -99 9.74986 0.108
NP_441041.1_7 Reverse -96 -108 8.87526 0.128
NP_441547.1_1 Forward -132 -113 3.53937 0.24
NP_442004.1_6 Reverse -206 -220 8.65272 0.14
NP_442004.1_6 Forward -215 -201 5.89945 0.181
NP_441725.1_5 Reverse -207 -217 11.7798 0.0247
NP_441725.1_5 Forward -107 -97 9.02648 0.0553
NP_441725.1_5 Forward -214 -204 8.92815 0.0553
NP_439966.1_7 Reverse -204 -214 13.8442 0.0234
NP_439966.1_7 Reverse -97 -107 7.15773 0.154
NP_439966.1_7 Forward -110 -100 4.60114 0.265
NP_439966.1_9 Reverse -204 -213 0.983037 0.253
NP_442941.1_3 Forward -214 -204 10.9931 0.0116
NP_442941.1_3 Reverse -100 -110 9.41981 0.0319
NP_442941.1_3 Reverse -207 -217 2.53664 0.14
NP_440289.1_2 Reverse -203 -216 14.5723 0.0107
NP_440289.1_2 Forward -218 -205 -2.34066 0.254
NP_440289.1_2 Forward -111 -98 -3.71729 0.267
NP_440289.1_2 Reverse -96 -109 -5.19226 0.3
NP_440260.1_8 Forward -224 -206 -5.09406 0.273
NP_442281.1_1 Reverse -201 -215 12.9786 0.0319
NP_442281.1_1 Reverse -94 -108 9.43874 0.0703
NP_442281.1_1 Reverse -124 -138 3.04726 0.246
NP_441334.1_7 Reverse -204 -223 -1.96717 0.0655
NP_441334.1_7 Forward -217 -198 -18.4868 0.275
NP_441334.1_7 Forward -110 -91 -20.0601 0.275
NP_442575.1_8 Reverse -264 -283 -5.60541 0.269
NP_440437.1_1 Forward -221 -202 -3.14714 0.232
NP_440647.1_9 Reverse -97 -115 2.28076 0.295
NP_442012.1_1 Reverse -200 -219 5.30933 0.153
NP_442012.1_1 Forward -144 -125 -0.39387 0.259
NP_441087.1_6 Forward -343 -325 8.47483 0.218
NP_441556.1_7 Forward -226 -207 -0.591301 0.3
NP_440498.1_1 Reverse -197 -215 0.609134 0.214
NP_441644.1_6 Forward -215 -205 19.0557 0.000803
NP_441644.1_6 Reverse -99 -109 18.7607 0.00127
NP_441644.1_6 Reverse -206 -216 15.7125 0.0048
NP_441644.1_6 Forward -108 -98 6.0761 0.167
NP_442215.1_2 Reverse -204 -220 -4.46469 0.233
NP_442215.1_2 Forward -71 -55 -6.13632 0.264
NP_442215.1_2 Forward -331 -315 -6.62797 0.277
NP_442215.1_2 Reverse -108 -124 -7.41462 0.294
NP_442029.1_6 Forward -251 -232 2.94938 0.286
NP_442029.1_10 Forward -332 -313 4.03102 0.295
NP_442247.1_10 Forward -231 -212 14.2574 0.277
NP_440929.1_8 Forward -215 -206 19.2726 0.000701
NP_440929.1_8 Reverse -206 -215 19.2726 0.000701
NP_440929.1_8 Reverse -99 -108 16.5193 0.00413
NP_440929.1_8 Forward -108 -99 9.53783 0.0296
NP_442933.1_10 Forward -215 -206 17.601 0.00325
NP_442933.1_10 Reverse -206 -215 17.601 0.00325
NP_442933.1_10 Reverse -99 -108 8.06287 0.0885
NP_442933.1_10 Forward -108 -99 7.96454 0.0937
NP_440430.1_5 Forward -315 -296 11.2092 0.262
NP_441751.2_8 Forward -214 -200 10.1277 0.0295
NP_441751.2_8 Forward -107 -93 5.50613 0.0423
NP_441751.2_8 Reverse -100 -114 2.65453 0.0782
NP_441751.2_8 Reverse -207 -221 -3.24533 0.137
NP_442554.1_8 Forward -214 -204 19.1546 0.00369
NP_442554.1_8 Forward -107 -97 14.6313 0.0129
NP_442554.1_8 Reverse -207 -217 14.238 0.0144
NP_442554.1_8 Reverse -100 -110 7.45319 0.092
NP_442554.1_8 Reverse -153 -163 1.84832 0.292
NP_441762.1_7 Forward -216 -204 11.1504 0.0142
NP_441762.1_7 Reverse -205 -217 0.432302 0.0747
NP_441762.1_7 Forward -109 -97 -7.04085 0.285
NP_442142.1_4 Reverse -96 -109 5.23026 0.197
NP_442142.1_4 Reverse -203 -216 4.93527 0.206
NP_442142.1_4 Forward -218 -205 3.36198 0.258
NP_442292.1_1 Forward -214 -205 17.5026 0.00435
NP_442292.1_1 Reverse -207 -216 9.53783 0.0183
NP_442292.1_1 Reverse -100 -109 7.66954 0.0634
NP_442292.1_1 Forward -107 -98 -0.196935 0.239
NP_440895.1_6 Forward -114 -101 10.8357 0.202
NP_441711.1_4 Forward -153 -134 3.34271 0.25
NP_441523.1_6 Reverse -95 -114 5.60432 0.234
NP_443009.1_5 Reverse -205 -216 17.0694 0.00659
NP_443009.1_5 Forward -216 -205 16.7744 0.00677
NP_443009.1_5 Forward -109 -98 7.33466 0.132
NP_443009.1_5 Reverse -98 -109 7.138 0.137
NP_443009.1_5 Forward -139 -128 3.5981 0.286
NP_440397.1_3 Reverse -175 -194 13.8641 0.216
NP_440947.1_7 Forward -229 -210 9.3409 0.178
NP_441715.1_4 Forward -214 -204 7.25653 0.108
NP_441715.1_4 Reverse -100 -110 6.96153 0.121
NP_440357.1_3 Forward -217 -198 10.6192 0.203
NP_440357.1_6 Forward -183 -164 4.42435 0.293
NP_440015.1_9 Forward -382 -364 6.01734 0.123
NP_441448.1_1 Reverse -159 -178 10.9142 0.188
NP_441448.1_1 Forward -64 -45 8.16093 0.21
NP_441448.1_1 Reverse -318 -337 5.40766 0.261
NP_440183.1_1 Forward -214 -195 11.0125 0.244
NP_441198.1_8 Reverse -204 -214 15.4199 0.0427
NP_441198.1_8 Forward -217 -207 12.5877 0.12
NP_441468.1_1 Forward -214 -207 15.8704 0.0124
NP_441468.1_1 Reverse -207 -214 15.8704 0.0124
NP_441468.1_1 Forward -107 -100 6.13563 0.209
NP_441468.1_1 Reverse -100 -107 6.0373 0.223
NP_441020.2_6 Forward -217 -200 15.9685 0.034
NP_441020.2_6 Forward -110 -93 10.4619 0.142
NP_441015.1_10 Reverse -201 -220 -7.08038 0.262
NP_441015.1_10 Reverse -147 -166 -11.3086 0.294
NP_441673.1_1 Forward -215 -206 20.8459 0.000698
NP_441673.1_1 Reverse -206 -215 20.8459 0.000698
NP_441673.1_1 Forward -108 -99 11.1111 0.0121
NP_441673.1_1 Reverse -99 -108 11.0128 0.018
NP_441876.1_9 Reverse -121 -131 16.0075 0.267
NP_441876.1_9 Reverse -1 -11 10.4026 0.293
NP_441826.1_2 Reverse -93 -107 0.392915 0.187
NP_441637.1_4 Forward -239 -221 19.4402 0.15
NP_442490.1_9 Forward -138 -119 -5.21209 0.273
NP_442868.1_6 Forward -217 -207 9.12481 0.0539
NP_442868.1_6 Reverse -204 -214 8.63316 0.0555
NP_442868.1_6 Reverse -97 -107 6.96153 0.0919
NP_442868.1_6 Forward -110 -100 0.668351 0.213
NP_442719.1_2 Reverse -224 -242 -2.34152 0.186
NP_442719.1_2 Reverse -225 -243 -10.3063 0.272
NP_442719.1_2 Forward -239 -221 -11.6829 0.294
NP_442227.1_2 Forward -333 -314 1.96607 0.241
NP_442227.1_2 Forward -375 -356 1.27776 0.249
NP_442227.1_2 Forward -380 -361 -2.36049 0.272
NP_443058.1_7 Reverse -98 -117 2.94938 0.279
NP_442427.1_8 Reverse -197 -216 6.09597 0.249
NP_442808.1_1 Reverse -98 -108 9.321 0.0481
NP_442808.1_1 Reverse -205 -215 8.73102 0.0481
NP_442808.1_1 Forward -216 -206 8.73102 0.0481
NP_442808.1_1 Forward -153 -143 4.50281 0.197
NP_442808.1_1 Forward -152 -142 4.50281 0.197
NP_442808.1_1 Reverse -242 -252 4.20782 0.203
NP_441101.1_10 Forward -112 -93 0.196116 0.18
NP_442542.1_2 Reverse -150 -163 9.16406 0.139
NP_442542.1_2 Reverse -97 -110 8.67241 0.152
NP_442542.1_9 Reverse -199 -213 8.94708 0.144
NP_442050.1_5 Reverse -204 -214 17.1874 0.00812
NP_442050.1_5 Reverse -97 -107 12.7626 0.0516
NP_442050.1_5 Forward -197 -187 7.74772 0.243
NP_442050.1_5 Forward -217 -207 6.96107 0.27
NP_442342.1_9 Reverse -97 -113 4.3851 0.25
NP_442342.1_9 Forward -217 -201 3.69678 0.258
NP_441114.1_3 Forward -391 -382 6.98123 0.254
NP_441114.1_3 Reverse -130 -139 6.39124 0.277
NP_440111.2_2 Reverse -124 -143 -4.72043 0.292
NP_442789.1_4 Reverse -321 -340 -1.86883 0.229
NP_442789.1_4 Forward -217 -198 -4.6221 0.261
NP_441518.1_3 Reverse -196 -215 -5.50708 0.124
NP_441878.1_6 Forward -216 -206 20.2362 0.0046
NP_441878.1_6 Reverse -205 -215 10.5014 0.0176
NP_441878.1_6 Reverse -98 -108 10.4031 0.0176
NP_441878.1_6 Reverse -151 -161 2.24165 0.0462
NP_441878.1_6 Forward -162 -152 1.25834 0.108
NP_441878.1_6 Forward -109 -99 0.766681 0.134
NP_441036.1_8 Reverse -205 -215 15.713 0.00724
NP_441036.1_8 Forward -109 -99 14.4347 0.0234
NP_441036.1_8 Forward -216 -206 8.4365 0.174
NP_441557.1_2 Reverse -61 -79 14.2771 0.288
NP_441557.1_5 Forward -215 -206 19.9609 0.000699
NP_441557.1_5 Reverse -206 -215 19.9609 0.000699
NP_441557.1_5 Forward -108 -99 10.2261 0.0144
NP_441557.1_5 Reverse -99 -108 10.1278 0.0188
NP_441445.1_1 Reverse -143 -162 5.80098 0.163
NP_441445.1_1 Forward -224 -205 5.211 0.175
NP_441445.1_1 Reverse -90 -109 4.12936 0.2
NP_441445.1_1 Reverse -177 -196 -0.295539 0.289
NP_442066.2_4 Forward -108 -89 -2.65548 0.214
NP_442066.2_9 Reverse -202 -215 19.3905 0.00844
NP_440738.1_5 Forward -359 -340 1.47442 0.289
NP_441739.1_2 Reverse -110 -126 2.31948 0.288
NP_441308.1_8 Reverse -204 -214 12.4681 0.218
NP_440101.1_3 Forward -220 -201 2.26107 0.259
NP_442192.1_7 Reverse -149 -167 14.6705 0.299
NP_442183.1_1 Forward -215 -201 18.9775 0.0065
NP_442183.1_1 Forward -108 -94 6.29277 0.18
NP_440676.1_7 Reverse -102 -121 23.4022 0.00997
NP_440356.1_2 Reverse -95 -114 1.17943 0.263
NP_442135.1_8 Reverse -195 -213 8.86894 0.284
NP_442444.1_6 Reverse -198 -216 14.4682 0.21
NP_441549.1_9 Forward -112 -94 -5.68405 0.198
NP_441549.1_9 Reverse -202 -220 -6.86402 0.206
NP_441549.1_9 Forward -219 -201 -7.15901 0.206
NP_441549.1_9 Reverse -182 -200 -9.12563 0.242
NP_442347.1_2 Forward -214 -205 3.34298 0.284
NP_442347.1_2 Reverse -207 -216 3.34298 0.284
NP_442645.1_2 Forward -77 -58 -17.1101 0.248
NP_441037.1_4 Forward -217 -207 17.3558 0.0127
NP_441037.1_4 Reverse -204 -214 16.5761 0.0168
NP_441037.1_4 Reverse -97 -107 14.9194 0.028
NP_441037.1_4 Reverse -150 -160 9.07193 0.235
NP_442594.1_8 Reverse -318 -337 9.3409 0.196
NP_442594.1_8 Reverse -317 -336 1.96607 0.295
NP_441633.1_3 Forward -110 -97 5.72248 0.0481
NP_441633.1_3 Forward -217 -204 3.65753 0.0699
NP_441633.1_3 Reverse -204 -217 -3.71729 0.177
NP_440136.1_2 Forward -214 -207 15.9687 0.0123
NP_440136.1_2 Reverse -207 -214 15.9687 0.0123
NP_440136.1_2 Forward -107 -100 6.23397 0.171
NP_440136.1_2 Reverse -100 -107 6.13563 0.193
NP_442590.1_10 Forward -222 -203 11.1109 0.168
NP_442998.1_10 Forward -213 -206 15.5754 0.0102
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_442998.1_10 Reverse -101 -108 15.5754 0.0102
NP_442998.1_10 Forward -106 -99 5.84064 0.235
NP_440899.1_8 Reverse -224 -243 -11.2103 0.299
NP_440299.1_1 Forward -219 -206 12.9984 0.0319
NP_440299.1_1 Forward -165 -152 12.5067 0.0369
NP_440299.1_1 Forward -142 -129 5.23026 0.184
NP_440299.1_1 Reverse -95 -108 5.23026 0.184
NP_441799.1_1 Forward -219 -205 20.5501 0.00485
NP_441799.1_1 Reverse -95 -109 11.602 0.0558
NP_441799.1_1 Reverse -202 -216 7.17714 0.149
NP_441799.1_9 Forward -375 -356 -4.32711 0.256
NP_441007.1_10 Reverse -201 -214 23.9137 0.00218
NP_441007.1_10 Reverse -94 -107 -0.570702 0.287
NP_442334.1_1 Reverse -194 -213 -5.80207 0.268
NP_442201.1_10 Forward -226 -207 -9.93197 0.25
NP_440256.1_1 Forward -111 -92 -3.04881 0.126
NP_440256.1_1 Reverse -203 -222 -7.27704 0.232
NP_441512.1_4 Forward -219 -200 8.06259 0.264
NP_441559.1_8 Reverse -229 -243 4.81781 0.108
NP_441559.1_8 Forward -113 -99 1.17956 0.156
NP_441559.1_8 Forward -220 -206 0.491246 0.166
NP_441559.1_8 Reverse -124 -138 -6.49025 0.279
NP_441559.1_8 Reverse -181 -195 -7.17857 0.287
NP_440915.1_6 Reverse -202 -216 12.1926 0.0218
NP_440915.1_6 Reverse -95 -109 11.701 0.0253
NP_440915.1_6 Forward -112 -98 8.75105 0.0507
NP_440915.1_6 Forward -219 -205 4.12949 0.0999
NP_440915.1_6 Reverse -125 -139 -2.55701 0.276
NP_440997.1_6 Reverse -201 -220 8.35759 0.276
NP_442785.1_7 Reverse -204 -218 11.5043 0.228
NP_441464.1_8 Forward -161 -147 17.5025 0.072
NP_441464.1_8 Reverse -206 -220 15.2409 0.104
NP_441464.1_8 Forward -215 -201 9.14437 0.192
NP_441464.1_8 Forward -108 -94 5.50613 0.253
NP_440695.1_6 Forward -119 -105 14.1927 0.217
NP_441939.1_3 Forward -214 -195 12.8808 0.0961
NP_441199.1_6 Forward -219 -200 1.37609 0.22
NP_441494.1_6 Reverse -201 -214 9.55739 0.227
NP_442993.1_1 Forward -215 -199 -3.38305 0.13
NP_440677.1_1 Reverse -197 -216 6.88262 0.247
NP_442386.1_9 Forward -216 -207 6.39082 0.219
NP_442386.1_9 Reverse -205 -214 6.39082 0.219
NP_440570.1_5 Forward -373 -354 2.26107 0.234
NP_441750.1_4 Reverse -131 -150 2.3594 0.26
NP_441340.1_5 Forward -214 -207 15.6737 0.0124
NP_441340.1_5 Reverse -207 -214 15.6737 0.0124
NP_441340.1_5 Forward -107 -100 13.5105 0.0314
NP_441340.1_5 Reverse -100 -107 5.84064 0.208
NP_441947.1_4 Forward -226 -207 14.5524 0.168
NP_442791.1_5 Forward -223 -204 -8.65367 0.279
NP_440586.1_8 Forward -214 -207 13.2151 0.026
NP_440586.1_8 Reverse -207 -214 13.2151 0.026
NP_440586.1_8 Reverse -100 -107 9.47853 0.146
NP_440586.1_8 Forward -107 -100 5.74197 0.283
NP_442251.1_6 Forward -214 -207 15.2804 0.0124
NP_442251.1_6 Reverse -207 -214 15.2804 0.0124
NP_440192.1_4 Reverse -231 -250 12.9873 0.169
NP_441262.1_3 Reverse -206 -213 14.7888 0.0223
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_441262.1_3 Forward -108 -101 14.7888 0.0223
NP_443051.1_1 Reverse -205 -214 19.5676 0.00335
NP_443051.1_1 Forward -216 -207 18.0926 0.00402
NP_443051.1_1 Forward -109 -100 16.6177 0.00754
NP_443051.1_1 Reverse -98 -107 8.25953 0.0414
NP_439937.1_9 Forward -162 -145 10.8545 0.0407
NP_439937.1_9 Reverse -232 -249 4.16803 0.0798
NP_439937.1_9 Reverse -205 -222 -4.97671 0.157
NP_439937.1_9 Reverse -124 -141 -11.2699 0.248
NP_439937.1_9 Forward -337 -320 -14.4164 0.287
NP_439937.1_9 Forward -109 -92 -14.8098 0.287
NP_439937.1_9 Reverse -98 -115 -15.7931 0.287
NP_440439.1_1 Forward -111 -98 17.8172 0.0105
NP_440439.1_1 Reverse -203 -216 12.3107 0.0255
NP_440439.1_1 Reverse -96 -109 6.1158 0.0818
NP_440439.1_1 Forward -218 -205 2.37923 0.135
NP_440439.1_1 Reverse -286 -299 -1.45568 0.269
NP_440372.1_2 Forward -214 -207 16.3621 0.0124
NP_440372.1_2 Reverse -207 -214 16.3621 0.0124
NP_440372.1_2 Forward -107 -100 13.8055 0.0214
NP_440372.1_2 Reverse -100 -107 6.52896 0.188
NP_440171.1_3 Reverse -322 -341 13.6675 0.177
NP_442783.1_8 Reverse -237 -256 16.7149 0.184
NP_440819.1_5 Forward -234 -226 7.59091 0.272
NP_441803.1_2 Reverse -201 -220 1.86774 0.223
NP_439977.1_5 Reverse -200 -219 4.42435 0.153
NP_439977.1_5 Forward -114 -95 -0.295539 0.222
NP_441572.1_7 Reverse -200 -219 5.11266 0.0892
NP_441572.1_7 Forward -114 -95 2.55606 0.131
NP_442384.1_10 Reverse -206 -219 18.6038 0.00417
NP_442384.1_10 Reverse -99 -112 13.884 0.018
NP_442384.1_10 Reverse -129 -142 12.3107 0.0292
NP_442384.1_10 Forward -108 -95 1.19926 0.267
NP_441018.1_7 Forward -142 -123 17.3057 0.069
NP_442790.1_4 Reverse -90 -109 -11.4069 0.226
NP_442262.1_10 Forward -214 -207 14.1988 0.0123
NP_442262.1_10 Reverse -207 -214 14.1988 0.0123
NP_442262.1_10 Reverse -100 -107 13.2155 0.0213
NP_441689.1_5 Reverse -204 -214 8.43603 0.132
NP_441689.1_5 Forward -110 -100 5.78111 0.197
NP_442244.1_3 Forward -302 -283 4.52268 0.259
NP_440163.1_10 Reverse -290 -300 8.73149 0.262
NP_440344.1_10 Reverse -199 -216 -1.92778 0.0588
NP_440344.1_10 Forward -222 -205 -4.38605 0.0956
NP_440344.1_10 Reverse -92 -109 -13.3342 0.282
NP_440282.1_10 Reverse -196 -215 -3.93378 0.25
NP_440531.1_6 Reverse -198 -217 5.211 0.116
NP_440531.1_6 Forward -223 -204 -1.18052 0.229
NP_442123.1_3 Forward -215 -196 20.944 0.0407
NP_441060.1_3 Reverse -359 -378 9.53756 0.226
NP_440826.1_1 Forward -187 -168 25.6629 0.00679
NP_440826.1_4 Forward -202 -189 20.4715 0.112
NP_440826.1_8 Forward -265 -246 18.0924 0.207
NP_442529.1_4 Reverse -90 -109 9.43923 0.235
NP_442693.1_6 Reverse -93 -112 4.81767 0.278
NP_440297.1_9 Reverse -207 -217 9.61647 0.0917
NP_440297.1_9 Reverse -153 -163 6.76487 0.17
NP_440297.1_9 Forward -107 -97 -0.216628 0.282
NP_440297.1_9 Forward -214 -204 -0.314959 0.282
NP_440350.1_1 Reverse -307 -326 -4.91709 0.264
NP_441896.1_3 Reverse -197 -216 4.52268 0.142
NP_441896.1_3 Forward -224 -205 -0.4922 0.241
NP_440990.1_4 Reverse -201 -220 13.0775 0.288
NP_442078.1_9 Forward -161 -144 13.3135 0.251
NP_440999.1_9 Reverse -202 -216 8.65272 0.0738
NP_440888.1_2 Forward -215 -201 14.5519 0.0168
NP_440888.1_2 Reverse -186 -200 11.7003 0.0611
NP_440888.1_2 Reverse -99 -113 8.65209 0.152
NP_440888.1_2 Forward -295 -281 7.07881 0.208
NP_440491.1_1 Forward -218 -199 7.69667 0.261
NP_439969.1_1 Forward -330 -311 -4.03212 0.288
NP_442277.1_4 Forward -224 -205 3.14526 0.228
NP_442033.1_10 Reverse -231 -250 -2.36049 0.151
NP_442033.1_10 Reverse -232 -251 -6.88371 0.186
NP_442033.1_10 Reverse -97 -116 -12.5869 0.273
NP_442033.1_10 Reverse -204 -223 -12.8819 0.277
NP_441543.1_2 Forward -214 -205 15.9293 0.00518
NP_441543.1_2 Reverse -207 -216 9.34117 0.0818
NP_441543.1_2 Reverse -100 -109 6.09625 0.153
NP_442845.1_2 Reverse -200 -214 6.98109 0.199
NP_442845.1_2 Forward -114 -100 4.52282 0.258
NP_442845.1_2 Reverse -152 -166 4.32615 0.261
NP_441834.1_7 Reverse -194 -213 16.4207 0.209
NP_441304.1_10 Forward -122 -113 13.5694 0.239
NP_441551.1_5 Reverse -95 -111 18.0524 0.038
NP_441551.1_5 Forward -219 -203 7.33433 0.249
NP_441178.1_6 Forward -375 -356 1.6703 0.279
NP_441469.1_8 Forward -216 -207 13.3727 0.073
NP_441469.1_8 Reverse -205 -214 6.5879 0.227
NP_442315.1_2 Reverse -145 -157 8.88877 0.292
NP_443064.1_6 Reverse -206 -216 13.8273 0.0796
NP_443064.1_6 Forward -108 -98 12.6639 0.0796
NP_443064.1_6 Forward -215 -205 10.8217 0.13
NP_443064.1_6 Reverse -99 -109 8.6886 0.276
NP_442578.1_7 Forward -214 -207 14.5921 0.026
NP_442578.1_7 Reverse -207 -214 14.5921 0.026
NP_442578.1_7 Reverse -294 -301 9.97054 0.112
NP_442578.1_7 Forward -107 -100 6.0373 0.18
NP_440710.1_1 Reverse -198 -216 -7.84733 0.245
NP_440710.1_1 Forward -169 -151 -8.63398 0.273
NP_441462.1_2 Forward -215 -205 20.2362 0.000805
NP_441462.1_2 Reverse -206 -216 20.1379 0.000967
NP_441462.1_2 Forward -108 -98 18.3679 0.0036
NP_441462.1_2 Reverse -99 -109 10.4031 0.011
NP_441621.1_7 Reverse -97 -111 2.65453 0.123
NP_441621.1_7 Forward -217 -203 2.5562 0.123
NP_443062.1_1 Forward -108 -90 5.13317 0.238
NP_443062.1_1 Forward -215 -197 4.64563 0.255
NP_443062.1_1 Reverse -99 -117 4.35311 0.264
NP_443062.1_6 Forward -223 -204 4.22769 0.221
NP_443062.1_6 Reverse -226 -245 2.55606 0.253
NP_442204.1_1 Forward -112 -101 11.2684 0.0565
NP_441560.1_10 Forward -223 -204 15.6341 0.0898
NP_441560.1_10 Reverse -91 -110 15.0441 0.097
NP_442487.1_5 Reverse -205 -224 3.14526 0.289
NP_440516.1_8 Forward -215 -206 16.9127 0.00442
NP_440516.1_8 Reverse -206 -215 16.9127 0.00442
NP_440516.1_8 Forward -108 -99 16.9127 0.00442
NP_440516.1_8 Reverse -99 -108 14.8477 0.00685
NP_442428.1_5 Forward -214 -207 15.8704 0.0124
NP_442428.1_5 Reverse -207 -214 15.8704 0.0124
NP_442428.1_5 Forward -107 -100 6.13563 0.209
NP_442428.1_5 Reverse -100 -107 6.0373 0.212
NP_440618.1_1 Forward -237 -218 -2.0655 0.182
NP_442823.1_8 Forward -46 -27 11.8975 0.275
NP_441867.1_2 Forward -135 -116 -20.65 0.292
NP_440673.1_3 Forward -213 -206 12.4288 0.0426
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_440673.1_3 Reverse -101 -108 12.4288 0.0426
NP_440673.1_3 Forward -391 -384 8.29892 0.221
NP_440865.1_9 Reverse -200 -219 -7.96535 0.254
NP_441052.1_2 Forward -215 -205 10.4031 0.0285
NP_441052.1_2 Reverse -206 -216 10.4031 0.0285
NP_441052.1_2 Forward -108 -98 0.865012 0.256
NP_441052.1_2 Reverse -99 -109 0.57002 0.256
NP_441052.1_2 Forward -195 -185 -0.806614 0.299
NP_442219.1_8 Reverse -148 -167 9.9065 0.219
NP_442219.1_9 Forward -214 -205 8.25953 0.0681
NP_442219.1_9 Reverse -207 -216 8.25953 0.0681
NP_440436.1_4 Reverse -207 -216 15.9289 0.00508
NP_440436.1_4 Forward -214 -205 9.24241 0.0871
NP_440436.1_4 Forward -107 -98 6.39082 0.162
NP_441884.1_9 Reverse -203 -222 -11.6036 0.12
NP_441884.1_9 Forward -218 -199 -14.9469 0.138
NP_441884.1_9 Forward -179 -160 -22.5183 0.281
NP_440314.1_9 Reverse -100 -119 -9.14533 0.26
NP_440648.1_1 Forward -215 -196 7.86593 0.189
NP_442414.1_8 Reverse -311 -330 5.80098 0.293
NP_441719.1_4 Forward -214 -207 16.3621 0.0124
NP_441719.1_4 Reverse -207 -214 16.3621 0.0124
NP_441719.1_4 Forward -107 -100 6.82395 0.0855
NP_441719.1_4 Reverse -100 -107 6.52896 0.188
NP_441733.1_10 Reverse -203 -216 16.3422 0.047
NP_441004.1_1 Reverse -320 -339 0.392778 0.117
NP_441004.1_1 Reverse -188 -207 -12.9802 0.251
NP_442813.1_2 Reverse -106 -125 0.58944 0.273
NP_442813.1_4 Reverse -134 -153 7.07928 0.173
NP_442813.1_4 Reverse -42 -61 -5.21209 0.299
NP_442366.1_5 Forward -218 -208 17.2858 0.0141
NP_442366.1_5 Forward -141 -131 12.0743 0.147
NP_442873.1_3 Reverse -196 -215 4.81688 0.262
NP_440296.1_10 Reverse -149 -168 -5.60541 0.225
NP_441115.1_4 Reverse -205 -223 7.49153 0.286
NP_442694.1_4 Reverse -221 -230 12.9794 0.225
NP_442206.1_1 Forward -215 -196 -11.7019 0.22
NP_442206.1_10 Reverse -99 -114 2.5365 0.201
NP_443054.1_2 Forward -217 -203 4.81781 0.24
NP_443054.1_2 Reverse -204 -218 -0.492064 0.295
NP_442430.1_10 Reverse -196 -215 9.93006 0.277
NP_442308.1_4 Reverse -200 -219 1.76941 0.267
NP_441851.1_10 Forward -216 -206 17.4829 0.0027
NP_441851.1_10 Reverse -205 -215 8.53483 0.114
NP_441851.1_10 Reverse -98 -108 7.64985 0.135
NP_442622.1_8 Reverse -206 -224 -18.3687 0.205
NP_442011.1_1 Forward -109 -90 5.70265 0.196
NP_442515.1_1 Forward -216 -202 6.3911 0.0977
NP_442515.1_1 Forward -162 -148 3.73617 0.115
NP_442515.1_1 Reverse -205 -219 -3.73699 0.297
NP_440593.1_3 Forward -143 -124 -4.6221 0.251
NP_441540.1_5 Reverse -19 -37 15.7513 0.237
NP_441982.1_6 Forward -235 -226 13.5358 0.274
NP_440165.1_5 Forward -109 -90 9.83255 0.0603
NP_442709.1_3 Reverse -92 -111 7.7676 0.121
NP_441046.1_2 Reverse -219 -238 0.786102 0.262
NP_440338.1_4 Forward -42 -23 6.09517 0.292
NP_441349.1_10 Forward -225 -206 -6.29373 0.226
NP_441349.1_10 Reverse -176 -195 -9.63698 0.297
NP_441409.1_6 Forward -114 -95 -6.78538 0.136
NP_441409.1_6 Forward -221 -202 -9.44032 0.184
NP_440432.1_9 Forward -214 -199 8.63302 0.0427
NP_442843.1_1 Forward -260 -241 -2.16383 0.203
NP_442843.1_1 Forward -125 -106 -11.0136 0.285
NP_442843.1_1 Forward -143 -124 -11.2103 0.286
NP_442843.1_1 Reverse -321 -340 -11.6036 0.291
NP_442944.1_10 Forward -342 -323 7.07928 0.269
NP_440474.1_8 Forward -214 -200 16.9119 0.0468
NP_442450.1_5 Forward -217 -207 17.3846 0.0267
NP_440195.1_5 Reverse -200 -219 11.4058 0.161
NP_442006.1_2 Reverse -354 -371 -16.4808 0.254
NP_440483.1_1 Reverse -313 -332 -8.65367 0.292
NP_441570.1_1 Forward -215 -197 0.510803 0.0391
NP_441570.1_1 Reverse -206 -224 -5.19239 0.0752
NP_441570.1_1 Forward -108 -90 -9.51896 0.139
NP_441570.1_1 Reverse -135 -153 -10.5023 0.171
NP_441570.1_1 Forward -144 -126 -17.7788 0.291
NP_441078.1_4 Forward -215 -206 19.6659 0.0007
NP_441078.1_4 Reverse -206 -215 19.6659 0.0007
NP_441078.1_4 Forward -108 -99 9.93116 0.0203
NP_441078.1_4 Reverse -99 -108 9.83282 0.0226
NP_441078.1_4 Reverse -152 -161 6.09625 0.0863
NP_441078.1_4 Forward -195 -186 -1.57357 0.266
NP_441078.1_4 Forward -161 -152 -1.86856 0.272
NP_442729.1_8 Forward -165 -152 6.01747 0.217
NP_441663.1_8 Forward -114 -95 -0.688862 0.232
NP_441663.1_8 Reverse -93 -112 -2.45882 0.268
NP_442348.1_2 Reverse -220 -229 7.47288 0.28
NP_442348.1_2 Reverse -339 -348 6.78456 0.299
NP_442443.1_1 Reverse -144 -163 -0.000545616 0.219
NP_442443.1_1 Reverse -321 -340 -6.39206 0.294
NP_440526.1_3 Forward -214 -203 11.6612 0.0646
NP_440526.1_3 Forward -107 -96 9.20294 0.0958
NP_440526.1_3 Reverse -207 -218 1.6315 0.267
NP_441432.1_8 Reverse -205 -214 16.8143 0.00595
NP_441432.1_8 Forward -109 -100 14.0611 0.0258
NP_441432.1_8 Forward -216 -207 8.35786 0.0755
NP_442320.1_8 Reverse -200 -214 -1.27871 0.0817
NP_442344.1_7 Forward -214 -195 0.786102 0.0908
NP_441732.1_2 Forward -219 -203 -7.51295 0.0859
NP_441732.1_2 Reverse -202 -218 -15.2811 0.145
NP_441732.1_2 Forward -112 -96 -16.3627 0.165
NP_441732.1_2 Forward -165 -149 -16.7561 0.195
NP_441732.1_5 Forward -166 -152 11.3077 0.21
NP_440497.1_2 Forward -143 -124 3.6377 0.293
NP_442003.1_9 Forward -214 -195 2.75272 0.292
NP_442815.1_2 Forward -244 -226 6.11567 0.212
NP_440760.1_1 Forward -215 -196 -12.6852 0.0945
NP_440760.1_1 Reverse -206 -225 -21.1417 0.231
NP_442797.1_7 Forward -168 -150 -0.570838 0.284
NP_442274.1_6 Forward -146 -127 17.8957 0.167
NP_440913.1_1 Forward -217 -199 4.14905 0.279
NP_440713.1_4 Reverse -356 -375 5.40766 0.21
NP_440713.1_4 Reverse -176 -195 4.03102 0.231
NP_440713.1_4 Reverse -89 -108 2.85105 0.256
NP_440713.1_4 Reverse -196 -215 2.55606 0.26
NP_442489.1_7 Forward -215 -206 20.1576 0.000695
NP_442489.1_7 Reverse -206 -215 20.1576 0.000695
NP_442489.1_7 Reverse -99 -108 10.5211 0.0102
NP_442489.1_7 Forward -108 -99 10.4228 0.0151
NP_442489.1_7 Reverse -186 -195 -1.6719 0.235
NP_442489.1_7 Reverse -152 -161 -1.6719 0.235
NP_442079.1_7 Forward -107 -88 4.62101 0.189
NP_442079.1_7 Forward -214 -195 3.44104 0.212
NP_440559.1_1 Reverse -207 -216 17.306 0.00658
NP_440559.1_1 Forward -107 -98 14.5527 0.0154
NP_440559.1_1 Forward -214 -205 8.65285 0.0586
NP_441659.2_8 Forward -215 -205 20.9245 0.000805
NP_441659.2_8 Reverse -206 -216 19.3512 0.000966
NP_441659.2_8 Reverse -99 -109 17.7779 0.00179
NP_441659.2_8 Forward -108 -98 9.81313 0.0269
NP_442749.1_5 Forward -128 -111 12.1764 0.17
NP_441092.1_3 Reverse -101 -120 12.8808 0.0684
NP_441040.1_2 Reverse -225 -244 -12.3902 0.255
NP_442849.1_1 Reverse -323 -337 13.3726 0.201
NP_442008.1_2 Forward -111 -92 11.0125 0.132
NP_440779.1_5 Forward -215 -198 -14.2191 0.243
NP_442346.1_5 Forward -216 -206 17.9746 0.00128
NP_442346.1_5 Reverse -205 -215 16.303 0.00248
NP_442346.1_5 Reverse -98 -108 8.1415 0.146
NP_442346.1_5 Forward -109 -99 7.15819 0.178
NP_440545.1_3 Forward -219 -202 16.4601 0.0122
NP_440545.1_3 Reverse -95 -112 15.4768 0.0131
NP_440545.1_3 Reverse -161 -178 4.95539 0.0658
NP_440545.1_3 Reverse -202 -219 0.432165 0.139
NP_440545.1_3 Forward -112 -95 -1.53445 0.17
NP_440545.1_3 Forward -165 -148 -5.86102 0.262
NP_441856.1_3 Reverse -96 -115 3.53937 0.178
NP_440025.1_3 Forward -164 -150 11.3853 0.29
NP_440555.1_6 Reverse -104 -123 16.0274 0.176
NP_440459.1_2 Forward -224 -207 7.217 0.299
NP_440010.1_10 Reverse -87 -106 5.40766 0.232
NP_440847.1_3 Reverse -68 -82 13.077 0.224
NP_442603.1_7 Forward -326 -312 6.0955 0.259
NP_442828.1_7 Reverse -323 -342 -4.81876 0.276
NP_440449.1_6 Reverse -198 -216 8.15857 0.206
NP_441948.1_4 Forward -222 -204 20.177 0.0121
NP_441833.1_4 Forward -214 -207 15.9687 0.0124
NP_441833.1_4 Reverse -207 -214 15.9687 0.0124
NP_441833.1_4 Reverse -100 -107 6.52896 0.0924
NP_441833.1_4 Forward -107 -100 6.23397 0.163
NP_442699.1_8 Forward -134 -115 -13.1769 0.284
NP_442162.1_9 Forward -214 -207 16.2637 0.0124
NP_442162.1_9 Reverse -207 -214 16.2637 0.0124
NP_442162.1_9 Forward -107 -100 12.9205 0.0282
NP_442162.1_9 Reverse -100 -107 12.9205 0.0282
NP_441044.1_4 Forward -351 -333 7.29564 0.223
NP_442199.1_5 Reverse -198 -217 -0.885524 0.177
NP_442140.1_3 Reverse -207 -217 13.5497 0.0542
NP_442140.1_3 Forward -214 -204 7.94484 0.124
NP_442140.1_3 Forward -107 -97 5.5849 0.202
NP_442723.1_1 Reverse -56 -75 2.85027 0.282
NP_441671.1_10 Reverse -195 -214 5.11266 0.219
NP_440875.1_9 Forward -213 -203 16.8403 0.0145
NP_440875.1_9 Reverse -101 -111 16.5483 0.0145
NP_440875.1_9 Forward -78 -68 7.39866 0.267
NP_441813.1_5 Forward -217 -207 8.82982 0.0367
NP_441813.1_5 Reverse -204 -214 8.73149 0.0367
NP_441813.1_5 Forward -110 -100 8.4365 0.0432
NP_441813.1_5 Reverse -97 -107 5.78156 0.109
NP_440594.1_8 Reverse -207 -220 11.6217 0.152
NP_441227.1_7 Reverse -207 -226 14.2265 0.256
NP_440590.1_4 Reverse -207 -220 3.26421 0.0749
NP_440590.1_4 Forward -214 -201 2.96921 0.0783
NP_440590.1_4 Reverse -130 -143 -2.93064 0.251
NP_440590.1_7 Reverse -141 -155 14.3559 0.266
NP_440567.1_1 Forward -214 -200 16.9125 0.0164
NP_440567.1_1 Reverse -207 -221 9.63603 0.0422
NP_440567.1_1 Forward -107 -93 7.9644 0.0637
NP_442497.1_10 Reverse -207 -216 19.8626 0.00532
NP_442497.1_10 Forward -214 -205 17.601 0.00813
NP_442497.1_10 Forward -107 -98 10.1278 0.0166
NP_442497.1_10 Reverse -100 -109 7.76787 0.0731
NP_440821.1_4 Forward -217 -207 10.9931 0.0146
NP_440821.1_4 Reverse -204 -214 10.7964 0.0146
NP_440821.1_4 Reverse -97 -107 9.7148 0.0274
NP_441239.1_9 Reverse -204 -216 18.4269 0.0114
NP_441239.1_9 Reverse -97 -109 13.2153 0.0386
NP_441239.1_9 Forward -217 -205 10.7571 0.0723
NP_441239.1_9 Forward -110 -98 6.82381 0.175
NP_441239.1_9 Reverse -150 -162 5.05386 0.231
NP_441239.1_9 Reverse -5 -17 4.5622 0.251
NP_441009.1_4 Reverse -165 -184 10.9142 0.26
NP_441892.1_1 Forward -224 -207 6.82368 0.0931
NP_441892.1_1 Reverse -197 -214 3.18543 0.129
NP_441892.1_1 Reverse -90 -107 -0.649475 0.188
NP_440604.1_6 Forward -108 -89 5.30933 0.117
NP_440604.1_6 Reverse -165 -184 -0.000545616 0.17
NP_440604.1_6 Forward -215 -196 -3.44213 0.225
NP_442044.1_1 Reverse -201 -220 -13.0786 0.273
NP_441017.1_8 Forward -318 -303 7.94471 0.262
NP_440833.1_6 Reverse -108 -122 11.602 0.218
NP_440354.1_7 Reverse -200 -218 5.72234 0.297
NP_442052.1_8 Forward -217 -207 12.7631 0.253
NP_440546.1_4 Forward -108 -98 13.8273 0.0459
NP_440546.1_4 Forward -215 -205 13.5365 0.0459
NP_440546.1_4 Reverse -206 -216 12.8578 0.0572
NP_440546.1_4 Reverse -99 -109 10.9186 0.101
NP_440546.1_4 Forward -138 -128 6.55553 0.291
NP_442349.1_6 Forward -218 -199 2.85105 0.214
NP_441230.1_3 Reverse -204 -223 2.65439 0.288
NP_440462.1_6 Reverse -204 -214 19.4496 0.00371
NP_440462.1_6 Forward -110 -100 9.22315 0.049
NP_440462.1_6 Reverse -97 -107 7.45319 0.0788
NP_440462.1_6 Forward -217 -207 1.455 0.294
NP_442340.1_3 Reverse -232 -251 -6.98204 0.227
NP_440868.1_4 Forward -112 -100 14.4936 0.0176
NP_440868.1_4 Reverse -202 -214 9.47875 0.0482
NP_440868.1_4 Forward -219 -207 9.08543 0.0576
NP_441474.1_1 Forward -355 -336 1.37531 0.247
NP_440638.2_2 Reverse -127 -146 14.4541 0.189
NP_442402.1_2 Forward -337 -323 13.372 0.263
NP_442402.1_4 Reverse -228 -247 9.14342 0.111
NP_442402.1_4 Forward -341 -322 -3.04956 0.211
NP_441848.1_7 Forward -337 -318 4.91521 0.215
NP_440696.1_3 Reverse -206 -224 0.805796 0.225
NP_440696.1_3 Forward -219 -201 -2.93078 0.28
NP_441843.2_9 Forward -213 -195 17.1059 0.0976
NP_442039.1_4 Forward -214 -207 15.1821 0.0124
NP_442039.1_4 Reverse -207 -214 15.1821 0.0124
NP_442039.1_4 Forward -107 -100 11.6422 0.0747
NP_442039.1_7 Forward -12 -2 8.4365 0.263
NP_441811.1_8 Forward -221 -207 13.6676 0.178
NP_440825.1_7 Reverse -207 -217 11.8361 0.2
NP_442837.1_3 Forward -214 -207 15.7721 0.0124
NP_442837.1_3 Reverse -207 -214 15.7721 0.0124
NP_442837.1_3 Forward -107 -100 6.0373 0.25
NP_442837.1_3 Reverse -100 -107 6.0373 0.25
NP_442053.1_1 Forward -215 -206 18.3876 0.0007
NP_442053.1_1 Reverse -206 -215 18.3876 0.0007
NP_442053.1_1 Reverse -99 -108 16.6177 0.00257
NP_442053.1_1 Forward -108 -99 8.65285 0.0741
NP_440505.1_3 Forward -110 -100 15.6147 0.0106
NP_440505.1_3 Reverse -204 -214 15.418 0.0114
NP_442360.1_5 Reverse -159 -169 13.1564 0.289
NP_442532.1_7 Forward -215 -201 5.60446 0.171
NP_440914.1_1 Forward -215 -205 16.3248 0.00196
NP_440914.1_1 Reverse -99 -109 14.373 0.0158
NP_440914.1_1 Reverse -129 -139 13.0067 0.0398
NP_440914.1_1 Forward -195 -185 11.9332 0.0746
NP_440914.1_1 Reverse -206 -216 8.51751 0.186
NP_440914.1_7 Forward -400 -381 5.96782 0.288
NP_441011.1_8 Forward -214 -205 16.6177 0.00602
NP_441011.1_8 Reverse -207 -216 14.356 0.0249
NP_441011.1_8 Forward -107 -98 10.8161 0.094
NP_441011.1_8 Reverse -100 -109 6.78456 0.184
NP_442533.1_1 Reverse -320 -339 3.93269 0.0838
NP_442533.1_1 Reverse -321 -340 -14.4552 0.243
NP_442533.1_1 Reverse -149 -168 -16.7168 0.275
NP_442533.1_1 Reverse -319 -338 -17.7001 0.293
NP_442533.1_6 Forward -215 -206 17.2076 0.00137
NP_442533.1_6 Reverse -206 -215 17.2076 0.00137
NP_442533.1_6 Reverse -99 -108 14.2577 0.0132
NP_442533.1_6 Forward -108 -99 7.47288 0.0898
NP_441089.1_10 Reverse -195 -214 0.786102 0.294
NP_442232.1_3 Reverse -91 -110 -3.93378 0.163
NP_442232.1_3 Forward -223 -204 -15.7335 0.296
NP_442229.1_1 Reverse -204 -218 8.16044 0.184
NP_443016.1_1 Reverse -93 -112 0.491109 0.193
NP_441482.1_7 Reverse -93 -107 -2.75368 0.0997
NP_441482.1_7 Reverse -200 -214 -10.6202 0.211
NP_439944.1_9 Forward -214 -204 17.7779 0.00341
NP_439944.1_9 Reverse -207 -217 8.82982 0.101
NP_439944.1_9 Forward -107 -97 8.1415 0.116
NP_440816.1_7 Reverse -202 -221 15.6341 0.181
NP_441028.1_6 Forward -172 -162 10.6976 0.197
NP_441028.1_6 Reverse -310 -320 9.02601 0.216
NP_441028.1_6 Forward -331 -321 8.23937 0.216
NP_440116.1_5 Forward -111 -94 6.72535 0.167
NP_440116.1_8 Forward -107 -88 -6.78538 0.216
NP_440115.1_6 Forward -111 -101 14.0414 0.0615
NP_440115.1_6 Reverse -96 -106 9.41981 0.115
NP_440115.1_6 Forward -218 -208 8.63316 0.128
NP_440115.1_6 Reverse -203 -213 7.84651 0.146
NP_441972.1_5 Forward -214 -195 -9.83364 0.293
NP_441106.1_1 Reverse -205 -214 18.486 0.0028
NP_441106.1_1 Forward -216 -207 9.73449 0.0311
NP_441106.1_1 Forward -109 -100 8.75118 0.0469
NP_441825.1_4 Reverse -220 -230 12.9597 0.249
NP_439903.1_6 Reverse -203 -222 1.47364 0.245
NP_442588.1_6 Reverse -213 -232 14.2574 0.127
NP_442588.1_6 Reverse -132 -151 11.7008 0.131
NP_442306.1_10 Forward -220 -201 -10.3253 0.11
NP_442306.1_10 Forward -113 -94 -11.5053 0.133
NP_441286.1_1 Reverse -205 -217 6.03717 0.0258
NP_441286.1_1 Forward -109 -97 5.34885 0.0259
NP_441286.1_1 Forward -216 -204 5.25052 0.0259
NP_441385.1_1 Reverse -332 -347 17.9745 0.224
NP_440670.1_8 Forward -215 -206 18.3876 0.000699
NP_440670.1_8 Reverse -206 -215 18.3876 0.000699
NP_440670.1_8 Forward -108 -99 18.0926 0.00136
NP_440670.1_8 Reverse -99 -108 15.831 0.00494
NP_441479.1_9 Reverse -359 -377 13.9821 0.271
NP_441930.1_2 Reverse -151 -161 11.5831 0.285
NP_440886.1_7 Forward -216 -206 8.04271 0.0805
NP_440886.1_7 Reverse -205 -215 8.04271 0.0805
NP_440886.1_7 Reverse -98 -108 6.76441 0.114
NP_440886.1_7 Forward -369 -359 4.10949 0.253
NP_440886.1_7 Reverse -212 -222 3.71617 0.267
NP_441001.1_10 Reverse -142 -161 5.89931 0.266
NP_442614.1_2 Reverse -206 -220 14.6509 0.0946
NP_442614.1_2 Forward -108 -94 7.86607 0.262
NP_442614.1_2 Reverse -99 -113 6.88276 0.28
NP_442072.1_9 Forward -216 -198 -1.55415 0.0316
NP_442072.1_9 Reverse -98 -116 -21.0237 0.206
NP_440513.1_4 Forward -108 -89 12.7825 0.192
NP_442963.1_3 Reverse -66 -84 14.3755 0.273
NP_440907.2_8 Forward -214 -204 19.1541 0.00362
NP_440907.2_8 Reverse -207 -217 16.2041 0.0161
NP_440907.2_8 Forward -107 -97 9.91099 0.103
NP_440907.2_8 Reverse -100 -110 7.84605 0.117
NP_441021.1_8 Forward -220 -202 4.14905 0.225
NP_441463.1_3 Reverse -196 -215 5.70265 0.0709
NP_441463.1_3 Reverse -89 -108 4.42435 0.0896
NP_441626.1_2 Forward -214 -207 15.7721 0.0124
NP_441626.1_2 Reverse -207 -214 15.7721 0.0124
NP_441626.1_2 Forward -107 -100 12.2322 0.0511
NP_441626.1_2 Reverse -100 -107 5.93897 0.231
NP_442365.1_5 Forward -107 -88 26.3522 0.00194
NP_442615.1_1 Reverse -197 -215 6.90232 0.0335
NP_442615.1_1 Reverse -90 -108 1.00246 0.0926
NP_442615.1_1 Forward -224 -206 -0.865831 0.122
NP_441962.1_4 Forward -220 -201 -11.4069 0.241
NP_440387.1_1 Forward -215 -199 6.25339 0.0282
NP_440387.1_1 Reverse -206 -222 -1.41643 0.142
NP_440387.1_1 Forward -108 -92 -1.80975 0.145
NP_440387.1_1 Reverse -186 -202 -3.28472 0.157
NP_441431.1_2 Reverse -203 -217 15.3386 0.0501
NP_441431.1_2 Forward -218 -204 11.5037 0.136
NP_441431.1_2 Forward -111 -97 10.717 0.155
NP_441431.1_2 Reverse -96 -110 6.78381 0.261
NP_441431.1_2 Reverse -2 -16 5.99717 0.281
NP_441488.1_7 Reverse -200 -219 6.4893 0.141
NP_441836.1_2 Forward -218 -199 -0.000545616 0.209
NP_441836.1_2 Reverse -348 -367 -3.3438 0.237
NP_441836.1_2 Forward -114 -95 -3.63879 0.242
NP_441836.1_2 Forward -246 -227 -6.1954 0.292
NP_440114.1_5 Reverse -355 -374 7.7676 0.291
NP_440114.1_10 Forward -215 -201 19.9608 0.00349
NP_440114.1_10 Reverse -206 -220 12.3893 0.0845
NP_440114.1_10 Forward -76 -62 7.17775 0.243
NP_440114.1_10 Forward -108 -94 6.3911 0.273
NP_440114.1_10 Forward -53 -39 6.19444 0.282
NP_441425.1_6 Reverse -377 -387 16.598 0.252
NP_442698.1_10 Forward -361 -342 2.16274 0.284
NP_441510.2_7 Reverse -129 -143 11.7987 0.28
NP_441272.1_7 Reverse -143 -153 14.4347 0.225
NP_440766.1_4 Reverse -202 -216 4.32615 0.131
NP_440766.1_5 Forward -48 -36 9.75661 0.275
NP_439988.1_10 Reverse -13 -32 8.15482 0.226
NP_441237.1_9 Reverse -207 -217 17.188 0.00445
NP_441237.1_9 Forward -107 -97 14.533 0.0323
NP_442743.1_1 Forward -338 -319 9.53674 0.262
NP_439910.1_2 Forward -116 -99 -22.479 0.25
NP_440457.1_1 Forward -219 -207 12.527 0.092
NP_440457.1_1 Reverse -95 -107 9.18376 0.0949
NP_440457.1_1 Forward -112 -100 2.89058 0.205
NP_442940.1_2 Forward -215 -196 6.78429 0.195
NP_440798.1_6 Reverse -207 -220 13.7856 0.0445
NP_440798.1_6 Forward -107 -94 8.47575 0.12
NP_440801.1_8 Forward -168 -149 0.982764 0.246
NP_441984.1_3 Reverse -148 -166 12.5072 0.163
NP_441332.1_6 Reverse -241 -251 11.8404 0.244
NP_442509.1_9 Reverse -206 -216 17.3841 0.00128
NP_442509.1_9 Forward -108 -98 14.6309 0.0263
NP_442509.1_9 Forward -215 -205 8.04271 0.192
NP_442514.1_5 Forward -104 -85 -9.34271 0.295
NP_441159.1_4 Reverse -159 -178 4.42435 0.254
NP_440554.1_4 Forward -214 -204 15.418 0.0199
NP_440554.1_4 Reverse -100 -110 15.0247 0.02
NP_442862.1_3 Reverse -223 -240 8.88863 0.236
NP_441845.1_6 Reverse -194 -212 -0.0791831 0.274
NP_441885.1_5 Forward -215 -205 11.3864 0.00668
NP_441885.1_5 Reverse -206 -216 11.3864 0.00668
NP_441885.1_5 Forward -108 -98 9.12481 0.0238
NP_441885.1_5 Reverse -99 -109 1.55333 0.109
NP_441885.1_5 Forward -195 -185 0.0783647 0.183
NP_441428.1_8 Forward -202 -183 15.4374 0.0843
NP_442341.1_7 Forward -216 -202 6.78443 0.118
NP_442341.1_7 Forward -162 -148 6.78443 0.118
NP_442341.1_9 Forward -110 -96 13.8636 0.0744
NP_442341.1_9 Reverse -204 -218 10.3237 0.135
NP_441756.1_5 Reverse -95 -114 -0.39387 0.244
NP_441756.1_5 Reverse -125 -144 -4.81876 0.296
NP_441173.1_9 Forward -330 -322 10.1471 0.261
NP_442534.1_1 Forward -44 -25 8.65258 0.241
NP_443000.1_7 Reverse -204 -214 10.7964 0.0345
NP_443000.1_7 Forward -110 -100 10.5998 0.0345
NP_443000.1_7 Forward -217 -207 2.04498 0.226
NP_441561.1_4 Reverse -101 -120 9.24257 0.191
NP_441842.1_1 Reverse -208 -221 15.0633 0.081
NP_441842.1_10 Reverse -199 -213 16.7159 0.0298
NP_441842.1_10 Forward -222 -208 8.45605 0.221
NP_440275.1_3 Reverse -204 -214 18.6629 0.0082
NP_440275.1_3 Forward -110 -100 13.5497 0.0268
NP_440275.1_3 Forward -217 -207 9.91146 0.046
NP_440275.1_3 Reverse -97 -107 9.91146 0.046
NP_440091.1_1 Reverse -202 -214 3.2839 0.163
NP_440091.1_1 Forward -219 -207 0.825626 0.227
NP_443010.1_10 Reverse -203 -220 14.85 0.0582
NP_442451.1_2 Reverse -198 -217 -9.44032 0.259
NP_442591.1_5 Reverse -132 -151 15.8307 0.234
NP_441105.1_3 Reverse -195 -214 -1.96717 0.154
NP_440216.1_1 Reverse -206 -220 8.06273 0.0068
NP_440216.1_1 Reverse -99 -113 5.1128 0.0222
NP_440216.1_1 Forward -215 -201 -1.8687 0.0412
NP_440216.1_1 Forward -108 -94 -2.85201 0.0608
NP_440172.1_1 Forward -215 -205 17.5813 0.00421
NP_440172.1_1 Reverse -206 -216 16.303 0.00854
NP_440172.1_1 Reverse -99 -109 14.6313 0.011
NP_440172.1_1 Forward -108 -98 6.56821 0.102
NP_441718.1_4 Forward -112 -93 11.995 0.299
NP_442015.1_10 Forward -219 -206 11.4257 0.0372
NP_442015.1_10 Reverse -95 -108 0.805932 0.218
NP_441226.1_7 Forward -214 -207 14.4934 0.0123
NP_441226.1_7 Reverse -207 -214 14.4934 0.0123
NP_441226.1_7 Forward -107 -100 12.7234 0.0312
NP_441226.1_7 Reverse -100 -107 11.5435 0.0757
NP_441226.1_7 Reverse -136 -143 6.52862 0.253
NP_442834.1_9 Reverse -156 -175 4.12936 0.298
NP_441111.1_7 Forward -214 -206 18.7023 0.00294
NP_441111.1_7 Reverse -207 -215 18.7023 0.00294
NP_441111.1_7 Forward -107 -99 8.96754 0.0463
NP_441111.1_7 Reverse -100 -108 8.86921 0.0589
NP_442379.1_10 Reverse -199 -216 5.74204 0.126
NP_442379.1_10 Reverse -92 -109 -3.00942 0.248
NP_441766.1_2 Forward -215 -206 17.5026 0.00297
NP_441766.1_2 Reverse -206 -215 17.5026 0.00297
NP_441766.1_2 Reverse -99 -108 13.9627 0.0114
NP_441766.1_2 Forward -108 -99 7.76787 0.0714
NP_440416.1_1 Forward -215 -196 -4.81876 0.135
NP_440416.1_9 Forward -145 -126 -14.1602 0.173
NP_440416.1_9 Reverse -92 -111 -14.3569 0.176
NP_440416.1_9 Reverse -43 -62 -18.3884 0.256
NP_440416.1_9 Forward -291 -272 -19.0768 0.269
NP_440416.1_9 Reverse -199 -218 -21.0434 0.29
NP_443052.1_8 Reverse -196 -215 -7.57203 0.161
NP_443052.1_8 Reverse -89 -108 -9.83364 0.197
NP_440261.1_5 Reverse -207 -220 5.23083 0.045
NP_440261.1_5 Reverse -100 -113 4.44418 0.058
NP_440261.1_5 Forward -214 -201 -1.16069 0.0662
NP_440261.1_5 Forward -107 -94 -1.16069 0.0662
NP_440261.1_5 Forward -160 -147 -4.89726 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGATTTGTTCATTGCTCAATAATTGCCCTACCCCGTCCACGTGGCCGGAAACAAAATGCCCCCCCACTTTTCCCCCCACCCGGAGGGAAGTTTCAATGTTGACCGCTGTGCGCCTTTCCTTAGCCCGTCCTAAGGTAGTGCGTTGTAAGGTTTCGGGGGAAACGTCGGCAAAAAATCCCTGGTGGGCGATCGCCTCTACGGTGAGGCAAACCCCATCTACAGCAATGCTGTCCCCTAGGGCCATATCCCCCAAAACCCGTTGGGCATCGTTGGGGCTAAGGGAAATTTCCAGGCGATCGGCCCGCTGAGCAGAAAGATAACCGAGGGATTGGATAATGCCAGTGAACACAATGGGACAAACCTTAGAAGATTAATTACAATTGTGCCAGTTGGGGGCCA

CDS

ATGCCATGGCTGGAGGGAGAGTTGCAGCTCGGGGTGGTCAAGGTTAGGGAAACGAGTCTAGAGTTCCCTTGGCATTATCTGGTCTCAATTAAGCATACCTTTGCCTTCGGTCAACCCCGGAAAACGGTCAATACCTTTACAATGGGTACTGTTCTTGTCCGTCGAAGAGATGATATGACTGATAATCCGGAAAAAGACGCATTTCTGTATCCCAAAAGCAAATATTATGGGGATTTCAAACCGGAGAAGCTGGTTTTCAACGCAAATTTGCAAGAATTTGCCCAAAAGGTGAGCGTTATTTGTAACCTAGAGACAGCGGGTAAAATCGAGACGATGGAAGCTTACGAGCGCATTAAGCAACTTTGGAAGAGTCTTAAGGAAAGCAAAAAGGAATTGGGCATTGGGGGAGACCCGTTTAAACCCACTGATCCCCCCAGCAGTTAA

Protein

MPWLEGELQLGVVKVRETSLEFPWHYLVSIKHTFAFGQPRKTVNTFTMGTVLVRRRDDMTDNPEKDAFLYPKSKYYGDFKPEKLVFNANLQEFAQKVSVICNLETAGKIETMEAYERIKQLWKSLKESKKELGIGGDPFKPTDPPSS