Your browser is old and dusty. Try Google Chrome!

Details for slr0320

ORF slr0320
Accession NP_441949.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -136 -122 11.8976 0.23
NP_442711.1_1 Forward -338 -324 10.816 0.264
NP_440815.1_2 Reverse -185 -199 10.422 0.265
NP_442291.1_5 Forward -240 -224 -5.05468 0.296
NP_441453.1_7 Forward -182 -175 11.9372 0.298
NP_442151.1_6 Reverse -22 -36 6.88276 0.217
NP_442182.1_3 Reverse -30 -49 2.55606 0.264
NP_441818.1_1 Forward -155 -144 10.3829 0.232
NP_441818.1_9 Reverse -1 -20 0.982764 0.191
NP_441818.1_9 Forward -334 -315 -7.08038 0.268
NP_440226.1_1 Forward -345 -326 2.65439 0.256
NP_442169.1_1 Forward -340 -321 -0.0988766 0.261
NP_443002.1_5 Reverse -181 -199 11.2281 0.247
NP_442173.1_1 Reverse -78 -86 5.13263 0.226
NP_442752.1_4 Forward -328 -321 12.1338 0.0546
NP_442752.1_4 Reverse -224 -231 5.25066 0.256
NP_443027.1_4 Forward -325 -315 9.61647 0.159
NP_441675.1_4 Reverse -197 -216 6.88262 0.236
NP_440061.1_6 Forward -83 -65 11.8181 0.268
NP_442062.1_8 Forward -156 -146 6.17489 0.136
NP_442062.1_8 Reverse -77 -87 3.51995 0.267
NP_440044.1_8 Reverse -315 -334 -2.16383 0.261
NP_441781.1_7 Forward -50 -31 0.982764 0.239
NP_440916.1_1 Forward -168 -154 10.3243 0.208
NP_439918.1_1 Reverse -371 -390 16.0274 0.14
NP_439918.1_2 Forward -154 -135 -1.86883 0.24
NP_441594.1_6 Reverse -32 -51 5.99764 0.198
NP_441546.1_2 Forward -303 -284 17.7974 0.244
NP_441082.1_10 Forward -333 -320 12.114 0.236
NP_441925.1_4 Reverse -319 -338 -14.6526 0.263
NP_440769.1_8 Reverse -150 -169 9.3409 0.214
NP_441083.1_5 Forward -233 -223 3.91327 0.162
NP_441083.1_5 Reverse -22 -32 3.02829 0.182
NP_442827.1_8 Forward -241 -222 -1.57461 0.249
NP_441434.1_1 Forward -75 -61 7.07802 0.288
NP_442136.1_1 Forward -82 -63 14.4541 0.114
NP_442889.1_8 Reverse -316 -330 3.34225 0.281
NP_440178.1_7 Forward -143 -124 -15.5368 0.162
NP_442570.1_3 Forward -158 -139 1.0811 0.2
NP_442461.1_2 Reverse -202 -221 14.6508 0.216
NP_441624.1_7 Forward -23 -9 9.93102 0.217
NP_440343.1_3 Forward -239 -221 3.75497 0.266
NP_440438.2_8 Reverse -63 -82 24.4839 0.00624
NP_441194.1_1 Forward -83 -64 12.2703 0.238
NP_442634.1_4 Reverse -239 -253 5.01447 0.0671
NP_442760.1_7 Reverse -17 -36 14.6508 0.127
NP_440403.1_10 Reverse -20 -39 2.26107 0.279
NP_441014.1_8 Forward -23 -4 -8.94866 0.288
NP_441014.1_8 Reverse -323 -342 -9.047 0.289
NP_441634.1_8 Forward -104 -90 11.701 0.0553
NP_440376.1_1 Reverse -1 -10 0.884706 0.259
NP_440376.1_1 Forward -328 -319 0.196389 0.283
NP_442687.1_7 Forward -87 -77 6.56821 0.159
NP_442687.1_7 Reverse -240 -250 4.0116 0.271
NP_441077.1_2 Forward -175 -156 5.0129 0.224
NP_441846.1_10 Forward -308 -289 -13.0786 0.197
NP_441388.1_3 Reverse -124 -143 7.4718 0.245
NP_441029.1_3 Reverse -135 -154 0.392778 0.277
NP_440887.1_5 Reverse -99 -118 21.1903 0.0519
NP_442658.1_1 Reverse -145 -155 6.27276 0.234
NP_442782.1_2 Reverse -241 -255 0.491246 0.289
NP_440184.1_1 Reverse -64 -83 5.07734 0.22
NP_441256.1_1 Reverse -93 -112 -5.80207 0.236
NP_442937.1_5 Forward -147 -128 14.2574 0.0802
NP_440203.1_5 Reverse -149 -159 11.4843 0.19
NP_440203.1_5 Reverse -322 -332 10.796 0.213
NP_440203.1_5 Reverse -364 -374 9.02601 0.275
NP_439905.1_1 Reverse -362 -375 12.3107 0.203
NP_443001.1_7 Forward -154 -135 8.75091 0.199
NP_440984.1_7 Reverse -314 -328 6.98109 0.192
NP_442690.1_1 Forward -79 -60 -10.522 0.215
NP_440153.1_5 Reverse -231 -245 0.786239 0.289
NP_440153.1_8 Reverse -87 -100 -2.83231 0.266
NP_442064.1_4 Forward -199 -180 15.3382 0.128
NP_443055.1_6 Forward -31 -13 1.78836 0.224
NP_443055.1_6 Reverse -77 -95 -1.06322 0.271
NP_442210.1_9 Forward -140 -122 9.55725 0.259
NP_440138.1_6 Reverse -363 -382 0.686995 0.294
NP_442002.1_9 Forward -87 -80 9.97054 0.246
NP_441712.1_1 Reverse -195 -214 11.1637 0.251
NP_441294.1_7 Reverse -322 -336 8.77068 0.281
NP_440411.1_10 Forward -150 -131 9.09059 0.293
NP_441646.1_1 Forward -149 -130 -1.18052 0.28
NP_441000.1_6 Forward -346 -332 1.96621 0.156
NP_440147.1_4 Reverse -334 -347 1.10092 0.239
NP_441916.1_10 Reverse -120 -139 5.30933 0.213
NP_441041.1_4 Forward -142 -123 -6.88371 0.176
NP_441725.1_5 Forward -155 -145 5.87989 0.115
NP_441725.1_5 Reverse -337 -347 -1.00328 0.279
NP_439966.1_7 Forward -241 -231 4.60114 0.265
NP_439966.1_7 Reverse -317 -327 4.10949 0.289
NP_440202.1_8 Reverse -290 -309 9.32 0.297
NP_442281.1_1 Forward -91 -77 3.44058 0.231
NP_442281.1_1 Forward -350 -336 2.16228 0.276
NP_441079.1_7 Reverse -196 -215 -2.06626 0.216
NP_442256.1_2 Reverse -20 -38 -9.12563 0.249
NP_441556.1_7 Reverse -287 -306 0.588665 0.295
NP_443049.1_6 Forward -329 -319 11.6409 0.24
NP_442215.1_2 Forward -138 -122 -6.7263 0.278
NP_442933.1_10 Forward -86 -77 4.22796 0.267
NP_442926.1_3 Reverse -351 -370 2.94938 0.294
NP_442554.1_8 Forward -306 -296 5.97822 0.13
NP_442554.1_8 Forward -327 -317 2.92996 0.249
NP_442554.1_8 Reverse -299 -309 2.24165 0.276
NP_442142.1_4 Reverse -130 -143 7.88518 0.127
NP_443009.1_5 Forward -157 -146 5.07306 0.218
NP_443009.1_5 Reverse -76 -87 3.69644 0.282
NP_441371.1_3 Forward -174 -156 4.6407 0.295
NP_440881.1_5 Forward -58 -39 15.0441 0.299
NP_440881.1_10 Forward -85 -72 10.7374 0.274
NP_440464.1_10 Reverse -117 -127 12.2442 0.242
NP_441758.1_4 Forward -339 -320 10.1275 0.254
NP_441015.1_10 Forward -141 -122 -9.34199 0.282
NP_441426.1_6 Forward -392 -373 15.5357 0.154
NP_441330.1_1 Reverse -122 -141 -15.7335 0.294
NP_442811.1_2 Forward -385 -366 -0.590531 0.252
NP_441764.1_4 Forward -82 -65 18.0029 0.0604
NP_441612.1_2 Reverse -180 -190 10.6792 0.21
NP_441612.1_2 Forward -256 -246 7.19391 0.26
NP_442227.1_2 Reverse -92 -111 1.67108 0.243
NP_442808.1_1 Forward -11 -1 5.87944 0.137
NP_442808.1_1 Reverse -132 -142 3.91283 0.218
NP_441906.1_2 Reverse -323 -342 2.85027 0.286
NP_440558.1_2 Forward -374 -355 -4.03212 0.241
NP_440558.1_2 Reverse -171 -190 -7.4737 0.294
NP_442789.1_4 Reverse -18 -37 -6.1954 0.285
NP_441518.1_3 Reverse -304 -323 -15.2418 0.288
NP_441878.1_6 Forward -308 -298 0.766681 0.134
NP_441036.1_3 Forward -125 -106 -0.39387 0.181
NP_441590.1_4 Forward -25 -6 8.75009 0.249
NP_440101.1_3 Forward -339 -320 2.55606 0.253
NP_440101.1_10 Forward -142 -123 8.84924 0.171
NP_440086.1_4 Forward -289 -275 19.395 0.163
NP_442347.1_2 Forward -238 -229 6.39124 0.17
NP_442347.1_2 Reverse -315 -324 6.29291 0.175
NP_442347.1_2 Reverse -320 -329 3.7363 0.284
NP_442645.1_2 Reverse -125 -144 -17.0118 0.246
NP_442594.1_8 Forward -337 -318 5.70265 0.241
NP_442590.1_10 Forward -239 -220 4.52268 0.274
NP_441728.2_4 Forward -83 -64 12.4613 0.273
NP_441799.1_1 Forward -311 -297 5.40719 0.21
NP_441799.1_1 Forward -90 -76 3.63724 0.289
NP_440640.1_6 Forward -111 -92 6.58763 0.18
NP_440256.1_1 Forward -152 -133 -8.752 0.266
NP_442283.1_6 Forward -37 -18 23.9922 0.0128
NP_441559.1_8 Forward -160 -146 3.34284 0.143
NP_441559.1_8 Reverse -294 -308 -5.9986 0.271
NP_441559.1_8 Reverse -122 -136 -7.17857 0.287
NP_441464.1_10 Forward -336 -322 8.45605 0.281
NP_441464.1_10 Forward -330 -316 8.35772 0.284
NP_440702.1_5 Reverse -226 -245 17.7974 0.0964
NP_441113.1_3 Reverse -178 -192 14.2569 0.289
NP_439985.1_7 Reverse -16 -35 5.211 0.224
NP_442993.1_1 Forward -195 -179 -11.6429 0.255
NP_440570.1_5 Forward -152 -133 -2.55715 0.28
NP_441750.1_7 Forward -335 -325 17.7779 0.254
NP_441340.1_9 Reverse -156 -166 8.15881 0.256
NP_440327.1_6 Forward -154 -135 9.0459 0.212
NP_441134.1_5 Forward -188 -171 10.4619 0.149
NP_440586.1_4 Forward -387 -369 15.1621 0.25
NP_442251.1_6 Reverse -78 -85 8.69224 0.199
NP_440192.1_5 Forward -143 -124 3.04771 0.293
NP_439937.1_4 Forward -189 -170 10.9142 0.274
NP_439943.1_4 Reverse -2 -21 4.71934 0.287
NP_441789.1_7 Reverse -327 -346 -4.1312 0.28
NP_440139.1_1 Reverse -330 -349 5.40686 0.159
NP_440210.1_9 Reverse -64 -83 8.73051 0.245
NP_441572.1_7 Reverse -121 -140 -5.9004 0.276
NP_442384.1_10 Reverse -127 -140 4.44418 0.157
NP_442384.1_10 Forward -239 -226 2.08423 0.237
NP_441980.1_4 Forward -333 -314 4.71934 0.206
NP_441877.1_9 Reverse -62 -79 4.75873 0.284
NP_441018.1_7 Forward -146 -127 8.06259 0.256
NP_442790.1_4 Reverse -224 -243 -11.0136 0.22
NP_440344.1_10 Reverse -86 -103 -12.0559 0.239
NP_440282.1_10 Reverse -176 -195 -0.295539 0.21
NP_440531.1_6 Reverse -290 -309 1.27776 0.178
NP_440297.1_9 Forward -155 -145 7.35486 0.126
NP_440297.1_9 Reverse -337 -347 -0.118297 0.282
NP_440297.1_9 Reverse -299 -309 -0.216628 0.282
NP_440937.1_5 Forward -377 -358 10.0292 0.275
NP_443036.1_9 Forward -242 -223 14.6508 0.213
NP_440999.1_9 Reverse -123 -137 0.687908 0.177
NP_440999.1_9 Reverse -294 -308 -2.65535 0.273
NP_440600.1_1 Reverse -64 -83 13.2252 0.286
NP_440179.1_6 Reverse -299 -318 5.99764 0.22
NP_440491.1_1 Reverse -19 -38 11.0102 0.178
NP_442033.1_10 Forward -98 -79 -11.2103 0.251
NP_441949.1_1 Forward -349 -330 20.944 0.0155
NP_441949.1_4 Forward -378 -359 23.5006 0.0201
NP_441949.1_5 Forward -82 -63 23.9841 0.00335
NP_440575.1_4 Forward -400 -381 13.3078 0.263
NP_442845.1_2 Forward -334 -320 15.3392 0.0729
NP_442845.1_2 Reverse -224 -238 7.47274 0.195
NP_442845.1_2 Forward -239 -225 5.50613 0.231
NP_441469.1_8 Reverse -146 -155 9.83282 0.227
NP_441469.1_8 Forward -308 -299 9.04618 0.227
NP_441469.1_8 Reverse -297 -306 5.21127 0.283
NP_442315.1_2 Forward -333 -321 18.2302 0.149
NP_442286.1_8 Forward -139 -121 16.2485 0.294
NP_441929.1_3 Reverse -158 -177 6.39097 0.266
NP_443062.1_1 Forward -345 -327 7.47334 0.175
NP_443062.1_6 Forward -353 -334 6.29264 0.183
NP_443062.1_6 Reverse -69 -88 3.34271 0.239
NP_443062.1_6 Forward -107 -88 2.3594 0.256
NP_442780.1_1 Forward -78 -59 10.0292 0.195
NP_440516.1_8 Reverse -224 -233 7.17789 0.0754
NP_440516.1_8 Reverse -1 -10 -0.295266 0.232
NP_440673.1_3 Reverse -79 -86 11.3472 0.085
NP_440673.1_3 Forward -36 -29 7.80726 0.244
NP_442219.1_9 Forward -238 -229 2.35967 0.28
NP_440436.1_4 Reverse -78 -87 8.16077 0.111
NP_442907.1_9 Reverse -29 -48 0.491109 0.207
NP_441733.1_5 Reverse -320 -339 15.3391 0.294
NP_441004.1_1 Reverse -3 -22 -7.86702 0.2
NP_441004.1_4 Reverse -6 -16 10.3048 0.254
NP_442873.1_3 Forward -39 -20 10.52 0.169
NP_440296.1_10 Forward -310 -291 -14.6519 0.27
NP_440328.1_4 Forward -37 -18 7.27595 0.124
NP_443054.1_2 Forward -251 -237 -0.590395 0.299
NP_440508.1_2 Forward -167 -148 22.0833 0.0948
NP_441851.1_10 Reverse -146 -156 4.0116 0.291
NP_442011.1_1 Reverse -76 -95 0.884433 0.268
NP_441683.1_1 Reverse -317 -336 12.1138 0.3
NP_440463.1_8 Forward -103 -84 8.85527 0.252
NP_442843.1_1 Reverse -30 -49 -9.93197 0.272
NP_440431.1_3 Reverse -185 -204 -8.16202 0.226
NP_441031.1_1 Forward -75 -56 8.17242 0.25
NP_441570.1_1 Reverse -224 -242 -14.6322 0.226
NP_441570.1_1 Forward -142 -124 -16.7954 0.254
NP_441570.1_1 Forward -239 -221 -17.7788 0.291
NP_442729.1_5 Forward -143 -133 8.63316 0.248
NP_442388.1_3 Reverse -286 -305 11.4058 0.209
NP_441663.1_8 Forward -92 -73 2.0644 0.206
NP_442348.1_2 Forward -293 -284 7.37455 0.28
NP_441094.1_6 Reverse -34 -51 8.69123 0.261
NP_441432.1_8 Forward -371 -362 9.24284 0.0755
NP_441732.1_2 Reverse -176 -192 -17.7394 0.292
NP_440497.1_2 Forward -110 -91 8.84924 0.208
NP_442003.1_4 Forward -344 -325 19.5673 0.0905
NP_441057.1_4 Forward -106 -88 -1.25915 0.272
NP_442353.1_4 Reverse -320 -339 5.89851 0.183
NP_441830.1_2 Forward -306 -287 -5.99873 0.296
NP_440559.1_1 Forward -85 -76 4.81794 0.193
NP_440559.1_1 Reverse -78 -87 4.32629 0.288
NP_441022.1_1 Reverse -196 -205 11.0666 0.284
NP_442346.1_5 Forward -87 -77 11.1898 0.0735
NP_442346.1_5 Forward -308 -298 5.09324 0.262
NP_440831.1_5 Reverse -34 -53 18.2961 0.223
NP_441923.1_8 Forward -191 -177 11.701 0.286
NP_442603.1_7 Reverse -224 -238 7.47213 0.205
NP_442603.1_7 Forward -239 -225 6.78381 0.23
NP_441888.1_7 Reverse -293 -307 6.3911 0.225
NP_441948.1_1 Reverse -219 -238 15.8307 0.231
NP_441948.1_3 Reverse -63 -82 25.122 0.00338
NP_440875.1_9 Forward -343 -333 8.76138 0.233
NP_441813.1_7 Reverse -93 -107 13.9619 0.197
NP_441813.1_9 Forward -290 -271 14.3558 0.222
NP_442254.1_1 Forward -319 -300 0.786102 0.249
NP_440590.1_4 Reverse -23 -36 0.117615 0.169
NP_441239.1_9 Reverse -296 -308 8.00379 0.145
NP_441239.1_9 Forward -309 -297 5.15219 0.227
NP_441239.1_9 Reverse -317 -329 4.36554 0.253
NP_440156.1_4 Forward -168 -158 11.6809 0.176
NP_442044.1_1 Forward -328 -309 -10.227 0.271
NP_442270.1_9 Forward -147 -128 -5.40875 0.206
NP_440573.1_3 Reverse -273 -286 19.6376 0.0595
NP_441874.1_1 Forward -146 -132 15.4376 0.165
NP_441541.1_1 Forward -81 -63 2.58027 0.195
NP_442052.1_6 Reverse -26 -44 19.6845 0.0923
NP_440675.1_1 Forward -380 -361 11.7008 0.177
NP_440462.1_4 Forward -335 -321 5.50613 0.29
NP_440462.1_6 Reverse -222 -232 4.50326 0.197
NP_441474.1_1 Reverse -95 -114 -1.96793 0.267
NP_442402.1_10 Forward -165 -155 11.091 0.269
NP_441848.1_4 Forward -177 -161 8.69657 0.288
NP_441084.1_6 Reverse -184 -198 9.73195 0.269
NP_440696.1_3 Forward -345 -327 -2.0458 0.272
NP_440696.1_6 Forward -340 -321 8.65258 0.231
NP_441811.1_8 Forward -142 -128 8.55439 0.235
NP_442837.1_3 Reverse -315 -322 6.52896 0.2
NP_440505.1_3 Forward -52 -42 10.0098 0.12
NP_440505.1_3 Reverse -222 -232 4.99491 0.252
NP_441408.2_7 Reverse -125 -144 0.884433 0.215
NP_441408.2_7 Reverse -172 -191 -4.42544 0.281
NP_440914.1_1 Forward -233 -223 7.05364 0.254
NP_440914.1_4 Reverse -36 -52 10.0876 0.274
NP_442533.1_1 Forward -111 -92 -15.2418 0.253
NP_442533.1_1 Forward -64 -45 -17.2085 0.281
NP_442533.1_6 Reverse -319 -328 4.0313 0.194
NP_442533.1_6 Forward -345 -336 1.37636 0.3
NP_442541.1_10 Reverse -110 -124 2.75226 0.254
NP_439944.1_9 Forward -188 -178 5.87989 0.214
NP_441697.1_5 Reverse -196 -215 -8.06949 0.254
NP_440115.1_6 Forward -89 -79 12.9597 0.0846
NP_440007.1_9 Reverse -220 -234 2.16287 0.281
NP_441961.1_4 Forward -373 -354 4.916 0.275
NP_440608.1_6 Reverse -320 -339 3.04693 0.292
NP_441972.1_5 Reverse -23 -42 -7.27704 0.247
NP_441972.1_5 Forward -28 -9 -10.0303 0.296
NP_441106.1_3 Forward -83 -64 21.1406 0.0238
NP_441420.1_1 Forward -51 -32 -4.72043 0.292
NP_439903.1_6 Reverse -124 -143 -1.18128 0.293
NP_440797.1_8 Forward -386 -367 15.2531 0.268
NP_441286.1_1 Forward -143 -131 -1.43599 0.145
NP_440886.1_7 Reverse -92 -102 9.91099 0.0805
NP_442614.1_2 Reverse -224 -238 12.586 0.155
NP_439899.1_1 Reverse -61 -79 5.16069 0.243
NP_441463.1_3 Reverse -98 -117 -7.86702 0.262
NP_441463.1_3 Reverse -83 -102 -8.26035 0.267
NP_442365.1_7 Reverse -83 -102 -1.86883 0.196
NP_441431.1_2 Reverse -295 -309 5.70218 0.291
NP_441993.1_1 Forward -142 -123 10.6204 0.124
NP_440114.1_10 Forward -298 -284 9.34103 0.177
NP_440114.1_10 Forward -328 -314 8.35772 0.207
NP_440114.1_10 Forward -156 -142 6.98109 0.25
NP_442437.1_8 Forward -42 -23 3.14605 0.291
NP_442323.1_7 Reverse -141 -160 2.45694 0.265
NP_441510.2_7 Forward -239 -225 11.1104 0.28
NP_440293.1_10 Forward -59 -40 -2.45882 0.273
NP_440422.1_10 Reverse -199 -218 9.14571 0.212
NP_442743.1_1 Reverse -316 -335 4.91521 0.288
NP_442930.1_1 Forward -168 -158 11.4843 0.258
NP_440213.1_5 Forward -195 -176 7.96426 0.281
NP_441332.1_6 Forward -11 -1 12.6149 0.221
NP_441436.1_8 Reverse -7 -26 7.47261 0.293
NP_440473.1_9 Forward -309 -290 -8.94866 0.26
NP_442936.1_10 Reverse -158 -172 8.88105 0.269
NP_440756.1_3 Forward -327 -309 16.1454 0.163
NP_440554.1_4 Forward -306 -296 1.84832 0.287
NP_442341.1_9 Reverse -222 -236 14.3553 0.0695
NP_442341.1_9 Reverse -334 -348 5.21053 0.277
NP_441173.1_3 Forward -384 -365 15.4374 0.248
NP_443000.1_7 Reverse -125 -135 4.20827 0.209
NP_440552.1_8 Forward -267 -250 14.0895 0.175
NP_440679.1_10 Forward -106 -87 -12.7836 0.213
NP_440258.1_3 Reverse -270 -289 -3.63879 0.225
NP_439962.1_4 Reverse -86 -105 -8.94866 0.298
NP_441875.1_3 Reverse -173 -192 15.4366 0.297
NP_441105.1_3 Forward -147 -128 -8.65367 0.275
NP_440216.1_1 Forward -345 -331 -5.70361 0.135
NP_440216.1_1 Forward -250 -236 -12.4884 0.274
NP_440216.1_9 Reverse -153 -162 6.48957 0.289
NP_440172.1_1 Forward -136 -126 4.10993 0.205
NP_442371.1_1 Reverse -155 -165 13.2542 0.206
NP_442371.1_1 Forward -174 -164 12.3692 0.254
NP_441226.1_7 Reverse -320 -327 8.29857 0.205
NP_441226.1_7 Forward -9 -2 8.29857 0.205
NP_441226.1_7 Forward -232 -225 6.82361 0.246
NP_442154.1_1 Forward -110 -92 -7.55234 0.143
NP_442154.1_1 Reverse -1 -19 -7.65067 0.146
NP_440261.1_5 Reverse -78 -91 -3.02898 0.108
NP_440261.1_5 Reverse -148 -161 -6.86388 0.201
NP_440988.1_10 Forward -98 -84 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTAATGCGGGCCACTTGGATTTGATTGGTGGCATTGACGTAGCAACAGAATAAGGCTGATGGCTGGTTGTTGGGGATGGGATCAAGAATTTGGGACATGGCAGGCATGGGATTTTTATTAAAAAAAGGTCTTTTAACTATTCTGGACAAAGCTAACACCCGCTGATCCCGATCCGCTGTAAAGATAATTACAATCAAATTTTTTGACTCTGGCTTTGTCCCTGGACTCAAGAAAATTTTTCCGAGGCATTGCACTTTGGCGTTGGTGATTACTTGGGGCTAGAACGGTCAGAATGCTGAGGGTGGCGGCTCCGAGCAATCGTTAAGATATATTACAATTGTGAGTAAGTGGGGGTAGTCCCTCCCGTTGCTGATCTCACCCTACCAGTGCCCCAACGCC

CDS

ATGATCGATCGCCTTTTGTACGTTCGTCTTCCCTGTAACCCGATTTTCCCCATTGGGGTGATTTATCTGGCGGACCATGTCCATAAATGTTTTCCGGCGACCGCCCAGCGGATTTTCGATTTAGGCACCATTCCTCCCCTGGATTTCAACCGGGCCCTTGATGAATGTATTGATGAATTTCAGCCGACAATTTTGGTTTTTTCCTGGCGGGACATTCAAATCTATGCTCCGGTGGGGGGTAGGGGTGGTAATCCCCTGCAGAACGCGTTTGAGTTTTACTACGGAAAAAATCCCTTGGTGAAGCTGAGGGGAGCCTTAGGTGGTTTGAAAGTTACCAGTGCCTATTACGGCGAATTATGGCGTAATTTAAGACTAATAAACCGGGGATTGCGGAGGGCAAAGCGTTATTGCAGTGATCCCCAAATCATTGTCGGGGGCGGAGCAGTTAGTGTTTTTTACGAACAGTTAAAAACCAAGTTGCCAGCGGGCACCATTGTGTCTGTGGGAGAAGGGGAAACCCTGTTAGAAAAATATCTACGGGGGCAAACCATTGAAGACGAACGGTGTTACATAGTCGGCCGCAGTCAGCCCCGGCCCCGGTTAATCCATGAACAGCCCTCCCCCATGGTAAAAACTGCCTGTGATTATGACTACATCGAGCAAATTTGGCCGGCCTTTGACTATTACCTCCAGGAGGATGATTTTTACCTAGGGGTACAAACTAAGCGGGGTTGTCCCCACAATTGCTGTTACTGCGTTTACACCGTGGTGGAAGGGAAACAGGTCAGAATTAATCCCGCCGCCGAAGTGGTCAAGGAAATGCGGCAACTTTATGACCGGGGCATTCGCAATTTTTGGTTCACCGATGCTCAATTTATTCCGGCTAGGGTTTTTATAGATGATGTGGTGGAATTGCTGGAGGCGATCGCCGCGTCGGGCATGGAGGATATCCATTGGGCTGCCTATATCCGAGCTGACAATTTAACCCCTCGGTTGTGTGAACTGATGGTACAAACGGGGATGAACTACTTTGAAATTGGTATCACCAGTGGTTCCCAGGAATTGGTACGCAAAATGCGCATGGGTTACAATCTCCGCACCGTGTTACAGAATTGTCGGGATCTAAAGGGGGCAGGCTTTAATGATTTGGTTTCCGTCAATTATTCCTTCAATGTTATTGATGAAACCCTAGACACCATCCGCCAAACCATTGCCTACCATCGGGAGTTAGAAGCTATTTTTGGGGCAGACAAAGTAGAACCAGCCATTTTCTTCATTGGGCTACAGCCCCACACCCATCTGGAAACCTATGCCCTGGACAAGGAAATTCTCAAACCAGGCTATGACCCCATGAGCATGATGCCCTGGACCGCCAAAAAATTACTCTGGAATCCAGAACCCCTCGGCTCGTTTTTCGGCGAAGTTTGCCTCCAGGCTTGGCAACAAAATCCCAATGATTTCGGTCGAGAAGTGATGAATATTCTCGAGCAACGGCTGGGCAAAGCTGATCTCGAAACAGCCCTCCACTCCCCCCTGCCCGACAAAAAAAAATTTCCCCCTACCATGGCAGAGGGAAAAAAACTCAGTCCTATTTAG

Protein

MIDRLLYVRLPCNPIFPIGVIYLADHVHKCFPATAQRIFDLGTIPPLDFNRALDECIDEFQPTILVFSWRDIQIYAPVGGRGGNPLQNAFEFYYGKNPLVKLRGALGGLKVTSAYYGELWRNLRLINRGLRRAKRYCSDPQIIVGGGAVSVFYEQLKTKLPAGTIVSVGEGETLLEKYLRGQTIEDERCYIVGRSQPRPRLIHEQPSPMVKTACDYDYIEQIWPAFDYYLQEDDFYLGVQTKRGCPHNCCYCVYTVVEGKQVRINPAAEVVKEMRQLYDRGIRNFWFTDAQFIPARVFIDDVVELLEAIAASGMEDIHWAAYIRADNLTPRLCELMVQTGMNYFEIGITSGSQELVRKMRMGYNLRTVLQNCRDLKGAGFNDLVSVNYSFNVIDETLDTIRQTIAYHRELEAIFGADKVEPAIFFIGLQPHTHLETYALDKEILKPGYDPMSMMPWTAKKLLWNPEPLGSFFGEVCLQAWQQNPNDFGREVMNILEQRLGKADLETALHSPLPDKKKFPPTMAEGKKLSPI