Your browser is old and dusty. Try Google Chrome!

Details for slr0325

ORF slr0325
Accession NP_441955.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -350 -336 11.5043 0.051
NP_441061.1_2 Reverse -343 -357 6.29277 0.121
NP_441061.1_2 Forward -260 -246 6.09611 0.126
NP_441061.1_2 Reverse -63 -77 5.60446 0.132
NP_440557.1_1 Reverse -130 -149 2.16274 0.243
NP_440795.1_7 Forward -350 -343 14.6904 0.0123
NP_440795.1_7 Reverse -343 -350 14.6904 0.0123
NP_441418.1_1 Forward -63 -44 6.54077 0.295
NP_441418.1_6 Forward -351 -332 0.196116 0.00922
NP_441418.1_6 Reverse -342 -361 -20.4534 0.114
NP_442291.1_5 Forward -352 -336 -3.38305 0.239
NP_442291.1_5 Reverse -341 -357 -3.67804 0.249
NP_440897.1_6 Forward -351 -332 -0.0996487 0.182
NP_441453.1_4 Reverse -342 -350 16.539 0.00633
NP_441453.1_4 Forward -351 -343 16.539 0.00633
NP_442151.1_6 Forward -351 -337 19.3708 0.00457
NP_442151.1_6 Forward -261 -247 8.84938 0.164
NP_442151.1_6 Reverse -141 -155 6.19444 0.244
NP_441818.1_1 Forward -350 -339 10.1862 0.232
NP_442169.1_1 Reverse -189 -208 -2.36049 0.274
NP_442623.1_3 Forward -350 -331 -8.65367 0.127
NP_440150.1_1 Forward -185 -166 0.982764 0.151
NP_442173.1_1 Forward -350 -342 15.4574 0.00633
NP_442173.1_1 Reverse -343 -351 15.4574 0.00633
NP_442752.1_4 Forward -351 -344 13.8055 0.0199
NP_442752.1_4 Reverse -342 -349 13.8055 0.0199
NP_443027.1_4 Reverse -340 -350 14.0414 0.0452
NP_443027.1_4 Forward -353 -343 13.943 0.0452
NP_443027.1_4 Reverse -127 -137 7.25653 0.24
NP_441745.1_3 Forward -206 -187 12.9783 0.298
NP_441812.1_3 Reverse -341 -355 14.9459 0.106
NP_442975.1_10 Forward -355 -341 21.3367 0.00107
NP_441225.1_4 Reverse -64 -83 -12.3902 0.284
NP_440784.1_7 Forward -350 -343 15.9687 0.0123
NP_440784.1_7 Reverse -343 -350 15.9687 0.0123
NP_441250.1_3 Reverse -259 -278 3.93269 0.252
NP_440110.1_8 Forward -353 -334 3.04771 0.211
NP_439979.1_2 Forward -354 -335 5.80098 0.295
NP_442062.1_3 Forward -32 -13 3.93269 0.198
NP_442062.1_3 Forward -63 -44 -3.54046 0.294
NP_442062.1_8 Reverse -342 -352 19.4496 0.000558
NP_442062.1_8 Forward -351 -341 17.3846 0.00193
NP_440761.1_4 Forward -356 -337 -3.73712 0.132
NP_441859.1_3 Reverse -341 -360 7.66846 0.155
NP_441802.1_1 Reverse -375 -394 6.58763 0.269
NP_440304.1_4 Reverse -340 -350 10.8948 0.051
NP_440304.1_4 Forward -353 -343 9.91146 0.051
NP_442242.1_1 Forward -192 -173 16.7027 0.28
NP_442242.1_4 Forward -350 -343 14.3954 0.0124
NP_442242.1_4 Reverse -343 -350 14.3954 0.0124
NP_440044.1_8 Reverse -343 -362 7.7676 0.0816
NP_440044.1_8 Forward -350 -331 7.57094 0.0817
NP_439918.1_3 Reverse -342 -361 3.73603 0.266
NP_441208.1_9 Reverse -339 -353 7.86607 0.219
NP_441594.1_6 Reverse -333 -352 7.96426 0.166
NP_441594.1_6 Forward -360 -341 3.6377 0.226
NP_441594.1_6 Reverse -243 -262 1.86774 0.261
NP_441594.1_6 Reverse -60 -79 0.196116 0.291
NP_440370.1_10 Reverse -333 -352 10.0292 0.211
NP_442742.1_9 Reverse -111 -130 -9.24366 0.269
NP_440132.1_1 Forward -79 -61 13.0972 0.178
NP_442110.1_7 Forward -351 -337 19.6658 0.0138
NP_442110.1_7 Forward -77 -63 1.86788 0.222
NP_441083.1_5 Forward -351 -341 20.3345 0.00053
NP_441083.1_5 Reverse -342 -352 11.3864 0.0159
NP_441083.1_5 Reverse -252 -262 -0.216628 0.261
NP_442827.1_8 Reverse -334 -353 -1.47628 0.247
NP_441434.1_1 Forward -59 -45 8.03294 0.26
NP_441434.1_6 Forward -368 -358 13.7464 0.296
NP_441434.1_7 Forward -198 -184 3.53951 0.236
NP_441738.1_2 Forward -349 -342 15.28 0.0102
NP_441738.1_2 Reverse -344 -351 15.28 0.0102
NP_441955.1_6 Forward -273 -254 17.3057 0.218
NP_440209.1_1 Reverse -342 -350 18.1123 0.00295
NP_440209.1_1 Forward -351 -343 18.1123 0.00295
NP_442889.1_8 Forward -354 -340 20.6484 0.00372
NP_441770.1_5 Forward -80 -61 5.01433 0.213
NP_441770.1_5 Forward -359 -340 -0.000545616 0.244
NP_440178.1_5 Reverse -348 -357 18.3876 0.137
NP_440178.1_7 Reverse -341 -360 -21.24 0.215
NP_442059.1_10 Reverse -210 -229 13.3725 0.185
NP_442570.1_3 Forward -353 -334 -3.44213 0.219
NP_442461.1_2 Reverse -10 -29 14.7491 0.216
NP_441716.1_1 Forward -351 -337 12.9793 0.0689
NP_443013.1_7 Reverse -242 -261 15.8307 0.275
NP_442111.1_4 Reverse -341 -355 3.14618 0.253
NP_442111.1_4 Forward -352 -338 2.94952 0.259
NP_441163.1_1 Forward -262 -245 17.541 0.158
NP_441387.1_8 Reverse -43 -62 15.6125 0.183
NP_440906.1_5 Forward -350 -343 15.8704 0.0124
NP_440906.1_5 Reverse -343 -350 15.8704 0.0124
NP_440747.1_10 Reverse -339 -351 17.2469 0.000522
NP_440747.1_10 Forward -354 -342 -2.02597 0.0196
NP_441130.1_10 Reverse -340 -354 17.3058 0.0167
NP_441854.1_10 Forward -197 -178 15.3391 0.139
NP_441486.1_1 Forward -354 -340 11.701 0.0149
NP_441486.1_1 Reverse -339 -353 4.12949 0.0492
NP_441486.1_1 Reverse -249 -263 -5.21195 0.226
NP_442634.1_4 Forward -353 -339 6.19444 0.0508
NP_442634.1_4 Forward -79 -65 -5.11362 0.235
NP_442634.1_4 Reverse -184 -198 -5.31028 0.246
NP_441265.1_3 Reverse -336 -350 2.94952 0.181
NP_440403.1_10 Reverse -333 -352 10.3242 0.186
NP_440403.1_10 Forward -360 -341 5.50599 0.242
NP_440403.1_10 Reverse -342 -361 4.42435 0.256
NP_441014.1_10 Reverse -341 -360 1.57197 0.227
NP_442848.1_1 Reverse -336 -350 -0.983719 0.263
NP_442848.1_1 Forward -357 -343 -3.63866 0.268
NP_441012.1_4 Reverse -64 -77 8.37742 0.272
NP_441012.1_4 Reverse -338 -351 7.49244 0.272
NP_443018.1_3 Forward -350 -343 14.8871 0.0123
NP_443018.1_3 Reverse -343 -350 14.8871 0.0123
NP_443018.1_3 Reverse -337 -344 9.38056 0.128
NP_441634.1_8 Reverse -340 -354 21.7307 0.0101
NP_440376.1_1 Forward -351 -342 19.4693 0.000692
NP_440376.1_1 Reverse -342 -351 19.4693 0.000692
NP_440376.1_1 Reverse -252 -261 4.12963 0.173
NP_440376.1_1 Forward -77 -68 1.67135 0.243
NP_441588.1_4 Reverse -344 -354 6.96153 0.178
NP_441588.1_4 Reverse -254 -264 5.97822 0.221
NP_442687.1_7 Forward -352 -342 15.8113 0.0125
NP_442687.1_7 Reverse -341 -351 8.92815 0.0994
NP_441077.1_6 Forward -59 -43 3.2839 0.271
NP_442485.1_3 Reverse -331 -350 3.93269 0.192
NP_442485.1_3 Forward -362 -343 -1.27885 0.256
NP_442485.1_3 Reverse -340 -359 -3.3438 0.273
NP_442530.1_2 Reverse -221 -231 12.2714 0.278
NP_442658.1_1 Forward -353 -343 18.7607 0.00222
NP_442658.1_1 Forward -256 -246 9.22267 0.165
NP_442658.1_1 Reverse -340 -350 6.76441 0.214
NP_441855.2_4 Reverse -334 -353 10.6799 0.244
NP_442782.1_2 Forward -272 -258 7.66941 0.202
NP_442782.1_2 Forward -77 -63 7.37441 0.202
NP_440656.1_8 Forward -362 -343 -7.96535 0.27
NP_441414.1_9 Reverse -342 -361 -6.49039 0.196
NP_442937.1_5 Forward -356 -337 13.8641 0.0867
NP_442937.1_5 Forward -266 -247 9.0459 0.204
NP_442937.1_5 Reverse -232 -251 6.88262 0.268
NP_441958.1_5 Forward -352 -342 12.2714 0.00183
NP_441958.1_5 Reverse -341 -351 12.2714 0.00183
NP_441127.1_1 Reverse -348 -362 8.06273 0.3
NP_440203.1_5 Forward -348 -338 15.7125 0.0611
NP_439905.1_1 Reverse -181 -194 9.16406 0.221
NP_443001.1_7 Forward -350 -331 12.8808 0.166
NP_440984.1_7 Forward -356 -342 6.88276 0.195
NP_440984.1_7 Reverse -184 -198 5.40779 0.257
NP_439990.1_5 Reverse -337 -350 11.229 0.128
NP_442911.1_2 Reverse -332 -351 -1.96717 0.092
NP_442911.1_2 Forward -361 -342 -7.17871 0.202
NP_441580.1_6 Reverse -331 -350 -6.98204 0.235
NP_440153.1_5 Forward -350 -336 0.491246 0.299
NP_440153.1_5 Reverse -343 -357 0.392915 0.299
NP_442064.1_1 Reverse -57 -76 -5.80207 0.211
NP_440200.1_3 Forward -224 -205 15.7324 0.0723
NP_443055.1_6 Forward -359 -341 9.45814 0.133
NP_442236.1_3 Forward -264 -245 11.7008 0.183
NP_440993.1_2 Reverse -337 -353 12.1532 0.0735
NP_440993.1_4 Forward -351 -334 2.69378 0.298
NP_440827.1_3 Forward -356 -337 13.6675 0.222
NP_440138.1_6 Reverse -247 -266 3.83357 0.24
NP_441348.1_3 Reverse -184 -203 7.57094 0.256
NP_441099.1_5 Reverse -332 -351 7.07928 0.0429
NP_442002.1_9 Forward -352 -345 10.7572 0.185
NP_441294.1_7 Forward -355 -341 17.8896 0.00674
NP_442438.1_10 Reverse -337 -351 17.0108 0.0203
NP_442438.1_10 Forward -356 -342 3.04785 0.166
NP_441000.1_6 Reverse -341 -355 5.01447 0.0933
NP_442771.1_1 Forward -353 -335 -5.29072 0.166
NP_440147.1_4 Reverse -340 -353 10.2457 0.0355
NP_440147.1_4 Forward -353 -340 3.36254 0.188
NP_441295.1_4 Reverse -337 -356 6.4893 0.29
NP_441550.1_8 Reverse -340 -350 12.3692 0.0336
NP_441550.1_8 Forward -353 -343 10.501 0.066
NP_441550.1_8 Reverse -189 -199 4.99446 0.274
NP_441916.1_7 Reverse -342 -352 18.4663 0.00144
NP_441916.1_7 Forward -351 -341 10.3048 0.0261
NP_441916.1_10 Forward -374 -355 3.14605 0.236
NP_441916.1_10 Reverse -334 -353 1.37609 0.264
NP_441916.1_10 Reverse -61 -80 -0.000545616 0.294
NP_441041.1_4 Forward -351 -332 -0.4922 0.0958
NP_441041.1_4 Forward -77 -58 -1.57384 0.101
NP_441041.1_7 Forward -354 -342 19.5648 0.00277
NP_442642.1_9 Forward -358 -341 6.23369 0.192
NP_442004.1_6 Forward -351 -337 8.55439 0.14
NP_441725.1_5 Forward -350 -340 11.2881 0.0247
NP_441725.1_5 Reverse -343 -353 9.02648 0.0553
NP_439966.1_7 Forward -353 -343 17.4824 0.00636
NP_439966.1_7 Reverse -340 -350 15.8108 0.0124
NP_439966.1_9 Forward -353 -344 10.7178 0.0863
NP_440736.1_3 Reverse -340 -359 1.17943 0.282
NP_442941.1_3 Forward -350 -340 19.9412 0.00262
NP_442941.1_3 Reverse -343 -353 2.53664 0.14
NP_440289.1_2 Forward -354 -341 19.6855 0.00426
NP_440289.1_2 Reverse -339 -352 -2.93064 0.262
NP_440983.1_5 Reverse -252 -271 -6.78538 0.28
NP_440260.1_8 Reverse -333 -351 3.95239 0.158
NP_442281.1_1 Forward -356 -342 18.7801 0.00389
NP_442281.1_1 Reverse -337 -351 16.9119 0.00698
NP_442281.1_1 Reverse -247 -261 2.16228 0.276
NP_441334.1_7 Forward -353 -334 -2.36049 0.0713
NP_442256.1_2 Forward -353 -335 -7.25734 0.214
NP_440437.1_1 Reverse -336 -355 14.2574 0.0272
NP_442012.1_1 Reverse -336 -355 -0.197208 0.253
NP_441556.1_10 Forward -260 -246 9.44312 0.298
NP_441644.1_6 Forward -351 -341 17.3841 0.00127
NP_441644.1_6 Reverse -342 -352 10.1076 0.0628
NP_441644.1_6 Reverse -336 -346 7.25606 0.132
NP_441644.1_6 Reverse -252 -262 5.87944 0.174
NP_441644.1_6 Forward -261 -251 3.32285 0.288
NP_442215.1_2 Forward -353 -337 20.9047 0.00603
NP_442215.1_2 Forward -263 -247 -2.39974 0.197
NP_442215.1_2 Forward -80 -64 -5.05468 0.244
NP_440253.1_2 Reverse -342 -360 30.6984 0.0000168
NP_440253.1_2 Forward -351 -333 6.01734 0.0864
NP_440929.1_8 Forward -351 -342 19.2726 0.000701
NP_440929.1_8 Reverse -342 -351 19.2726 0.000701
NP_442933.1_10 Forward -351 -342 17.601 0.00325
NP_442933.1_10 Reverse -342 -351 17.601 0.00325
NP_441751.2_8 Forward -350 -336 -0.787057 0.129
NP_441751.2_8 Reverse -343 -357 -3.93365 0.157
NP_440096.1_9 Reverse -22 -41 16.8552 0.253
NP_442554.1_8 Reverse -343 -353 16.008 0.0065
NP_442554.1_8 Forward -350 -340 15.9097 0.00747
NP_442554.1_8 Forward -260 -250 2.43831 0.272
NP_442554.1_8 Forward -344 -334 1.94665 0.288
NP_441762.1_7 Reverse -341 -353 12.4287 0.0142
NP_441762.1_7 Forward -352 -340 2.30059 0.0676
NP_442313.1_5 Reverse -337 -356 4.32602 0.273
NP_442142.1_4 Reverse -339 -352 18.0132 0.0255
NP_442142.1_4 Forward -354 -341 13.8833 0.0324
NP_442142.1_4 Forward -145 -132 9.36014 0.0973
NP_442142.1_4 Forward -168 -155 4.24695 0.227
NP_442292.1_1 Forward -350 -341 18.486 0.00229
NP_442292.1_1 Reverse -343 -352 9.63616 0.0183
NP_442381.1_8 Forward -354 -335 -4.81876 0.137
NP_442381.1_8 Reverse -172 -191 -9.83364 0.248
NP_443009.1_5 Reverse -341 -352 18.3477 0.00265
NP_441715.1_4 Forward -350 -340 14.828 0.0268
NP_441715.1_4 Reverse -343 -353 9.32148 0.097
NP_441448.1_1 Reverse -181 -200 10.1275 0.191
NP_440158.1_8 Forward -353 -334 9.73422 0.264
NP_440183.1_9 Reverse -344 -363 -15.5368 0.273
NP_440379.1_5 Forward -276 -257 1.27776 0.162
NP_440379.1_5 Reverse -333 -352 -3.54046 0.204
NP_440379.1_5 Forward -354 -335 -10.4236 0.28
NP_441468.1_1 Forward -350 -343 15.8704 0.0124
NP_441468.1_1 Reverse -343 -350 15.8704 0.0124
NP_439939.1_1 Reverse -347 -366 12.4867 0.275
NP_441020.2_6 Reverse -340 -357 15.5751 0.0385
NP_441020.2_6 Forward -353 -336 14.1985 0.0592
NP_441015.1_10 Forward -350 -331 9.3409 0.0763
NP_441015.1_10 Forward -356 -337 -4.81876 0.212
NP_441673.1_1 Forward -351 -342 20.8459 0.000698
NP_441673.1_1 Reverse -342 -351 20.8459 0.000698
NP_441876.1_9 Forward -205 -195 13.6475 0.267
NP_441826.1_2 Reverse -336 -350 15.5359 0.0196
NP_441826.1_2 Forward -357 -343 1.57289 0.147
NP_442868.1_6 Reverse -340 -350 9.91146 0.038
NP_442868.1_6 Forward -353 -343 8.53483 0.0555
NP_441056.1_1 Forward -351 -332 13.2741 0.0433
NP_441612.1_2 Forward -351 -341 8.54929 0.21
NP_442361.1_3 Reverse -336 -349 19.0955 0.0363
NP_442808.1_1 Forward -352 -342 18.4657 0.00201
NP_442808.1_1 Reverse -341 -351 8.63269 0.0481
NP_441101.1_1 Forward -353 -335 8.08229 0.294
NP_441101.1_10 Reverse -338 -357 -6.39206 0.29
NP_440145.1_3 Forward -361 -342 -0.885524 0.144
NP_442718.1_2 Reverse -237 -256 6.29264 0.126
NP_442542.1_2 Forward -353 -340 21.0621 0.00555
NP_442050.1_5 Reverse -340 -350 16.4991 0.00812
NP_442050.1_5 Forward -353 -343 8.23937 0.234
NP_442342.1_9 Forward -353 -337 2.32015 0.29
NP_440334.1_2 Reverse -241 -254 14.4739 0.249
NP_441114.1_3 Reverse -247 -256 7.37455 0.239
NP_440558.1_2 Reverse -333 -352 7.37428 0.12
NP_440558.1_2 Forward -258 -239 4.03102 0.152
NP_440558.1_2 Reverse -59 -78 -4.32711 0.244
NP_440558.1_2 Reverse -236 -255 -7.57203 0.296
NP_442789.1_4 Forward -353 -334 10.0292 0.0942
NP_442789.1_4 Reverse -184 -203 4.62101 0.153
NP_442789.1_4 Reverse -253 -272 -7.08038 0.291
NP_441518.1_3 Forward -361 -342 5.50599 0.05
NP_441518.1_3 Reverse -332 -351 -11.4069 0.26
NP_441878.1_6 Forward -352 -342 10.4031 0.0176
NP_441878.1_6 Reverse -341 -351 10.4031 0.0176
NP_441878.1_6 Forward -78 -68 -7.78811 0.266
NP_441878.1_6 Reverse -251 -261 -7.98478 0.285
NP_441036.1_8 Forward -352 -342 17.7779 0.000554
NP_441036.1_8 Reverse -341 -351 8.33817 0.174
NP_442650.1_2 Forward -351 -337 6.6861 0.13
NP_441557.1_5 Forward -351 -342 19.9609 0.000699
NP_441557.1_5 Reverse -342 -351 19.9609 0.000699
NP_441445.1_1 Forward -360 -341 3.93269 0.204
NP_442066.2_9 Forward -355 -342 8.47575 0.185
NP_442962.1_5 Forward -138 -119 5.89931 0.242
NP_442419.1_2 Reverse -337 -356 -2.55715 0.247
NP_442419.1_2 Reverse -331 -350 -2.75381 0.247
NP_440744.1_2 Forward -352 -333 14.5282 0.294
NP_441308.1_8 Forward -353 -343 9.22315 0.226
NP_441458.1_10 Reverse -333 -352 4.12936 0.236
NP_442183.1_1 Reverse -342 -356 18.8791 0.00656
NP_442183.1_1 Forward -351 -337 7.07942 0.149
NP_442183.1_9 Reverse -159 -169 9.7148 0.296
NP_441407.1_5 Forward -361 -342 9.24257 0.149
NP_442397.1_1 Forward -367 -353 17.5764 0.191
NP_441574.1_1 Forward -363 -344 -5.80207 0.268
NP_440276.1_1 Reverse -5 -24 19.3102 0.0901
NP_441467.1_10 Forward -138 -124 6.29277 0.281
NP_442170.1_5 Reverse -342 -361 4.62101 0.162
NP_442347.1_2 Forward -350 -341 12.4878 0.056
NP_442347.1_2 Reverse -343 -352 11.1111 0.056
NP_442645.1_2 Reverse -334 -353 -14.6519 0.177
NP_441411.1_2 Forward -210 -191 18.879 0.0747
NP_442888.1_6 Reverse -122 -141 2.0644 0.271
NP_441037.1_4 Forward -353 -343 16.2838 0.0168
NP_441037.1_6 Reverse -68 -87 22.7139 0.028
NP_441633.1_3 Reverse -340 -353 11.1307 0.0286
NP_441633.1_3 Forward -353 -340 -3.81562 0.177
NP_440136.1_2 Forward -350 -343 15.9687 0.0123
NP_440136.1_2 Reverse -343 -350 15.9687 0.0123
NP_442998.1_5 Forward -183 -173 9.41981 0.241
NP_442998.1_5 Reverse -199 -209 8.33817 0.264
NP_442998.1_10 Forward -349 -342 15.5754 0.0102
NP_442998.1_10 Reverse -344 -351 15.5754 0.0102
NP_442998.1_10 Reverse -385 -392 7.21728 0.144
NP_440899.1_2 Reverse -331 -350 18.1898 0.0452
NP_440299.1_1 Reverse -338 -351 22.3398 0.000547
NP_441799.1_1 Forward -355 -341 9.04542 0.1
NP_441799.1_1 Reverse -338 -352 7.86545 0.13
NP_441007.1_10 Forward -356 -343 3.26421 0.182
NP_441007.1_10 Reverse -337 -350 -0.570702 0.287
NP_442333.2_5 Reverse -331 -350 -12.1936 0.249
NP_440256.1_1 Reverse -339 -358 11.7992 0.0138
NP_440256.1_1 Forward -354 -335 -6.09707 0.201
NP_441229.1_3 Reverse -258 -270 19.0169 0.248
NP_441559.1_8 Forward -259 -245 -5.9986 0.271
NP_441559.1_8 Reverse -337 -351 -6.78525 0.279
NP_441559.1_8 Forward -204 -190 -7.17857 0.287
NP_442756.1_2 Reverse -244 -263 5.70265 0.27
NP_440915.1_6 Forward -355 -341 6.3911 0.0826
NP_440915.1_6 Reverse -338 -352 3.8345 0.1
NP_441704.1_8 Reverse -331 -350 14.9449 0.096
NP_442452.1_8 Reverse -336 -350 14.7486 0.273
NP_442866.1_1 Forward -356 -337 -2.26216 0.21
NP_441464.1_8 Reverse -342 -356 7.9644 0.204
NP_441199.1_6 Reverse -338 -357 -0.39387 0.268
NP_441494.1_6 Reverse -118 -131 6.01747 0.289
NP_442993.1_1 Forward -313 -297 -1.12144 0.0876
NP_442993.1_1 Reverse -342 -358 -7.80794 0.146
NP_442993.1_1 Forward -339 -323 -12.7245 0.278
NP_440677.1_1 Forward -360 -341 10.8159 0.163
NP_442386.1_9 Forward -352 -343 15.7322 0.0144
NP_442386.1_9 Reverse -341 -350 13.8639 0.0289
NP_442386.1_9 Reverse -335 -344 10.324 0.132
NP_442386.1_9 Forward -255 -246 7.17747 0.219
NP_441750.1_1 Forward -351 -332 -11.9969 0.3
NP_441750.1_4 Reverse -338 -357 7.37428 0.159
NP_441340.1_5 Forward -350 -343 15.6737 0.0124
NP_441340.1_5 Reverse -343 -350 15.6737 0.0124
NP_442484.1_2 Reverse -331 -350 10.6192 0.113
NP_442484.1_2 Forward -272 -253 2.85105 0.218
NP_440168.1_2 Reverse -349 -368 -3.93378 0.276
NP_440327.1_6 Forward -272 -253 2.55606 0.294
NP_442240.1_1 Reverse -334 -353 2.9486 0.295
NP_440586.1_8 Forward -350 -343 13.2151 0.026
NP_440586.1_8 Reverse -343 -350 13.2151 0.026
NP_440586.1_8 Reverse -130 -137 10.7568 0.128
NP_442251.1_6 Forward -350 -343 15.2804 0.0124
NP_442251.1_6 Reverse -343 -350 15.2804 0.0124
NP_440192.1_4 Reverse -169 -188 8.52442 0.296
NP_441262.1_3 Reverse -342 -349 14.7888 0.0223
NP_441262.1_3 Forward -351 -344 14.7888 0.0223
NP_443051.1_1 Reverse -341 -350 10.4228 0.00754
NP_443051.1_1 Forward -352 -343 10.4228 0.00754
NP_439937.1_9 Forward -212 -195 -11.4665 0.256
NP_439937.1_9 Reverse -341 -358 -16.2847 0.287
NP_442294.1_3 Forward -134 -120 12.192 0.29
NP_443039.1_7 Reverse -358 -372 7.3738 0.19
NP_440408.1_7 Forward -351 -332 13.0775 0.196
NP_440439.1_1 Reverse -339 -352 7.29578 0.0664
NP_440439.1_1 Forward -354 -341 2.47756 0.133
NP_440372.1_2 Forward -350 -343 16.3621 0.0124
NP_440372.1_2 Reverse -343 -350 16.3621 0.0124
NP_440378.1_6 Forward -64 -45 13.7658 0.291
NP_440819.1_5 Reverse -119 -127 15.8507 0.185
NP_442488.1_4 Forward -182 -163 9.14423 0.297
NP_441803.1_2 Reverse -337 -356 9.73422 0.095
NP_439977.1_5 Forward -357 -338 4.916 0.15
NP_440139.1_1 Forward -357 -338 10.3234 0.0921
NP_442384.1_10 Forward -351 -338 17.4239 0.00585
NP_442384.1_10 Reverse -252 -265 3.36254 0.193
NP_442384.1_10 Reverse -111 -124 1.19926 0.267
NP_442114.1_4 Reverse -342 -353 12.1534 0.107
NP_440364.1_6 Forward -352 -339 14.375 0.275
NP_441631.1_6 Reverse -334 -353 17.3057 0.238
NP_442262.1_10 Forward -350 -343 14.1988 0.0123
NP_442262.1_10 Reverse -343 -350 14.1988 0.0123
NP_442262.1_10 Reverse -337 -344 9.47889 0.187
NP_441689.1_5 Reverse -340 -350 15.3192 0.0403
NP_440163.1_10 Reverse -339 -349 12.4681 0.159
NP_440344.1_10 Forward -358 -341 17.3451 0.0033
NP_440344.1_10 Reverse -335 -352 -1.43612 0.0537
NP_440531.1_6 Reverse -334 -353 -1.27885 0.231
NP_442123.1_3 Reverse -342 -361 17.3057 0.0891
NP_440487.1_1 Forward -354 -335 4.81767 0.119
NP_440562.1_3 Forward -350 -333 6.62702 0.15
NP_441965.1_10 Forward -354 -338 10.6783 0.107
NP_441640.1_8 Forward -350 -331 -0.688862 0.198
NP_440297.1_9 Forward -350 -340 9.32148 0.0917
NP_440297.1_9 Reverse -63 -73 3.91327 0.253
NP_440297.1_9 Reverse -343 -353 -0.216628 0.282
NP_440350.1_2 Forward -139 -120 7.27595 0.248
NP_440894.1_10 Forward -356 -337 2.0644 0.298
NP_440999.1_9 Forward -355 -341 14.1593 0.0277
NP_440888.1_2 Forward -351 -337 18.4851 0.00237
NP_440888.1_2 Reverse -342 -356 15.6336 0.00976
NP_440491.1_1 Forward -354 -335 17.9297 0.0504
NP_440052.1_5 Reverse -331 -350 -5.80207 0.298
NP_442277.1_4 Forward -360 -341 5.70185 0.172
NP_442033.1_10 Forward -353 -334 -7.57203 0.186
NP_441543.1_2 Reverse -343 -352 18.486 0.00236
NP_441543.1_2 Forward -350 -341 16.9127 0.00359
NP_441543.1_2 Reverse -130 -139 8.25953 0.104
NP_442845.1_2 Forward -351 -337 16.8142 0.0608
NP_442845.1_2 Reverse -336 -350 7.07942 0.199
NP_442845.1_2 Forward -78 -64 6.09611 0.217
NP_441319.1_8 Reverse -336 -354 5.32902 0.28
NP_441469.1_8 Forward -352 -343 16.126 0.00797
NP_441469.1_8 Forward -255 -246 12.1928 0.123
NP_441469.1_8 Reverse -341 -350 6.48957 0.227
NP_443064.1_6 Forward -351 -341 12.5669 0.0796
NP_442578.1_7 Forward -350 -343 14.5921 0.026
NP_442578.1_7 Reverse -343 -350 14.5921 0.026
NP_440220.1_4 Reverse -116 -135 -0.984623 0.262
NP_441462.1_2 Forward -351 -341 11.5831 0.00406
NP_441462.1_2 Reverse -342 -352 11.5831 0.00406
NP_441621.1_7 Forward -353 -339 6.48943 0.068
NP_441621.1_7 Reverse -340 -354 -3.34366 0.188
NP_443062.1_1 Reverse -342 -360 9.6185 0.131
NP_443062.1_1 Forward -138 -120 4.35311 0.264
NP_441601.1_4 Forward -202 -183 -5.70374 0.294
NP_442204.1_1 Reverse -338 -349 9.69511 0.0736
NP_442204.1_5 Forward -264 -245 11.4058 0.0764
NP_441351.1_8 Reverse -349 -368 3.04771 0.233
NP_440516.1_8 Forward -351 -342 16.9127 0.00442
NP_440516.1_8 Reverse -342 -351 16.9127 0.00442
NP_441785.1_1 Reverse -342 -356 12.4475 0.245
NP_441785.1_1 Forward -120 -106 11.5748 0.293
NP_441033.1_2 Forward -361 -342 -8.65367 0.293
NP_442428.1_5 Forward -350 -343 15.8704 0.0124
NP_442428.1_5 Reverse -343 -350 15.8704 0.0124
NP_440818.1_6 Reverse -256 -275 9.0459 0.228
NP_440818.1_6 Forward -362 -343 5.89931 0.284
NP_442120.1_10 Forward -150 -131 -6.1954 0.207
NP_442120.1_10 Forward -357 -338 -8.16202 0.23
NP_442120.1_10 Forward -372 -353 -12.2919 0.27
NP_440673.1_2 Reverse -332 -351 8.24345 0.275
NP_440673.1_3 Forward -349 -342 12.4288 0.0426
NP_440673.1_3 Reverse -344 -351 12.4288 0.0426
NP_440673.1_7 Reverse -331 -350 3.04771 0.216
NP_441052.1_2 Forward -351 -341 19.9412 0.00106
NP_441052.1_2 Reverse -342 -352 10.5014 0.0285
NP_442219.1_9 Forward -350 -341 17.7976 0.00718
NP_442219.1_9 Reverse -343 -352 8.35786 0.0681
NP_440436.1_4 Reverse -343 -352 18.1905 0.00233
NP_440436.1_4 Forward -350 -341 17.2072 0.00233
NP_441884.1_9 Forward -354 -335 15.6341 0.0078
NP_442414.1_8 Forward -206 -187 6.88262 0.293
NP_440577.1_2 Forward -266 -247 13.8641 0.219
NP_441086.1_3 Reverse -290 -309 5.55986 0.29
NP_441719.1_4 Forward -350 -343 16.3621 0.0124
NP_441719.1_4 Reverse -343 -350 16.3621 0.0124
NP_441733.1_10 Forward -354 -341 10.639 0.106
NP_441733.1_10 Reverse -339 -352 7.49244 0.153
NP_441004.1_1 Forward -83 -64 -13.0786 0.253
NP_441004.1_3 Reverse -342 -361 6.19431 0.224
NP_441004.1_4 Forward -382 -372 11.3864 0.254
NP_442813.1_4 Reverse -147 -166 -5.21209 0.299
NP_442366.1_3 Forward -352 -334 4.34571 0.0984
NP_442366.1_3 Reverse -341 -359 -2.83245 0.234
NP_442139.1_7 Forward -82 -63 10.6192 0.198
NP_440129.1_10 Forward -358 -344 4.12949 0.185
NP_440296.1_10 Forward -354 -335 -14.2585 0.269
NP_442206.1_1 Reverse -327 -346 -10.817 0.219
NP_442206.1_10 Forward -351 -336 5.97809 0.178
NP_443054.1_2 Reverse -340 -354 21.7307 0.00482
NP_441966.1_6 Reverse -242 -261 6.58763 0.289
NP_441851.1_10 Forward -352 -342 16.008 0.00552
NP_441851.1_10 Reverse -341 -351 15.8113 0.00552
NP_441851.1_10 Forward -78 -68 5.19158 0.221
NP_442208.1_5 Forward -197 -178 -7.67036 0.274
NP_442622.1_1 Reverse -341 -360 -11.4069 0.257
NP_442622.1_5 Forward -353 -334 -2.65548 0.171
NP_441542.1_4 Reverse -234 -248 3.53951 0.272
NP_442856.1_7 Reverse -333 -352 -5.99873 0.291
NP_442515.1_1 Reverse -341 -355 5.30946 0.107
NP_442515.1_1 Forward -151 -137 0.982901 0.174
NP_440593.1_3 Reverse -331 -350 -6.58872 0.278
NP_440593.1_9 Forward -187 -173 10.1277 0.24
NP_440593.1_9 Reverse -339 -353 10.0294 0.24
NP_442689.1_8 Forward -110 -93 -5.46769 0.272
NP_441409.1_6 Reverse -336 -355 -0.590531 0.0705
NP_441409.1_8 Reverse -108 -127 17.332 0.209
NP_440432.1_9 Reverse -343 -358 10.0097 0.0419
NP_442843.1_1 Reverse -253 -272 -10.6203 0.279
NP_442843.1_1 Forward -137 -118 -10.9153 0.282
NP_439960.1_10 Reverse -335 -353 15.1621 0.0769
NP_439960.1_10 Forward -191 -173 -2.73412 0.258
NP_440474.1_8 Reverse -343 -357 17.3052 0.0432
NP_440726.1_2 Reverse -176 -195 1.37609 0.285
NP_440431.1_3 Reverse -67 -86 -3.44213 0.178
NP_442450.1_5 Reverse -340 -350 9.32148 0.115
NP_440588.1_2 Reverse -333 -352 -2.95047 0.174
NP_440195.1_5 Forward -357 -338 0.491109 0.298
NP_442006.1_2 Forward -360 -343 -16.5791 0.256
NP_442006.1_2 Forward -165 -148 -16.6774 0.261
NP_442006.1_2 Forward -345 -328 -18.5457 0.292
NP_442243.1_1 Reverse -245 -263 -1.45654 0.279
NP_441570.1_1 Forward -351 -333 8.7706 0.0132
NP_441078.1_4 Forward -351 -342 19.6659 0.0007
NP_441078.1_4 Reverse -342 -351 19.6659 0.0007
NP_441078.1_4 Reverse -252 -261 -1.96689 0.282
NP_442729.1_5 Forward -346 -336 14.0414 0.22
NP_442729.1_8 Reverse -338 -351 8.37742 0.125
NP_441663.1_7 Reverse -339 -358 15.6341 0.181
NP_442348.1_2 Forward -72 -63 9.14451 0.28
NP_440526.1_3 Reverse -343 -354 11.7595 0.0646
NP_440526.1_3 Forward -350 -339 7.92465 0.126
NP_441432.1_8 Reverse -341 -350 16.8143 0.00595
NP_441432.1_8 Forward -352 -343 8.25953 0.0755
NP_441432.1_8 Forward -72 -63 3.7363 0.243
NP_441432.1_8 Reverse -245 -254 2.65466 0.292
NP_442320.1_8 Forward -357 -343 14.1593 0.0138
NP_442320.1_8 Reverse -336 -350 3.63784 0.0578
NP_442344.1_7 Reverse -343 -362 2.0644 0.0644
NP_441732.1_2 Reverse -338 -354 2.22182 0.0253
NP_440760.1_1 Forward -351 -332 -23.01 0.278
NP_442797.1_1 Reverse -253 -272 7.96426 0.137
NP_442797.1_7 Reverse -335 -353 12.0155 0.158
NP_440199.1_10 Reverse -339 -349 7.64985 0.231
NP_440578.1_4 Forward -266 -247 13.4708 0.247
NP_442353.1_4 Reverse -246 -265 -0.787962 0.291
NP_440913.1_1 Forward -353 -335 5.72234 0.236
NP_442751.1_2 Forward -352 -333 2.16195 0.3
NP_442230.1_5 Reverse -349 -359 18.0729 0.266
NP_442489.1_7 Forward -351 -342 20.1576 0.000695
NP_442489.1_7 Reverse -342 -351 20.1576 0.000695
NP_442489.1_7 Reverse -252 -261 -1.27858 0.185
NP_442079.1_7 Forward -350 -331 10.5209 0.11
NP_442079.1_7 Reverse -343 -362 1.27776 0.258
NP_440559.1_1 Forward -350 -341 17.4043 0.00658
NP_440559.1_1 Reverse -343 -352 8.75118 0.0586
NP_441659.2_8 Forward -351 -341 18.1713 0.00133
NP_441659.2_8 Reverse -342 -352 11.9764 0.0147
NP_441659.2_8 Reverse -252 -262 2.33998 0.205
NP_442913.1_10 Forward -360 -341 0.58944 0.153
NP_442849.1_1 Reverse -295 -309 7.9644 0.282
NP_439956.1_7 Forward -82 -63 3.24438 0.257
NP_440335.1_9 Reverse -92 -110 9.55725 0.294
NP_440779.1_5 Reverse -342 -359 3.57876 0.0665
NP_442346.1_5 Reverse -341 -351 16.6963 0.00248
NP_442346.1_5 Forward -352 -342 9.02648 0.118
NP_442346.1_10 Reverse -340 -359 5.11266 0.168
NP_440545.1_3 Forward -355 -338 -1.43612 0.168
NP_440545.1_3 Reverse -338 -355 -2.51776 0.187
NP_440831.1_3 Reverse -333 -352 12.6972 0.139
NP_440459.1_2 Forward -347 -330 10.9536 0.185
NP_440010.1_4 Forward -355 -336 2.45694 0.225
NP_440010.1_10 Reverse -330 -349 7.07928 0.226
NP_442311.1_6 Forward -126 -107 15.4374 0.117
NP_442311.1_8 Forward -258 -239 8.94757 0.282
NP_442603.1_7 Forward -351 -337 20.7467 0.00695
NP_441888.1_7 Forward -356 -342 2.35953 0.225
NP_441948.1_4 Reverse -335 -353 6.31233 0.0646
NP_441833.1_4 Forward -350 -343 15.9687 0.0124
NP_441833.1_4 Reverse -343 -350 15.9687 0.0124
NP_443040.1_1 Reverse -103 -117 9.89403 0.291
NP_441329.1_6 Reverse -90 -109 -0.621121 0.278
NP_442060.1_10 Forward -200 -181 8.25926 0.269
NP_442162.1_9 Forward -350 -343 16.2637 0.0124
NP_442162.1_9 Reverse -343 -350 16.2637 0.0124
NP_440671.1_4 Reverse -336 -350 11.406 0.133
NP_440224.1_1 Reverse -331 -350 1.96607 0.132
NP_440772.1_6 Reverse -343 -362 6.88262 0.292
NP_442045.1_5 Reverse -333 -352 12.7825 0.182
NP_442073.1_6 Forward -264 -245 6.19431 0.25
NP_440204.1_1 Forward -272 -253 3.73603 0.278
NP_442199.1_5 Forward -359 -340 -5.01543 0.235
NP_442140.1_3 Reverse -343 -353 17.4829 0.0159
NP_442140.1_3 Forward -344 -334 5.19158 0.221
NP_442140.1_3 Forward -350 -340 4.40493 0.243
NP_440875.1_9 Reverse -344 -354 17.619 0.0104
NP_442547.1_7 Reverse -242 -261 15.1865 0.168
NP_441813.1_5 Reverse -340 -350 15.9097 0.01
NP_441813.1_5 Forward -353 -343 10.0098 0.0208
NP_442089.1_1 Reverse -339 -358 -0.787193 0.261
NP_440590.1_4 Reverse -343 -356 4.8375 0.0585
NP_440590.1_4 Forward -350 -337 4.14919 0.0632
NP_440590.1_4 Forward -260 -247 -0.472371 0.189
NP_440590.1_4 Reverse -246 -259 -0.767364 0.2
NP_440567.1_1 Forward -350 -336 12.9793 0.0213
NP_440567.1_1 Reverse -343 -357 9.04604 0.0501
NP_442497.1_10 Forward -350 -341 10.4228 0.0087
NP_442497.1_10 Reverse -343 -352 10.4228 0.0087
NP_440821.1_4 Forward -353 -343 18.7612 0.00422
NP_440821.1_4 Reverse -340 -350 18.2696 0.00448
NP_441239.1_9 Forward -353 -341 16.0669 0.0175
NP_441239.1_9 Reverse -340 -352 6.92215 0.173
NP_441239.1_9 Reverse -334 -346 5.05386 0.231
NP_441951.1_4 Forward -351 -332 17.404 0.168
NP_441009.1_4 Forward -77 -58 12.5858 0.232
NP_440156.1_3 Forward -363 -344 10.9142 0.126
NP_441727.1_3 Forward -358 -339 13.2741 0.117
NP_441892.1_1 Reverse -333 -350 -5.86102 0.29
NP_442105.1_9 Reverse -181 -195 14.2547 0.294
NP_442270.1_9 Reverse -331 -350 -7.57203 0.213
NP_440945.1_1 Forward -220 -201 14.3558 0.232
NP_440219.1_1 Reverse -5 -24 16.0881 0.158
NP_440219.1_1 Reverse -97 -116 13.9873 0.218
NP_440949.1_7 Forward -359 -340 15.6332 0.162
NP_441567.1_4 Forward -279 -260 6.39097 0.281
NP_442138.1_1 Reverse -60 -79 2.6536 0.24
NP_442809.1_6 Reverse -201 -220 -0.0988766 0.295
NP_440546.1_4 Reverse -342 -352 11.8882 0.0679
NP_440546.1_4 Forward -351 -341 10.046 0.109
NP_440546.1_4 Forward -345 -335 9.07643 0.156
NP_440546.1_6 Forward -277 -258 10.9142 0.245
NP_440546.1_7 Reverse -180 -190 16.1063 0.234
NP_441230.1_5 Reverse -331 -350 7.07928 0.166
NP_441230.1_5 Forward -356 -337 6.88262 0.168
NP_440462.1_6 Forward -353 -343 17.9746 0.00578
NP_440462.1_6 Reverse -340 -350 7.74818 0.0699
NP_440868.1_4 Forward -355 -343 9.77374 0.043
NP_440868.1_4 Reverse -338 -350 6.1355 0.0878
NP_440868.1_8 Forward -355 -336 -4.6221 0.263
NP_441474.1_1 Reverse -332 -351 0.0970122 0.255
NP_442402.1_4 Reverse -60 -79 -9.34271 0.288
NP_442402.1_10 Forward -207 -197 12.6642 0.204
NP_439942.1_1 Reverse -78 -97 17.5205 0.158
NP_441843.2_9 Reverse -344 -362 14.4798 0.189
NP_442039.1_4 Forward -350 -343 15.1821 0.0124
NP_442039.1_4 Reverse -343 -350 15.1821 0.0124
NP_442039.1_7 Forward -343 -333 9.7148 0.257
NP_442039.1_7 Forward -69 -59 7.25653 0.277
NP_442891.1_5 Forward -228 -218 15.8718 0.293
NP_440008.1_9 Reverse -336 -355 7.57094 0.283
NP_442696.1_2 Reverse -341 -359 20.9636 0.0201
NP_442837.1_3 Forward -350 -343 15.7721 0.0124
NP_442837.1_3 Reverse -343 -350 15.7721 0.0124
NP_442053.1_1 Forward -351 -342 18.3876 0.0007
NP_442053.1_1 Reverse -342 -351 18.3876 0.0007
NP_440505.1_3 Reverse -340 -350 16.303 0.00696
NP_440505.1_3 Forward -353 -343 14.1397 0.0235
NP_441102.1_1 Forward -350 -331 11.1109 0.131
NP_441203.1_1 Forward -350 -331 -19.7651 0.297
NP_442532.1_7 Reverse -342 -356 4.62115 0.171
NP_441408.2_7 Forward -353 -334 -2.45882 0.269
NP_440914.1_1 Forward -351 -341 17.5935 0.000537
NP_440914.1_1 Forward -254 -244 10.3717 0.142
NP_440914.1_1 Reverse -63 -73 9.39583 0.186
NP_440914.1_1 Reverse -342 -352 8.6151 0.186
NP_441699.1_7 Reverse -16 -35 3.63691 0.255
NP_441011.1_8 Reverse -343 -352 16.9127 0.00602
NP_441011.1_8 Forward -350 -341 8.25953 0.144
NP_442101.1_10 Reverse -334 -353 -8.94866 0.243
NP_442533.1_6 Forward -351 -342 17.2076 0.00137
NP_442533.1_6 Reverse -342 -351 17.2076 0.00137
NP_442533.1_6 Forward -261 -252 5.11294 0.155
NP_442533.1_6 Reverse -68 -77 4.32629 0.184
NP_442533.1_6 Reverse -252 -261 3.93297 0.197
NP_442541.1_10 Reverse -62 -76 5.50552 0.248
NP_442232.1_3 Reverse -183 -202 -14.9469 0.288
NP_442322.1_4 Reverse -60 -77 -2.71511 0.235
NP_441219.1_6 Forward -361 -343 23.0286 0.0234
NP_441482.1_7 Reverse -336 -350 0.589577 0.0554
NP_439944.1_9 Forward -350 -340 19.0562 0.00329
NP_439944.1_9 Reverse -343 -353 10.4031 0.0887
NP_442203.1_1 Forward -19 -5 15.5768 0.228
NP_441028.1_6 Forward -206 -196 6.37109 0.23
NP_440116.1_8 Forward -350 -331 8.94757 0.0369
NP_441527.1_4 Reverse -93 -112 -3.29489 0.164
NP_440115.1_6 Reverse -339 -349 9.41981 0.115
NP_440115.1_6 Reverse -199 -209 4.89658 0.28
NP_440007.1_9 Reverse -242 -256 3.53951 0.269
NP_440007.1_9 Reverse -338 -352 1.86788 0.282
NP_439965.1_1 Reverse -333 -352 -6.09707 0.211
NP_439965.1_7 Forward -274 -255 10.0276 0.294
NP_442492.1_2 Reverse -342 -361 5.89931 0.179
NP_441602.1_3 Forward -350 -331 -2.95047 0.239
NP_441972.1_5 Forward -350 -331 -7.4737 0.249
NP_441106.1_1 Forward -352 -343 18.191 0.0028
NP_441106.1_1 Reverse -341 -350 9.63616 0.0311
NP_439903.1_6 Forward -354 -335 2.35861 0.227
NP_442588.1_6 Forward -168 -149 3.83436 0.213
NP_440797.1_8 Forward -291 -272 15.3503 0.268
NP_440797.1_10 Forward -274 -255 9.53756 0.0675
NP_441286.1_1 Reverse -341 -353 14.7886 0.00418
NP_441286.1_1 Forward -352 -340 11.8387 0.0114
NP_442674.1_1 Reverse -288 -307 16.6773 0.133
NP_442674.1_3 Reverse -334 -353 7.4718 0.219
NP_440670.1_8 Forward -351 -342 18.3876 0.000699
NP_440670.1_8 Reverse -342 -351 18.3876 0.000699
NP_441647.1_1 Reverse -253 -272 17.404 0.128
NP_440886.1_7 Forward -352 -342 17.7774 0.0011
NP_440886.1_7 Reverse -341 -351 7.94438 0.0805
NP_440886.1_7 Reverse -335 -345 5.19112 0.194
NP_442614.1_2 Forward -351 -337 9.14437 0.242
NP_439995.1_5 Forward -361 -342 6.78429 0.276
NP_442072.1_9 Reverse -341 -359 -21.712 0.212
NP_440907.2_8 Reverse -343 -353 17.4824 0.00685
NP_442264.1_2 Forward -355 -338 8.7903 0.208
NP_441021.1_8 Reverse -337 -355 2.57575 0.246
NP_442459.1_7 Forward -113 -94 7.27595 0.197
NP_441463.1_3 Forward -361 -342 9.53756 0.0481
NP_441463.1_3 Reverse -131 -150 -3.04881 0.167
NP_441463.1_3 Reverse -235 -254 -4.6221 0.209
NP_441463.1_6 Reverse -340 -354 8.92841 0.25
NP_441463.1_6 Reverse -244 -258 8.25197 0.25
NP_441626.1_2 Forward -350 -343 15.7721 0.0124
NP_441626.1_2 Reverse -343 -350 15.7721 0.0124
NP_442912.1_10 Reverse -237 -256 21.6323 0.0352
NP_442365.1_5 Reverse -343 -362 9.73422 0.202
NP_442365.1_7 Reverse -338 -357 6.29264 0.116
NP_440107.1_5 Forward -352 -333 8.65258 0.139
NP_442794.1_1 Reverse -338 -350 19.7052 0.00523
NP_442615.1_1 Forward -360 -342 4.24738 0.048
NP_441962.1_4 Reverse -337 -356 1.76941 0.103
NP_441962.1_4 Forward -260 -241 -5.60541 0.17
NP_441962.1_4 Forward -350 -331 -9.73531 0.22
NP_441962.1_4 Reverse -247 -266 -10.1286 0.224
NP_440387.1_1 Forward -351 -335 4.3851 0.0426
NP_440387.1_1 Reverse -342 -358 -0.236458 0.137
NP_440387.1_1 Reverse -200 -216 -5.34967 0.227
NP_440855.1_5 Reverse -244 -263 14.6499 0.141
NP_441431.1_2 Forward -354 -340 8.75042 0.207
NP_442647.1_7 Reverse -331 -344 6.21414 0.257
NP_441993.1_1 Forward -351 -332 8.7687 0.139
NP_441993.1_1 Reverse -336 -355 3.21363 0.239
NP_441993.1_1 Reverse -173 -192 1.94669 0.267
NP_441174.1_2 Reverse -339 -353 18.5841 0.023
NP_440467.1_8 Reverse -117 -136 11.6025 0.243
NP_440114.1_10 Reverse -342 -356 15.0442 0.0308
NP_442698.1_5 Forward -222 -208 20.2558 0.233
NP_440287.1_6 Reverse -243 -262 1.96607 0.257
NP_440766.1_4 Reverse -338 -352 17.5025 0.0255
NP_440766.1_4 Forward -349 -335 2.06454 0.2
NP_440766.1_5 Forward -66 -54 6.50989 0.299
NP_439988.1_3 Forward -349 -335 6.09611 0.278
NP_439988.1_7 Forward -352 -338 11.5037 0.292
NP_442743.1_4 Reverse -189 -208 -7.76869 0.28
NP_442743.1_5 Reverse -240 -259 7.07928 0.168
NP_442930.1_1 Reverse -79 -89 9.81266 0.28
NP_439910.1_2 Forward -359 -342 -21.2006 0.183
NP_440457.1_1 Reverse -338 -350 8.29878 0.101
NP_440798.1_6 Reverse -343 -356 2.47756 0.17
NP_440801.1_10 Forward -349 -330 6.39097 0.289
NP_441984.1_3 Reverse -169 -187 7.78729 0.239
NP_441984.1_3 Forward -355 -337 7.78729 0.239
NP_441332.1_6 Reverse -390 -400 12.5181 0.223
NP_440473.1_9 Forward -362 -343 -9.34199 0.26
NP_442509.1_9 Reverse -342 -352 16.2041 0.00739
NP_442509.1_9 Forward -351 -341 8.14104 0.192
NP_441489.1_3 Forward -68 -54 11.7571 0.211
NP_440660.1_6 Reverse -244 -263 13.5691 0.25
NP_442514.1_5 Reverse -244 -263 -6.58946 0.269
NP_440185.1_9 Forward -346 -329 13.5102 0.264
NP_440554.1_4 Reverse -343 -353 13.943 0.0218
NP_440554.1_4 Forward -350 -340 7.05986 0.106
NP_441885.1_5 Forward -351 -341 20.9245 0.000538
NP_441885.1_5 Reverse -342 -352 11.4848 0.00668
NP_441885.1_5 Forward -261 -251 -0.0199663 0.186
NP_440478.1_10 Forward -353 -339 7.47274 0.262
NP_442341.1_7 Forward -352 -338 16.1259 0.0186
NP_442341.1_7 Reverse -341 -355 12.291 0.0455
NP_442341.1_7 Forward -262 -248 4.91614 0.175
NP_442341.1_9 Forward -353 -339 10.3237 0.135
NP_442341.1_9 Forward -263 -249 6.48882 0.225
NP_442341.1_9 Forward -342 -328 6.19383 0.238
NP_441756.1_5 Forward -202 -183 -4.6221 0.295
NP_440423.1_6 Forward -359 -340 -14.0619 0.224
NP_440423.1_6 Reverse -183 -202 -20.65 0.263
NP_440423.1_10 Reverse -335 -354 13.1758 0.176
NP_443000.1_7 Reverse -340 -350 17.0896 0.00865
NP_443000.1_7 Forward -353 -343 2.04498 0.226
NP_440507.2_3 Forward -360 -341 10.6184 0.205
NP_440507.2_3 Reverse -333 -352 9.04509 0.236
NP_441842.1_1 Forward -209 -196 14.2767 0.111
NP_441842.1_10 Forward -358 -344 16.9125 0.0273
NP_441842.1_10 Reverse -335 -349 6.78443 0.272
NP_440275.1_3 Forward -353 -343 17.9746 0.0082
NP_440275.1_3 Reverse -340 -350 8.1415 0.0602
NP_440091.1_1 Forward -355 -343 20.1968 0.00953
NP_440091.1_1 Reverse -338 -350 -0.452677 0.273
NP_441307.1_6 Forward -351 -332 8.35759 0.217
NP_440679.1_10 Forward -352 -333 -16.4218 0.261
NP_443010.1_10 Forward -313 -296 1.90109 0.289
NP_442451.1_2 Reverse -334 -353 0.884433 0.148
NP_441635.1_2 Forward -63 -44 19.3367 0.241
NP_441122.1_1 Forward -265 -250 4.20813 0.28
NP_439962.1_4 Reverse -334 -353 3.6377 0.187
NP_439962.1_4 Forward -353 -334 3.44104 0.189
NP_440175.1_7 Forward -277 -259 9.85107 0.276
NP_440804.1_7 Reverse -8 -25 9.18288 0.261
NP_440149.1_8 Forward -351 -332 21.2389 0.00726
NP_440149.1_8 Reverse -123 -142 -6.29373 0.246
NP_441105.1_3 Reverse -241 -260 2.85105 0.097
NP_441105.1_3 Forward -266 -247 -9.34199 0.288
NP_441105.1_5 Reverse -58 -76 14.6697 0.258
NP_440216.1_1 Reverse -342 -356 6.29277 0.0156
NP_440216.1_1 Forward -351 -337 -0.590395 0.0284
NP_440172.1_1 Forward -351 -341 15.0247 0.00945
NP_440172.1_1 Reverse -342 -352 8.73149 0.0586
NP_442290.1_8 Reverse -341 -355 14.6509 0.288
NP_442015.1_10 Reverse -338 -351 18.8988 0.00492
NP_441226.1_7 Forward -350 -343 14.4934 0.0123
NP_441226.1_7 Reverse -343 -350 14.4934 0.0123
NP_441226.1_7 Forward -260 -253 9.77352 0.131
NP_441226.1_7 Reverse -69 -76 8.59356 0.197
NP_441226.1_7 Reverse -252 -259 6.82361 0.246
NP_440117.1_1 Forward -22 -3 -2.16383 0.258
NP_441111.1_7 Forward -350 -342 18.7023 0.00294
NP_441111.1_7 Reverse -343 -351 18.7023 0.00294
NP_442379.1_10 Reverse -335 -352 -1.82945 0.224
NP_441766.1_2 Forward -351 -342 17.5026 0.00297
NP_441766.1_2 Reverse -342 -351 17.5026 0.00297
NP_442417.1_5 Forward -351 -337 10.0294 0.124
NP_442252.1_3 Forward -358 -340 8.57394 0.249
NP_440416.1_1 Reverse -342 -361 -5.60541 0.155
NP_440416.1_9 Reverse -335 -354 1.37609 0.0457
NP_443052.1_8 Forward -361 -342 12.0942 0.0129
NP_442403.1_8 Forward -136 -117 10.9142 0.134
NP_442403.1_9 Forward -273 -254 3.04771 0.281
NP_440261.1_5 Forward -350 -337 -1.06236 0.0655
NP_440261.1_5 Reverse -343 -356 -10.6005 0.201
NP_440261.1_7 Forward -190 -171 9.63589 0.0911
NP_440988.1_10 Reverse -244 -258 4.80201 0.25
NP_440988.1_10 Reverse -61 -75 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGTACGGGGCAATATTTTGCGCCTACGGGAAATGGAATTTGTCAAAGCGGCGATCGCCATGGGGGCAGGTTCTAACCATATTATTTGGCGACATTTGTTACCCAATGTGTTGAATTTAATCATTGTGGCCGCTAGTTTGGCCGTCGGCAATGCCATTATTACCGAATCAACTTTGAGCTTTTTAGGCTTAGGATTTCCCCCCGATGTGCCCACCTGGGGCCAGATGCTTTACACCGCCAAGGATTATTTGGAAACGGCACCATTGATGGCAGTTTTTCCGGGCTTAGCTATTTTTATTACCGTTTTAAGTGTTAATTATTTGGGGGACGGCATTGGCATAAAAAATAGTTAATGATGCAACCCTATTGATCAATCTTAGTTAAGCTCAAAATAAATTTC

CDS

ATGATTCGTCCAGTTCCCGATGCTAGTAATCAGTTTTATTTAGACCATATTAATTTACTACGTCAAAGTTATGAGCGCTTAACTGGTAAAACCTTTGGGCCCAGCGGATTAACCGGGGTGGCCCTAGCCCAGGCCGTCTATGAAGCTCCCTACGTAGTAGTTTCCCATGGCATAGAGCCTGACCCAATTTTTAATTATGCTAATCTTACTGCCCAAAAATTATTTGAATTTCCCTGGGTAGAATTTTGTCAATTGCCATCCCGTCAGTCCGCAGAACTTCCTAATCAAACGGAAAGGCAACAATTGTTAGATACCGTCAGCCGCCAAGGTTTTATTGAAAATTACCAAGGTATACGCATTGCCAAGGGTGGTGGCCGCTTTTGGATTAAAAATGTTACCGTTTGGAATCTCTACGACGGCGAAGGGATTTATCGGGGTCAGGGGGCAATTTATAGTGATTGGGAGAATATTGTTGAAAAGCTTTAA

Protein

MIRPVPDASNQFYLDHINLLRQSYERLTGKTFGPSGLTGVALAQAVYEAPYVVVSHGIEPDPIFNYANLTAQKLFEFPWVEFCQLPSRQSAELPNQTERQQLLDTVSRQGFIENYQGIRIAKGGGRFWIKNVTVWNLYDGEGIYRGQGAIYSDWENIVEKL