Your browser is old and dusty. Try Google Chrome!

Details for slr0313

ORF slr0313
Accession NP_442612.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -270 -284 8.16106 0.0927
NP_440557.1_1 Forward -95 -76 6.98095 0.148
NP_440795.1_7 Forward -277 -270 14.6904 0.0123
NP_440795.1_7 Reverse -270 -277 14.6904 0.0123
NP_440795.1_7 Reverse -343 -350 13.6088 0.0364
NP_441418.1_6 Forward -278 -259 -21.3384 0.147
NP_441453.1_4 Forward -278 -270 16.539 0.00633
NP_441453.1_4 Reverse -269 -277 7.8859 0.0536
NP_441453.1_4 Reverse -342 -350 7.19758 0.0757
NP_441453.1_4 Forward -96 -88 7.09925 0.0962
NP_441453.1_4 Reverse -87 -95 7.00092 0.107
NP_442151.1_6 Forward -278 -264 10.6193 0.119
NP_441818.1_1 Forward -277 -266 14.2178 0.0541
NP_441818.1_1 Reverse -343 -354 12.6445 0.114
NP_440226.1_1 Forward -278 -259 6.98095 0.115
NP_440226.1_1 Reverse -87 -106 6.88262 0.118
NP_440226.1_1 Reverse -204 -223 5.60432 0.151
NP_440226.1_1 Forward -351 -332 3.83436 0.212
NP_440150.1_6 Reverse -266 -285 3.93269 0.245
NP_442173.1_1 Reverse -270 -278 15.4574 0.00633
NP_442173.1_1 Forward -277 -269 14.1791 0.0165
NP_442173.1_1 Forward -95 -87 12.9008 0.0296
NP_442173.1_1 Reverse -343 -351 11.0325 0.0523
NP_442173.1_1 Forward -350 -342 7.78757 0.136
NP_442173.1_1 Reverse -88 -96 5.72262 0.203
NP_442752.1_4 Forward -278 -271 13.8055 0.0199
NP_443027.1_4 Reverse -340 -350 8.23984 0.215
NP_443027.1_4 Reverse -267 -277 7.45319 0.24
NP_443027.1_4 Reverse -154 -164 6.66654 0.274
NP_443027.1_4 Forward -98 -88 6.46988 0.275
NP_443027.1_4 Forward -280 -270 5.87989 0.294
NP_441812.1_3 Forward -352 -338 7.37441 0.277
NP_442975.1_10 Reverse -338 -352 5.40719 0.224
NP_442975.1_10 Forward -100 -86 2.26061 0.28
NP_442975.1_10 Reverse -83 -97 1.76896 0.291
NP_440784.1_7 Forward -277 -270 15.9687 0.0123
NP_440784.1_7 Reverse -270 -277 15.9687 0.0123
NP_440784.1_7 Forward -350 -343 6.62729 0.168
NP_440784.1_7 Reverse -343 -350 6.52896 0.176
NP_440784.1_7 Reverse -88 -95 6.3323 0.228
NP_440784.1_7 Forward -95 -88 6.13563 0.241
NP_442909.1_7 Reverse -270 -284 8.16044 0.186
NP_440061.1_9 Forward -280 -266 12.192 0.0999
NP_441054.1_4 Forward -106 -88 12.9988 0.0619
NP_441054.1_4 Reverse -259 -277 0.117479 0.176
NP_442062.1_8 Forward -278 -268 16.9913 0.00317
NP_442062.1_8 Reverse -269 -279 9.91146 0.0554
NP_442062.1_8 Forward -96 -86 8.63316 0.0733
NP_442062.1_8 Reverse -342 -352 4.89658 0.193
NP_440761.1_4 Reverse -82 -101 -12.8819 0.257
NP_441859.1_3 Forward -279 -260 12.3883 0.101
NP_442972.1_1 Forward -206 -188 6.8091 0.291
NP_441802.1_1 Forward -380 -361 6.88262 0.257
NP_440304.1_4 Forward -98 -88 18.0729 0.00654
NP_440304.1_4 Reverse -85 -95 8.63316 0.0721
NP_440304.1_4 Reverse -267 -277 8.1415 0.0859
NP_440304.1_4 Forward -280 -270 1.84832 0.299
NP_442242.1_4 Forward -277 -270 14.3954 0.0124
NP_442242.1_4 Reverse -270 -277 14.3954 0.0124
NP_442242.1_4 Forward -95 -88 11.8388 0.0776
NP_442762.1_10 Reverse -364 -383 -12.1936 0.284
NP_441161.1_3 Forward -284 -266 16.6371 0.0605
NP_441619.1_8 Reverse -81 -95 11.5037 0.178
NP_440370.1_10 Reverse -260 -279 7.17762 0.265
NP_441083.1_5 Forward -278 -268 9.61647 0.0243
NP_441083.1_5 Reverse -269 -279 2.04498 0.195
NP_441083.1_5 Reverse -87 -97 1.55333 0.204
NP_441083.1_5 Forward -96 -86 1.455 0.205
NP_442827.1_8 Reverse -261 -280 -0.591301 0.231
NP_441738.1_2 Reverse -271 -278 15.28 0.0102
NP_441738.1_2 Reverse -89 -96 13.8051 0.0221
NP_441738.1_2 Forward -276 -269 11.5435 0.084
NP_441558.1_5 Reverse -267 -286 3.83436 0.296
NP_440209.1_1 Forward -278 -270 18.1123 0.00295
NP_440209.1_1 Reverse -269 -277 8.47588 0.0457
NP_440209.1_1 Reverse -87 -95 8.37755 0.0576
NP_440209.1_1 Forward -96 -88 8.27922 0.0687
NP_441713.1_1 Reverse -263 -282 -12.0953 0.242
NP_441713.1_1 Forward -102 -83 -14.9469 0.26
NP_440178.1_7 Reverse -86 -105 -21.7317 0.237
NP_442461.1_2 Forward -303 -284 14.1591 0.218
NP_441327.1_1 Forward -143 -124 2.57952 0.289
NP_442111.1_4 Reverse -268 -282 5.30946 0.169
NP_442111.1_4 Forward -252 -238 4.42448 0.207
NP_441163.1_1 Forward -286 -269 7.3146 0.245
NP_441831.1_7 Forward -256 -237 17.994 0.203
NP_440906.1_5 Forward -277 -270 15.8704 0.0124
NP_440906.1_5 Reverse -270 -277 15.8704 0.0124
NP_440906.1_5 Reverse -343 -350 6.43063 0.223
NP_440906.1_5 Forward -350 -343 6.3323 0.234
NP_440906.1_5 Forward -95 -88 6.13563 0.241
NP_440906.1_5 Reverse -88 -95 6.13563 0.241
NP_440747.1_10 Reverse -84 -96 -4.18925 0.0817
NP_440747.1_10 Forward -281 -269 -4.28759 0.0903
NP_440747.1_10 Reverse -266 -278 -11.7607 0.142
NP_440747.1_10 Forward -99 -87 -11.7607 0.142
NP_441130.1_10 Forward -280 -266 13.6676 0.0612
NP_442973.1_5 Reverse -78 -97 20.1573 0.039
NP_441486.1_1 Forward -281 -267 5.80112 0.0344
NP_441486.1_1 Reverse -266 -280 2.65453 0.079
NP_441486.1_1 Forward -99 -85 -3.73699 0.181
NP_441486.1_1 Reverse -84 -98 -5.50694 0.242
NP_442634.1_2 Reverse -263 -282 -0.197208 0.293
NP_442634.1_4 Reverse -85 -99 -2.65535 0.155
NP_441265.1_3 Reverse -263 -277 8.84938 0.155
NP_442848.1_1 Reverse -342 -356 0.392915 0.263
NP_443018.1_3 Forward -277 -270 14.8871 0.0123
NP_443018.1_3 Reverse -270 -277 14.8871 0.0123
NP_443018.1_3 Forward -95 -88 12.0355 0.0639
NP_443018.1_3 Reverse -300 -307 6.62729 0.168
NP_443018.1_3 Reverse -88 -95 5.64398 0.181
NP_443018.1_3 Reverse -343 -350 5.44732 0.193
NP_443018.1_3 Forward -350 -343 5.34899 0.212
NP_443018.1_3 Forward -164 -157 4.26735 0.267
NP_443018.1_3 Reverse -157 -164 4.07068 0.299
NP_441316.1_7 Forward -98 -83 2.14318 0.156
NP_441316.1_7 Forward -280 -265 -2.28172 0.248
NP_441634.1_8 Forward -280 -266 -3.44199 0.295
NP_440376.1_1 Forward -96 -87 16.0277 0.00493
NP_440376.1_1 Forward -278 -269 9.73449 0.0365
NP_440376.1_1 Reverse -87 -96 9.73449 0.0365
NP_440376.1_1 Reverse -269 -278 9.63616 0.0385
NP_441588.1_4 Reverse -271 -281 7.25653 0.178
NP_441588.1_4 Forward -94 -84 6.96153 0.178
NP_442687.1_7 Reverse -86 -96 9.12481 0.0994
NP_442687.1_7 Reverse -268 -278 8.92815 0.0994
NP_442687.1_7 Forward -279 -269 6.76487 0.154
NP_442958.1_3 Forward -289 -270 8.25926 0.152
NP_440042.1_2 Reverse -259 -278 2.85105 0.195
NP_440042.1_2 Forward -367 -348 -2.16383 0.258
NP_440533.1_9 Reverse -87 -106 3.44104 0.25
NP_440360.1_9 Forward -85 -66 6.78429 0.259
NP_440360.1_10 Forward -276 -262 5.60446 0.227
NP_442658.1_1 Forward -280 -270 15.9091 0.00966
NP_442658.1_1 Reverse -267 -277 15.8108 0.0101
NP_442658.1_1 Reverse -85 -95 11.4843 0.082
NP_442658.1_1 Forward -167 -157 9.81266 0.145
NP_442205.1_9 Forward -102 -86 -2.79306 0.272
NP_441414.1_9 Forward -278 -259 -5.80207 0.18
NP_441958.1_5 Reverse -86 -96 11.4848 0.00522
NP_441958.1_5 Forward -97 -87 11.3864 0.0074
NP_441958.1_5 Reverse -268 -278 10.6981 0.0112
NP_441958.1_5 Forward -279 -269 3.12662 0.0364
NP_440318.1_1 Forward -258 -239 0.392778 0.296
NP_442836.1_5 Reverse -263 -282 4.12936 0.217
NP_440203.1_5 Reverse -90 -100 10.796 0.213
NP_440203.1_5 Reverse -302 -312 10.5993 0.218
NP_439905.1_1 Forward -277 -264 14.2773 0.131
NP_442911.1_2 Reverse -259 -278 14.8474 0.0112
NP_442911.1_2 Forward -106 -87 -8.35868 0.233
NP_441580.1_6 Reverse -331 -350 -4.72043 0.235
NP_440153.1_5 Reverse -270 -284 2.35953 0.225
NP_443055.1_6 Forward -278 -260 2.87 0.203
NP_442236.1_3 Reverse -263 -282 17.404 0.122
NP_440993.1_6 Forward -277 -260 13.7068 0.0546
NP_440388.1_4 Reverse -238 -257 17.5024 0.235
NP_440138.1_6 Forward -364 -345 5.2102 0.23
NP_442002.1_9 Forward -279 -272 10.7572 0.185
NP_440809.1_9 Forward -105 -87 -8.14232 0.227
NP_441938.1_1 Forward -280 -261 1.37609 0.272
NP_441646.1_1 Forward -285 -266 -1.37718 0.284
NP_441646.1_7 Forward -159 -145 13.6676 0.28
NP_441000.1_6 Reverse -268 -282 5.89945 0.0933
NP_440484.1_3 Reverse -340 -354 10.6193 0.242
NP_440484.1_3 Reverse -154 -168 9.04604 0.275
NP_441674.1_10 Forward -386 -368 1.88744 0.259
NP_440147.1_4 Forward -280 -267 12.999 0.0326
NP_440147.1_4 Reverse -85 -98 9.75405 0.0371
NP_441125.1_6 Reverse -212 -225 13.589 0.244
NP_441550.1_8 Reverse -267 -277 16.5975 0.0116
NP_441550.1_8 Forward -280 -270 8.3377 0.124
NP_441550.1_8 Reverse -85 -95 5.78111 0.23
NP_441916.1_7 Reverse -269 -279 10.2065 0.0266
NP_441916.1_7 Forward -96 -86 9.51814 0.0338
NP_441916.1_7 Reverse -87 -97 9.22315 0.0383
NP_441916.1_7 Forward -278 -268 7.55152 0.0639
NP_441916.1_7 Forward -351 -341 7.15819 0.0745
NP_440465.1_10 Reverse -266 -285 9.24257 0.173
NP_441041.1_7 Reverse -84 -96 13.8313 0.0457
NP_441041.1_7 Reverse -266 -278 10.7216 0.0888
NP_441725.1_4 Forward -58 -44 5.01387 0.278
NP_441725.1_5 Forward -277 -267 17.4829 0.0219
NP_441725.1_5 Reverse -270 -280 2.04498 0.115
NP_441725.1_5 Reverse -88 -98 1.65166 0.13
NP_441725.1_5 Reverse -343 -353 0.57002 0.162
NP_441725.1_5 Forward -95 -85 0.373358 0.182
NP_439966.1_7 Forward -280 -270 9.91099 0.0968
NP_439966.1_7 Reverse -267 -277 5.58445 0.216
NP_439966.1_7 Forward -98 -88 4.99446 0.248
NP_439966.1_9 Reverse -267 -276 9.24284 0.253
NP_439966.1_9 Forward -263 -254 6.48957 0.253
NP_439966.1_9 Forward -280 -271 0.884706 0.253
NP_442941.1_2 Forward -147 -128 10.8379 0.295
NP_442941.1_3 Reverse -88 -98 10.2065 0.0213
NP_442941.1_3 Forward -350 -340 7.84651 0.0564
NP_442941.1_3 Reverse -270 -280 2.63497 0.14
NP_442941.1_3 Forward -95 -85 1.25834 0.15
NP_442941.1_3 Reverse -343 -353 1.06167 0.153
NP_440289.1_2 Forward -281 -268 -3.22564 0.267
NP_440289.1_2 Reverse -266 -279 -4.20895 0.283
NP_441678.1_4 Reverse -371 -390 14.0608 0.16
NP_442281.1_1 Reverse -82 -96 14.6503 0.0168
NP_442281.1_1 Forward -283 -269 10.0287 0.0639
NP_442172.1_1 Reverse -119 -138 14.8825 0.189
NP_442256.1_2 Reverse -267 -285 -7.15901 0.214
NP_440647.1_9 Reverse -85 -103 2.47742 0.293
NP_442012.1_1 Forward -284 -265 -1.47551 0.289
NP_441556.1_10 Reverse -264 -278 15.2833 0.145
NP_440498.1_1 Forward -105 -87 10.5406 0.0786
NP_440498.1_1 Reverse -260 -278 2.18243 0.194
NP_440498.1_1 Forward -287 -269 -3.12744 0.256
NP_441644.1_6 Forward -96 -86 15.1225 0.00691
NP_441644.1_6 Forward -278 -268 13.2542 0.0212
NP_441644.1_6 Reverse -342 -352 9.91099 0.0661
NP_441644.1_6 Reverse -87 -97 9.71433 0.0705
NP_442247.1_8 Forward -280 -266 10.4227 0.247
NP_440253.1_2 Reverse -348 -366 -3.52077 0.294
NP_440253.1_2 Forward -248 -230 -3.6191 0.297
NP_440929.1_8 Forward -278 -269 17.4043 0.00289
NP_440929.1_8 Reverse -269 -278 17.4043 0.00289
NP_440929.1_8 Reverse -87 -96 9.53783 0.0296
NP_440929.1_8 Forward -96 -87 9.4395 0.0326
NP_442933.1_10 Forward -278 -269 9.04618 0.063
NP_442933.1_10 Reverse -269 -278 8.94785 0.0643
NP_442933.1_10 Reverse -87 -96 7.86621 0.103
NP_442933.1_10 Forward -96 -87 7.86621 0.103
NP_441751.2_8 Reverse -270 -284 -1.5737 0.129
NP_441751.2_8 Reverse -88 -102 -5.70361 0.231
NP_441751.2_8 Forward -95 -81 -5.80194 0.239
NP_442554.1_8 Forward -277 -267 13.648 0.0164
NP_442554.1_8 Reverse -270 -280 13.2547 0.0187
NP_442554.1_8 Reverse -88 -98 7.84651 0.0825
NP_442554.1_8 Forward -95 -85 7.15819 0.0975
NP_442554.1_8 Reverse -306 -316 6.46988 0.117
NP_442554.1_8 Reverse -343 -353 3.12662 0.239
NP_442554.1_8 Forward -164 -154 3.12662 0.239
NP_441762.1_7 Reverse -268 -280 11.2487 0.0142
NP_441762.1_7 Forward -279 -267 4.36554 0.0504
NP_442142.1_4 Forward -99 -86 2.772 0.278
NP_442292.1_1 Reverse -270 -279 9.63616 0.0183
NP_442292.1_1 Forward -277 -268 8.94785 0.0261
NP_442292.1_1 Reverse -343 -352 8.45619 0.0381
NP_442292.1_1 Reverse -88 -97 7.96454 0.0578
NP_442292.1_1 Forward -95 -86 7.66954 0.0634
NP_442476.1_6 Reverse -270 -284 4.71948 0.142
NP_442476.1_6 Forward -277 -263 4.52282 0.143
NP_443009.1_5 Reverse -86 -97 14.8078 0.0189
NP_443009.1_5 Forward -97 -86 11.7595 0.0602
NP_443009.1_5 Reverse -268 -279 10.8746 0.0717
NP_443009.1_5 Forward -279 -268 8.02298 0.118
NP_442408.2_1 Reverse -87 -106 -0.0988766 0.204
NP_441715.1_4 Reverse -270 -280 9.41981 0.097
NP_441715.1_4 Forward -95 -85 4.79825 0.248
NP_441715.1_4 Reverse -88 -98 4.50326 0.27
NP_440357.1_3 Forward -280 -261 9.43923 0.203
NP_440881.1_6 Reverse -175 -194 16.2241 0.227
NP_441198.1_8 Reverse -267 -277 13.7596 0.108
NP_441198.1_8 Reverse -85 -95 13.1737 0.108
NP_441198.1_8 Forward -98 -88 10.1462 0.296
NP_441468.1_1 Forward -277 -270 15.8704 0.0124
NP_441468.1_1 Reverse -270 -277 15.8704 0.0124
NP_441468.1_1 Reverse -343 -350 6.52896 0.135
NP_441468.1_1 Forward -350 -343 6.3323 0.202
NP_441468.1_1 Forward -95 -88 6.3323 0.202
NP_441468.1_1 Reverse -88 -95 6.13563 0.209
NP_441468.1_1 Forward -164 -157 4.07068 0.263
NP_441020.2_6 Forward -98 -81 9.97027 0.156
NP_441673.1_1 Forward -278 -269 11.1111 0.0121
NP_441673.1_1 Reverse -87 -96 11.1111 0.0121
NP_441673.1_1 Reverse -269 -278 11.0128 0.018
NP_441673.1_1 Forward -96 -87 11.0128 0.018
NP_441673.1_1 Reverse -342 -351 -8.06341 0.254
NP_441731.1_3 Forward -286 -267 -4.13045 0.284
NP_441826.1_2 Forward -284 -270 0.392915 0.187
NP_441717.1_4 Forward -140 -121 18.5728 0.25
NP_442868.1_6 Reverse -267 -277 7.84651 0.0669
NP_442868.1_6 Forward -353 -343 1.55333 0.205
NP_442868.1_6 Forward -280 -270 0.865012 0.205
NP_442808.1_1 Forward -279 -269 8.73102 0.0481
NP_441101.1_1 Reverse -267 -285 13.2938 0.231
NP_442775.1_6 Forward -269 -250 12.7825 0.277
NP_442050.1_5 Reverse -267 -277 14.3359 0.0206
NP_442050.1_5 Forward -98 -88 8.23937 0.234
NP_442050.1_5 Reverse -340 -350 7.84605 0.243
NP_442050.1_5 Reverse -85 -95 6.76441 0.282
NP_440558.1_2 Forward -360 -341 -7.57203 0.296
NP_441518.1_3 Forward -361 -342 4.42435 0.05
NP_441878.1_6 Reverse -268 -278 10.4031 0.0176
NP_441878.1_6 Forward -97 -87 2.24165 0.0462
NP_441878.1_6 Reverse -86 -96 1.35667 0.101
NP_441878.1_6 Forward -279 -269 0.668351 0.139
NP_441036.1_8 Forward -279 -269 8.1415 0.176
NP_441036.1_8 Reverse -268 -278 7.45319 0.197
NP_441036.1_8 Reverse -86 -96 5.97822 0.246
NP_441036.1_8 Forward -97 -87 5.87989 0.253
NP_441557.1_5 Reverse -269 -278 17.4043 0.0023
NP_441557.1_5 Forward -278 -269 10.8161 0.00464
NP_441557.1_5 Reverse -87 -96 10.2261 0.0144
NP_441557.1_5 Forward -96 -87 10.1278 0.0188
NP_441557.1_5 Forward -351 -342 6.5879 0.0526
NP_442419.1_2 Reverse -343 -362 -3.73712 0.27
NP_440084.1_8 Reverse -116 -130 8.89237 0.299
NP_442183.1_1 Forward -278 -264 10.226 0.0869
NP_442183.1_1 Forward -96 -82 10.1277 0.0888
NP_442183.1_1 Reverse -342 -356 4.32615 0.266
NP_442397.1_9 Reverse -80 -99 4.22769 0.254
NP_442397.1_9 Reverse -350 -369 1.96607 0.283
NP_440414.1_4 Reverse -276 -295 4.62101 0.28
NP_442347.1_2 Reverse -270 -279 11.1111 0.056
NP_442645.1_2 Forward -374 -355 -19.7651 0.288
NP_441037.1_4 Reverse -267 -277 17.8431 0.0127
NP_441037.1_4 Forward -280 -270 14.7245 0.028
NP_442594.1_7 Forward -289 -270 6.48849 0.207
NP_440151.1_2 Reverse -368 -386 14.6697 0.277
NP_441633.1_3 Forward -280 -267 12.9006 0.0192
NP_441633.1_3 Reverse -267 -280 -4.01229 0.179
NP_441633.1_3 Reverse -85 -98 -7.06055 0.288
NP_440136.1_2 Forward -277 -270 15.9687 0.0123
NP_440136.1_2 Reverse -270 -277 15.9687 0.0123
NP_440136.1_2 Forward -95 -88 13.4121 0.0388
NP_440136.1_2 Reverse -343 -350 6.52896 0.116
NP_440136.1_2 Forward -350 -343 6.43063 0.154
NP_440136.1_2 Reverse -88 -95 6.23397 0.171
NP_442590.1_10 Reverse -363 -382 5.30933 0.264
NP_442998.1_10 Reverse -271 -278 15.5754 0.0102
NP_442998.1_10 Forward -94 -87 12.5271 0.0457
NP_442998.1_10 Reverse -89 -96 6.23397 0.157
NP_442998.1_10 Forward -276 -269 5.84064 0.235
NP_440299.1_1 Forward -355 -342 8.2785 0.0962
NP_440299.1_1 Reverse -265 -278 5.0336 0.191
NP_441799.1_1 Reverse -83 -97 16.7152 0.0134
NP_441799.1_1 Reverse -265 -279 10.8154 0.0668
NP_441799.1_1 Forward -282 -268 9.6354 0.0879
NP_441799.1_1 Forward -100 -86 8.3571 0.117
NP_441007.1_10 Reverse -264 -277 10.8357 0.0646
NP_441007.1_10 Reverse -82 -95 2.08423 0.2
NP_441007.1_10 Forward -283 -270 1.59258 0.203
NP_441007.1_10 Reverse -337 -350 1.19926 0.207
NP_442201.1_10 Forward -289 -270 -14.6519 0.285
NP_440256.1_1 Forward -99 -80 -2.75381 0.122
NP_440256.1_1 Forward -311 -292 -9.63698 0.284
NP_440087.1_1 Forward -287 -268 2.26107 0.167
NP_442007.1_8 Reverse -268 -286 10.0481 0.258
NP_441559.1_8 Forward -101 -87 0.294584 0.169
NP_441704.1_8 Forward -362 -343 8.55343 0.208
NP_440749.1_1 Reverse -299 -318 8.45592 0.155
NP_440243.1_4 Reverse -282 -301 22.1513 0.077
NP_441464.1_8 Forward -278 -264 20.2558 0.0644
NP_442993.1_1 Reverse -87 -103 -2.10475 0.107
NP_442993.1_1 Reverse -269 -285 -9.18458 0.179
NP_440677.1_1 Reverse -260 -279 10.1275 0.179
NP_442386.1_9 Forward -279 -270 15.7322 0.0144
NP_442386.1_9 Reverse -268 -277 5.11253 0.266
NP_441340.1_5 Forward -277 -270 15.6737 0.0124
NP_441340.1_5 Reverse -270 -277 15.6737 0.0124
NP_441340.1_5 Reverse -343 -350 6.23397 0.132
NP_441340.1_5 Reverse -88 -95 6.23397 0.132
NP_441340.1_5 Forward -350 -343 6.13563 0.175
NP_441340.1_5 Forward -95 -88 6.13563 0.175
NP_441340.1_5 Reverse -157 -164 3.97235 0.274
NP_442484.1_2 Reverse -331 -350 1.96607 0.226
NP_441676.1_8 Reverse -122 -138 16.8381 0.235
NP_440161.1_3 Forward -98 -79 13.3725 0.145
NP_442714.1_7 Reverse -88 -107 -0.000545616 0.248
NP_440586.1_8 Forward -277 -270 13.2151 0.026
NP_440586.1_8 Reverse -270 -277 13.2151 0.026
NP_440586.1_8 Reverse -157 -164 9.57686 0.146
NP_442251.1_6 Forward -277 -270 15.2804 0.0124
NP_442251.1_6 Reverse -270 -277 15.2804 0.0124
NP_442251.1_6 Forward -95 -88 11.9372 0.0749
NP_442251.1_6 Reverse -45 -52 7.11894 0.274
NP_440684.1_9 Forward -284 -270 21.4357 0.00483
NP_441262.1_3 Reverse -269 -276 14.8871 0.0223
NP_441262.1_3 Forward -278 -271 14.7888 0.0223
NP_441262.1_3 Forward -96 -89 11.5438 0.0584
NP_441262.1_3 Forward -351 -344 5.34899 0.181
NP_440027.1_8 Reverse -360 -379 3.83357 0.295
NP_443051.1_1 Reverse -268 -277 16.0277 0.00754
NP_443051.1_1 Forward -279 -270 10.4228 0.00754
NP_443051.1_1 Reverse -86 -95 9.83282 0.0203
NP_443051.1_1 Forward -97 -88 9.73449 0.0265
NP_443051.1_1 Reverse -341 -350 0.786375 0.125
NP_443051.1_1 Forward -352 -343 -1.18024 0.297
NP_441232.1_10 Reverse -373 -392 2.45773 0.247
NP_439937.1_9 Forward -279 -262 -6.64833 0.157
NP_440398.1_2 Forward -384 -365 0.982764 0.281
NP_440408.1_7 Forward -378 -359 14.8474 0.165
NP_440439.1_1 Forward -99 -86 8.37742 0.0537
NP_440439.1_1 Forward -281 -268 4.64084 0.0998
NP_440439.1_1 Reverse -266 -279 1.10092 0.162
NP_440372.1_2 Forward -277 -270 16.3621 0.0124
NP_440372.1_2 Reverse -270 -277 16.3621 0.0124
NP_440372.1_2 Reverse -343 -350 6.92228 0.0492
NP_440372.1_2 Forward -350 -343 6.82395 0.0854
NP_440372.1_2 Reverse -88 -95 6.62729 0.151
NP_440372.1_2 Forward -95 -88 6.52896 0.188
NP_441803.1_2 Reverse -364 -383 -1.18052 0.294
NP_440139.1_1 Reverse -344 -363 1.08032 0.272
NP_442384.1_10 Reverse -269 -282 6.50913 0.0995
NP_442384.1_10 Reverse -87 -100 5.42749 0.13
NP_442384.1_10 Reverse -363 -376 3.16588 0.199
NP_442384.1_10 Forward -278 -265 1.88757 0.243
NP_442114.1_4 Reverse -269 -280 8.90846 0.179
NP_441877.1_9 Reverse -117 -134 9.77361 0.211
NP_441018.1_7 Forward -268 -249 7.7676 0.265
NP_442790.1_4 Forward -287 -268 -12.7836 0.253
NP_442262.1_10 Forward -277 -270 14.1988 0.0123
NP_442262.1_10 Reverse -270 -277 14.1988 0.0123
NP_442262.1_10 Forward -95 -88 12.4288 0.0538
NP_442262.1_10 Reverse -300 -307 10.1672 0.162
NP_441689.1_5 Reverse -340 -350 10.6976 0.132
NP_441689.1_5 Forward -98 -88 8.04271 0.166
NP_441689.1_5 Forward -310 -300 7.35439 0.197
NP_441689.1_5 Reverse -85 -95 5.48612 0.251
NP_442165.1_1 Forward -21 -2 14.7483 0.244
NP_442165.1_3 Reverse -131 -145 19.0145 0.11
NP_440344.1_10 Reverse -262 -279 -12.7442 0.264
NP_440531.1_6 Reverse -261 -280 -1.7705 0.239
NP_441965.1_10 Reverse -266 -282 8.90832 0.123
NP_440297.1_9 Forward -277 -267 9.81313 0.0917
NP_440297.1_9 Reverse -88 -98 0.766681 0.282
NP_440297.1_9 Reverse -343 -353 0.176696 0.282
NP_440297.1_9 Reverse -270 -280 -0.118297 0.282
NP_441896.1_3 Reverse -260 -279 14.2574 0.0589
NP_441896.1_3 Forward -222 -203 -2.75381 0.289
NP_440937.1_5 Forward -264 -245 12.4875 0.275
NP_440999.1_9 Reverse -265 -279 -1.37704 0.236
NP_440999.1_9 Reverse -83 -97 -2.85201 0.279
NP_440999.1_9 Forward -282 -268 -2.95034 0.281
NP_440888.1_2 Reverse -369 -383 11.012 0.0783
NP_442454.1_2 Forward -136 -117 6.15881 0.298
NP_440600.1_4 Reverse -79 -97 -8.24065 0.3
NP_440491.1_2 Reverse -366 -385 21.3364 0.177
NP_442033.1_10 Forward -280 -261 -13.3736 0.287
NP_441543.1_2 Reverse -270 -279 18.486 0.00236
NP_441543.1_2 Reverse -88 -97 6.8829 0.135
NP_441543.1_2 Forward -95 -86 6.29291 0.153
NP_442845.1_2 Forward -284 -270 6.29277 0.212
NP_442845.1_2 Forward -102 -88 4.52282 0.258
NP_441469.1_8 Forward -279 -270 16.126 0.00797
NP_441469.1_8 Reverse -268 -277 13.7661 0.0719
NP_441469.1_8 Forward -166 -157 5.60459 0.258
NP_442578.1_7 Forward -277 -270 14.5921 0.026
NP_442578.1_7 Reverse -270 -277 14.5921 0.026
NP_442578.1_7 Reverse -343 -350 11.9372 0.0739
NP_441462.1_2 Forward -278 -268 11.2881 0.00441
NP_441462.1_2 Reverse -87 -97 10.5014 0.00824
NP_441462.1_2 Forward -96 -86 10.4031 0.011
NP_441462.1_2 Forward -351 -341 7.94484 0.048
NP_441462.1_2 Reverse -269 -279 1.74999 0.0811
NP_441621.1_7 Reverse -267 -281 5.21113 0.0933
NP_443062.1_1 Reverse -156 -174 8.2534 0.157
NP_443062.1_1 Forward -351 -333 3.86557 0.282
NP_442204.1_5 Forward -288 -269 17.404 0.0348
NP_442204.1_5 Forward -342 -323 6.68596 0.142
NP_441560.1_8 Forward -263 -244 16.1873 0.0771
NP_440516.1_2 Reverse -263 -281 2.18243 0.18
NP_440516.1_2 Forward -284 -266 -0.865831 0.266
NP_440516.1_8 Forward -278 -269 9.53783 0.0136
NP_440516.1_8 Reverse -87 -96 7.17789 0.0754
NP_440516.1_8 Forward -96 -87 7.07956 0.0867
NP_440516.1_8 Reverse -269 -278 7.07956 0.0867
NP_442428.1_5 Forward -277 -270 15.8704 0.0124
NP_442428.1_5 Reverse -270 -277 15.8704 0.0124
NP_442428.1_5 Reverse -343 -350 6.43063 0.148
NP_442428.1_5 Forward -95 -88 6.43063 0.148
NP_442428.1_5 Forward -350 -343 6.3323 0.193
NP_442428.1_5 Reverse -88 -95 6.13563 0.209
NP_442428.1_5 Forward -164 -157 4.46401 0.267
NP_442612.1_1 Forward -74 -59 20.7277 0.214
NP_440673.1_3 Reverse -271 -278 12.4288 0.0426
NP_440673.1_3 Forward -94 -87 9.77388 0.167
NP_440673.1_3 Forward -155 -148 6.3323 0.283
NP_440673.1_3 Forward -276 -269 5.34899 0.298
NP_441052.1_2 Reverse -269 -279 1.94665 0.221
NP_441052.1_2 Reverse -87 -97 0.963343 0.255
NP_441052.1_2 Forward -96 -86 0.766681 0.256
NP_441052.1_2 Forward -278 -268 0.668351 0.256
NP_442219.1_8 Forward -361 -342 6.52434 0.294
NP_442219.1_9 Reverse -270 -279 8.35786 0.0681
NP_442219.1_9 Reverse -343 -352 0.983037 0.299
NP_440436.1_4 Reverse -270 -279 18.1905 0.00233
NP_440436.1_4 Forward -277 -268 6.78414 0.147
NP_440436.1_4 Forward -95 -86 5.9975 0.174
NP_441884.1_9 Forward -281 -262 -22.0267 0.275
NP_441884.1_9 Reverse -266 -285 -26.4516 0.29
NP_440314.1_9 Reverse -88 -107 -5.99873 0.225
NP_441719.1_4 Forward -277 -270 16.3621 0.0124
NP_441719.1_4 Reverse -270 -277 16.3621 0.0124
NP_441719.1_4 Reverse -343 -350 6.92228 0.0565
NP_441719.1_4 Forward -350 -343 6.82395 0.0855
NP_441719.1_4 Reverse -88 -95 6.62729 0.151
NP_441719.1_4 Forward -95 -88 6.52896 0.188
NP_441733.1_10 Reverse -266 -279 10.4424 0.106
NP_441004.1_1 Forward -344 -325 -10.7186 0.225
NP_442366.1_3 Reverse -268 -286 4.83737 0.0917
NP_442366.1_5 Forward -281 -271 15.2208 0.0375
NP_441115.1_4 Forward -279 -261 14.178 0.0618
NP_440328.1_4 Forward -284 -265 11.0125 0.0791
NP_443054.1_2 Forward -98 -84 9.63603 0.0918
NP_442430.1_10 Reverse -259 -278 9.14342 0.297
NP_441851.1_10 Reverse -268 -278 15.9097 0.00552
NP_441851.1_10 Forward -279 -269 15.8113 0.00552
NP_441851.1_10 Forward -97 -87 6.8632 0.153
NP_441851.1_10 Forward -352 -342 6.07655 0.187
NP_440347.1_9 Forward -107 -88 16.5191 0.173
NP_441157.1_1 Reverse -327 -341 5.1122 0.25
NP_442515.1_1 Forward -279 -265 12.8809 0.0308
NP_442515.1_1 Reverse -86 -100 -0.492064 0.224
NP_440463.1_8 Reverse -366 -385 5.66045 0.277
NP_441046.1_2 Forward -107 -88 -0.590531 0.282
NP_440338.1_4 Reverse -25 -44 5.80018 0.293
NP_441349.1_10 Forward -288 -269 -0.590531 0.0947
NP_441409.1_6 Forward -102 -83 1.27776 0.0619
NP_441409.1_6 Forward -314 -295 -11.0136 0.215
NP_441409.1_6 Forward -171 -152 -13.9635 0.247
NP_440432.1_9 Forward -95 -80 -3.95334 0.194
NP_440474.1_8 Forward -277 -263 8.16044 0.189
NP_440474.1_8 Reverse -270 -284 7.17714 0.207
NP_440474.1_8 Reverse -343 -357 6.48882 0.226
NP_440474.1_8 Reverse -253 -267 6.19383 0.23
NP_440474.1_8 Reverse -88 -102 6.19383 0.23
NP_442450.1_5 Forward -280 -270 7.55152 0.13
NP_440588.1_2 Forward -287 -268 19.9606 0.0104
NP_440588.1_2 Forward -105 -86 -4.6221 0.223
NP_440040.1_1 Forward -285 -267 16.8337 0.101
NP_441570.1_1 Forward -96 -78 -16.5005 0.247
NP_441078.1_4 Reverse -87 -96 10.4228 0.0105
NP_441078.1_4 Forward -96 -87 10.3245 0.0119
NP_441078.1_4 Forward -278 -269 9.93116 0.0203
NP_441078.1_4 Reverse -269 -278 9.83282 0.0226
NP_442348.1_2 Forward -240 -231 9.53783 0.28
NP_440526.1_3 Forward -277 -266 9.79292 0.075
NP_441432.1_8 Reverse -86 -95 17.7976 0.00595
NP_441432.1_8 Forward -279 -270 8.25953 0.0755
NP_441432.1_8 Forward -97 -88 7.17789 0.102
NP_441432.1_8 Forward -309 -300 5.21127 0.185
NP_442320.1_8 Forward -357 -343 -4.52363 0.171
NP_441732.1_2 Forward -282 -266 -7.61128 0.0861
NP_441732.1_2 Reverse -83 -99 -16.6577 0.186
NP_441732.1_2 Forward -100 -84 -16.7561 0.195
NP_440629.1_6 Reverse -150 -169 13.1886 0.265
NP_440760.1_1 Forward -96 -77 -15.8318 0.157
NP_440760.1_1 Forward -278 -259 -20.65 0.224
NP_441023.1_1 Forward -110 -92 16.4404 0.18
NP_442489.1_7 Forward -96 -87 17.601 0.00221
NP_442489.1_7 Reverse -87 -96 10.4228 0.0151
NP_442489.1_7 Forward -278 -269 10.4228 0.0151
NP_442489.1_7 Reverse -269 -278 10.3245 0.0193
NP_442079.1_7 Reverse -88 -107 -0.4922 0.296
NP_440559.1_1 Forward -277 -268 16.421 0.01
NP_440559.1_1 Reverse -270 -279 8.75118 0.0586
NP_440559.1_1 Reverse -343 -352 7.07956 0.112
NP_440559.1_1 Reverse -88 -97 5.40793 0.14
NP_441659.2_8 Forward -278 -268 16.008 0.0042
NP_441659.2_8 Reverse -87 -97 11.4848 0.0172
NP_441659.2_8 Forward -96 -86 11.0914 0.0207
NP_441659.2_8 Reverse -342 -352 3.12662 0.172
NP_441659.2_8 Reverse -269 -279 2.43831 0.2
NP_442913.1_10 Reverse -260 -279 -0.39387 0.159
NP_442913.1_10 Forward -105 -86 -3.44213 0.21
NP_440442.1_9 Reverse -260 -279 15.2408 0.162
NP_440779.1_5 Reverse -252 -269 -14.9075 0.287
NP_442346.1_5 Reverse -86 -96 13.5497 0.0226
NP_442346.1_5 Reverse -268 -278 8.53483 0.133
NP_442346.1_5 Forward -279 -269 7.74818 0.159
NP_442346.1_5 Forward -97 -87 7.15819 0.178
NP_440545.1_3 Forward -282 -265 7.41366 0.0499
NP_440545.1_3 Reverse -265 -282 5.9387 0.0587
NP_440545.1_3 Reverse -83 -100 -4.87771 0.235
NP_442603.1_7 Forward -278 -264 8.55376 0.171
NP_441948.1_4 Reverse -262 -280 -6.27403 0.293
NP_439970.1_5 Forward -269 -250 20.2556 0.121
NP_441779.1_10 Reverse -302 -314 18.9185 0.289
NP_441833.1_4 Forward -277 -270 15.9687 0.0124
NP_441833.1_4 Reverse -270 -277 15.9687 0.0124
NP_441833.1_4 Reverse -343 -350 6.52896 0.0924
NP_441833.1_4 Forward -350 -343 6.43063 0.125
NP_441833.1_4 Reverse -88 -95 6.23397 0.163
NP_441833.1_4 Forward -95 -88 6.13563 0.198
NP_442162.1_9 Forward -277 -270 16.2637 0.0124
NP_442162.1_9 Reverse -270 -277 16.2637 0.0124
NP_442162.1_9 Forward -95 -88 12.6255 0.0393
NP_442162.1_9 Reverse -343 -350 6.82395 0.0927
NP_442162.1_9 Forward -350 -343 6.72562 0.116
NP_442162.1_9 Reverse -88 -95 6.52896 0.178
NP_440671.1_4 Reverse -293 -307 5.60446 0.279
NP_442045.1_5 Forward -360 -341 7.66927 0.197
NP_442199.1_5 Reverse -148 -167 -5.31042 0.244
NP_442140.1_3 Reverse -270 -280 16.2046 0.0255
NP_442140.1_3 Forward -277 -267 15.8113 0.0322
NP_442140.1_3 Reverse -157 -167 11.8781 0.0695
NP_440875.1_9 Forward -163 -153 14.7963 0.0363
NP_440875.1_9 Reverse -153 -163 8.27469 0.233
NP_441813.1_5 Forward -280 -270 9.91146 0.021
NP_441813.1_5 Reverse -267 -277 8.1415 0.0478
NP_441813.1_5 Forward -98 -88 6.07655 0.104
NP_441813.1_5 Reverse -340 -350 5.68323 0.113
NP_441813.1_5 Forward -353 -343 5.5849 0.118
NP_440594.1_8 Forward -277 -264 11.9167 0.152
NP_440594.1_8 Reverse -88 -101 7.59019 0.272
NP_440590.1_4 Reverse -270 -283 3.36254 0.0746
NP_440590.1_4 Forward -277 -264 -4.50394 0.262
NP_440590.1_4 Forward -338 -325 -5.88057 0.293
NP_440567.1_1 Reverse -270 -284 12.6843 0.022
NP_440567.1_1 Forward -277 -263 2.2612 0.179
NP_442497.1_10 Forward -277 -268 17.9943 0.00813
NP_442497.1_10 Reverse -270 -279 10.4228 0.0087
NP_442497.1_10 Reverse -88 -97 7.86621 0.0695
NP_442497.1_10 Forward -95 -86 7.76787 0.0731
NP_442497.1_10 Forward -350 -341 6.19458 0.0812
NP_442497.1_10 Reverse -343 -352 -0.885252 0.215
NP_440821.1_4 Reverse -267 -277 18.9579 0.00422
NP_440821.1_4 Forward -280 -270 10.2065 0.0163
NP_440821.1_4 Forward -353 -343 8.1415 0.055
NP_440821.1_4 Forward -98 -88 1.25834 0.139
NP_441239.1_9 Reverse -267 -279 17.0502 0.0153
NP_441239.1_9 Forward -280 -268 11.7404 0.0551
NP_441239.1_9 Reverse -85 -97 9.28209 0.11
NP_441239.1_9 Forward -98 -86 3.08724 0.296
NP_441541.1_1 Forward -198 -180 -2.95826 0.264
NP_441541.1_1 Forward -126 -108 -4.8681 0.285
NP_440900.1_5 Forward -101 -82 14.8567 0.28
NP_440354.1_7 Reverse -263 -281 10.9339 0.224
NP_442138.1_10 Forward -165 -146 -2.95047 0.223
NP_440462.1_6 Forward -280 -270 9.02648 0.0498
NP_440462.1_6 Forward -98 -88 7.05986 0.0915
NP_440462.1_6 Reverse -340 -350 6.76487 0.102
NP_440462.1_6 Reverse -267 -277 1.74999 0.294
NP_440868.1_4 Forward -282 -270 20.2952 0.00865
NP_440868.1_4 Forward -100 -88 7.90546 0.0637
NP_440868.1_4 Reverse -265 -277 4.26721 0.122
NP_442479.1_9 Forward -303 -284 -9.93197 0.266
NP_441582.1_5 Forward -280 -261 5.99684 0.202
NP_441843.2_9 Reverse -254 -272 11.7564 0.205
NP_441843.2_9 Forward -306 -288 10.5893 0.23
NP_442039.1_4 Forward -277 -270 15.1821 0.0124
NP_442039.1_4 Reverse -270 -277 15.1821 0.0124
NP_442039.1_4 Forward -95 -88 14.3954 0.0271
NP_441811.1_8 Reverse -263 -277 14.1593 0.175
NP_440825.1_7 Reverse -270 -280 12.4217 0.155
NP_440825.1_7 Forward -277 -267 12.2265 0.177
NP_442837.1_3 Forward -277 -270 15.7721 0.0124
NP_442837.1_3 Reverse -270 -277 15.7721 0.0124
NP_442837.1_3 Reverse -343 -350 6.43063 0.212
NP_442837.1_3 Forward -350 -343 6.23397 0.244
NP_442837.1_3 Reverse -88 -95 6.0373 0.25
NP_442837.1_3 Forward -95 -88 5.93897 0.265
NP_442053.1_1 Forward -278 -269 9.34117 0.0666
NP_442053.1_1 Reverse -269 -278 8.84951 0.072
NP_442053.1_1 Reverse -87 -96 8.65285 0.0741
NP_442053.1_1 Forward -96 -87 8.55452 0.0784
NP_440505.1_3 Forward -98 -88 12.0747 0.0596
NP_440505.1_3 Forward -280 -270 6.76487 0.169
NP_440505.1_3 Reverse -85 -95 6.37155 0.183
NP_441102.1_1 Forward -350 -331 4.81767 0.256
NP_442532.1_7 Forward -278 -264 6.29277 0.171
NP_442532.1_7 Reverse -269 -283 1.67122 0.274
NP_440914.1_1 Reverse -87 -97 14.373 0.0158
NP_440914.1_1 Forward -96 -86 7.05364 0.254
NP_440914.1_1 Forward -278 -268 6.27291 0.288
NP_441011.1_8 Reverse -270 -279 16.9127 0.00602
NP_441011.1_8 Forward -350 -341 8.45619 0.144
NP_441011.1_8 Reverse -88 -97 7.07956 0.179
NP_441011.1_8 Forward -95 -86 6.8829 0.18
NP_441011.1_8 Forward -277 -268 6.68623 0.184
NP_442533.1_6 Reverse -87 -96 8.65285 0.0727
NP_442533.1_6 Forward -96 -87 7.96454 0.0838
NP_442533.1_6 Forward -278 -269 7.86621 0.0862
NP_442533.1_6 Reverse -269 -278 7.37455 0.0898
NP_442533.1_6 Reverse -369 -378 2.55633 0.25
NP_443050.1_7 Forward -379 -365 17.1092 0.285
NP_442229.1_1 Reverse -267 -281 5.01387 0.291
NP_443016.1_1 Forward -284 -265 -4.03212 0.225
NP_439944.1_9 Forward -277 -267 15.2213 0.0239
NP_439944.1_9 Reverse -88 -98 8.1415 0.116
NP_439944.1_9 Reverse -343 -353 7.55152 0.138
NP_439944.1_9 Forward -350 -340 6.46988 0.179
NP_441697.1_5 Reverse -113 -132 -10.2658 0.278
NP_442202.1_10 Reverse -268 -282 5.21113 0.255
NP_440116.1_8 Forward -350 -331 5.211 0.0658
NP_440115.1_6 Reverse -266 -276 9.02648 0.123
NP_441106.1_1 Forward -279 -270 18.191 0.0028
NP_441106.1_1 Forward -97 -88 8.84951 0.0431
NP_441106.1_1 Reverse -86 -95 8.75118 0.0469
NP_441106.1_1 Reverse -341 -350 8.1612 0.0597
NP_441106.1_1 Forward -166 -157 2.55633 0.28
NP_439903.1_6 Forward -99 -80 12.29 0.0872
NP_442306.1_10 Forward -253 -234 -21.0434 0.242
NP_441286.1_1 Forward -279 -267 5.54551 0.0259
NP_441286.1_1 Reverse -268 -280 -4.68091 0.168
NP_441286.1_1 Reverse -86 -98 -4.77924 0.175
NP_441286.1_1 Forward -352 -340 -5.66422 0.213
NP_440670.1_8 Forward -278 -269 16.3227 0.00291
NP_440670.1_8 Reverse -269 -278 15.1427 0.00768
NP_440670.1_8 Forward -96 -87 15.1427 0.00768
NP_440670.1_8 Reverse -87 -96 8.65285 0.0627
NP_440886.1_7 Forward -279 -269 8.53436 0.0805
NP_440886.1_7 Reverse -86 -96 5.48612 0.181
NP_440886.1_7 Reverse -275 -285 3.91283 0.26
NP_442614.1_2 Forward -278 -264 19.0758 0.0456
NP_441753.1_10 Reverse -260 -279 0.491109 0.291
NP_440907.2_8 Forward -277 -267 17.5808 0.00685
NP_440907.2_8 Reverse -270 -280 14.2375 0.0312
NP_440907.2_8 Forward -95 -85 6.0761 0.179
NP_441463.1_3 Forward -367 -348 -10.522 0.296
NP_441626.1_2 Forward -277 -270 15.7721 0.0124
NP_441626.1_2 Reverse -270 -277 15.7721 0.0124
NP_441626.1_2 Forward -350 -343 12.6255 0.0468
NP_441626.1_2 Forward -95 -88 6.43063 0.147
NP_441626.1_2 Reverse -343 -350 6.3323 0.155
NP_441626.1_2 Reverse -88 -95 6.0373 0.212
NP_442365.1_5 Forward -277 -258 10.6192 0.183
NP_442238.1_7 Reverse -285 -304 17.0099 0.139
NP_442615.1_1 Forward -287 -269 -4.8974 0.197
NP_442615.1_1 Reverse -78 -96 -4.8974 0.197
NP_442615.1_1 Reverse -333 -351 -5.48739 0.215
NP_442615.1_1 Reverse -260 -278 -5.78238 0.223
NP_441962.1_4 Reverse -343 -362 -7.17871 0.185
NP_440387.1_1 Reverse -269 -285 13.8249 0.00803
NP_440387.1_1 Forward -278 -262 -3.18639 0.156
NP_440387.1_1 Reverse -87 -103 -3.28472 0.157
NP_440387.1_1 Forward -96 -80 -4.26803 0.181
NP_441431.1_2 Forward -281 -267 11.2087 0.145
NP_441431.1_2 Reverse -266 -280 10.9137 0.15
NP_441431.1_2 Forward -99 -85 5.80051 0.288
NP_441488.1_7 Reverse -263 -282 0.786102 0.296
NP_441174.1_2 Forward -99 -85 13.4709 0.201
NP_440467.1_8 Reverse -144 -163 11.5042 0.243
NP_440114.1_10 Forward -96 -82 15.1426 0.0294
NP_440114.1_10 Reverse -87 -101 13.2743 0.0609
NP_440114.1_10 Forward -278 -264 11.406 0.115
NP_440114.1_10 Forward -308 -294 6.19444 0.282
NP_442323.1_7 Reverse -300 -319 3.24359 0.245
NP_441510.2_6 Forward -388 -369 12.29 0.282
NP_440287.1_6 Reverse -267 -286 6.09597 0.17
NP_440293.1_3 Reverse -367 -386 1.86774 0.207
NP_440766.1_4 Reverse -265 -279 9.83269 0.0871
NP_441237.1_9 Forward -277 -267 16.7946 0.0141
NP_441311.1_4 Reverse -38 -55 7.02034 0.298
NP_442103.1_2 Forward -363 -345 9.26148 0.246
NP_442930.1_1 Forward -129 -119 10.206 0.278
NP_440457.1_1 Reverse -265 -277 7.11881 0.105
NP_440798.1_6 Reverse -270 -283 5.52582 0.14
NP_440798.1_6 Forward -277 -264 2.77255 0.16
NP_440473.1_9 Reverse -258 -277 2.26107 0.0985
NP_440473.1_9 Forward -289 -270 -4.03212 0.177
NP_442509.1_9 Forward -278 -268 13.6475 0.0475
NP_442509.1_9 Reverse -269 -279 12.1726 0.101
NP_440554.1_4 Forward -350 -340 8.63316 0.0695
NP_440554.1_4 Forward -277 -267 7.55152 0.103
NP_440554.1_4 Reverse -270 -280 7.35486 0.103
NP_440554.1_4 Reverse -88 -98 6.56821 0.121
NP_441885.1_5 Forward -278 -268 2.24165 0.0822
NP_441885.1_5 Reverse -87 -97 2.24165 0.0822
NP_441885.1_5 Reverse -269 -279 1.65166 0.106
NP_441885.1_5 Forward -96 -86 1.55333 0.109
NP_442341.1_7 Forward -279 -265 5.21113 0.165
NP_442341.1_7 Reverse -268 -282 3.53951 0.22
NP_442341.1_9 Reverse -85 -99 5.60385 0.263
NP_442341.1_9 Forward -98 -84 4.52221 0.299
NP_440409.1_1 Forward -286 -267 -0.983855 0.224
NP_440423.1_10 Reverse -80 -99 9.24257 0.26
NP_443000.1_7 Forward -98 -88 7.64985 0.0734
NP_443000.1_7 Reverse -340 -350 7.55152 0.0778
NP_443000.1_7 Forward -280 -270 1.94665 0.226
NP_443000.1_7 Reverse -85 -95 0.963343 0.278
NP_440507.2_3 Reverse -347 -366 10.52 0.207
NP_440507.2_3 Reverse -260 -279 7.37347 0.281
NP_441561.1_8 Forward -49 -30 17.5123 0.282
NP_441842.1_1 Forward -276 -263 14.965 0.0837
NP_440275.1_3 Reverse -267 -277 19.6462 0.00756
NP_440275.1_3 Forward -280 -270 8.33817 0.0602
NP_440275.1_3 Forward -353 -343 7.25653 0.0823
NP_440091.1_1 Forward -282 -270 0.727295 0.233
NP_440091.1_1 Reverse -265 -277 0.530633 0.247
NP_440312.1_8 Forward -85 -66 10.8728 0.271
NP_440679.1_10 Forward -285 -266 -20.2567 0.283
NP_443010.1_10 Forward -281 -264 5.57317 0.203
NP_442451.1_2 Forward -286 -267 -8.752 0.253
NP_440175.1_4 Forward -104 -85 -14.4552 0.277
NP_440149.1_8 Reverse -342 -361 -6.78538 0.261
NP_440216.1_1 Forward -278 -264 -10.9151 0.153
NP_440216.1_1 Reverse -269 -283 -11.0135 0.159
NP_440216.1_1 Reverse -87 -101 -11.2101 0.169
NP_440216.1_1 Forward -96 -82 -11.6035 0.203
NP_440172.1_1 Forward -96 -86 14.533 0.0118
NP_440172.1_1 Reverse -87 -97 14.3364 0.0134
NP_440172.1_1 Forward -278 -268 9.7148 0.0586
NP_442015.1_10 Reverse -265 -278 5.91914 0.13
NP_442015.1_10 Forward -282 -269 1.00259 0.216
NP_441226.1_7 Forward -277 -270 14.4934 0.0123
NP_441226.1_7 Reverse -270 -277 14.4934 0.0123
NP_441226.1_7 Reverse -343 -350 11.8385 0.0485
NP_441226.1_7 Reverse -88 -95 5.64364 0.286
NP_441111.1_7 Reverse -270 -278 18.7023 0.00294
NP_441111.1_7 Forward -277 -269 8.96754 0.0463
NP_441111.1_7 Reverse -88 -96 8.96754 0.0463
NP_441111.1_7 Forward -95 -87 8.86921 0.0589
NP_441111.1_7 Reverse -343 -351 -0.472234 0.131
NP_441111.1_7 Forward -350 -342 -0.668896 0.274
NP_441766.1_2 Reverse -269 -278 16.2243 0.0047
NP_441766.1_2 Forward -278 -269 9.14451 0.0337
NP_441766.1_2 Reverse -87 -96 7.76787 0.0714
NP_441766.1_2 Forward -96 -87 7.66954 0.0723
NP_441766.1_2 Forward -351 -342 7.07956 0.0757
NP_443052.1_8 Reverse -259 -278 -7.76869 0.164
NP_440261.1_5 Forward -277 -264 14.3756 0.0214
NP_440261.1_5 Reverse -270 -283 -2.53732 0.0924
NP_440261.1_5 Reverse -88 -101 -4.89726 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACTAGAAGTACTCGGCTCACTGGCGCAGGGCATGAGTAATGCCGATATTGCGACCGCTTTAAGTATCGGTGAAGGTACTGTTAAATCCCATGTCAATCGGATTTTGAATAAGTTGGATGTCGGCGATCGCACCCAAGCTGTGATTGTTGCCGTTAAACGCGGCATTGTCAGTTTGTAAGGTGTACTTTCGATCAGACTAGGATTCTAACTTAAGTTATAACCAGCCTTTTACTCTACGATGGCATGGTTGCTCCATCAATTTATACTATAAAAATTTTAACTTGCTGTAGAAGACGGTTTGAAGGCGATTGCCTATATTGAATTTATGCAAATAGAGACGCAGTCAAGTAATCGAGCAAGTTAATTGCAAGGTTTCATGTCTGATATAGATGTAGAAAA

CDS

ATGAGCAAAGATCGCAACCACGGTTCCTTACTTGTACCACCTTCAACCCAAGATTGGATGCAAGGTGTGCTGAGTGCCAAGGTCGTACTGGTGATGTATGGAGATTACCAAGACTCCAGAAGTGCGGATGTTTACAAGCTGATTAAAGTCATCAAACGAGAGCTTAGTGCTTCTTTTGGAGAGGATTATTCATGCTTTATCTTCCGTCATTTTCCGCAAGTACAGATCCATCCTCATGCTCAACGAGCCGCCCAAGCTGCCGAAGCCGCTGCTGCCCAAGGACAGTTTTGGTTAATGAATGATACCTTATTTGACCATCAACAAAGGTTGGAGAATGGTTATCTTGTCGAGTACGCCAATGATTTAGGACTTGATATTCCTCAATTTCTCAAAGAGTTGGCTAAACAAGTGCACGTTGATCGCATCAAGAAAGATATTGAAGGCGGTTTACAAAGTGGAGTGATGGCTGTTCCAGCACTTTTTGTTAATGGAATTCTCTATCGCGATTGCTGGAATATTAAACAGTTGATCGCAACCATTATTGCTTCAAGTTACTAG

Protein

MSKDRNHGSLLVPPSTQDWMQGVLSAKVVLVMYGDYQDSRSADVYKLIKVIKRELSASFGEDYSCFIFRHFPQVQIHPHAQRAAQAAEAAAAQGQFWLMNDTLFDHQQRLENGYLVEYANDLGLDIPQFLKELAKQVHVDRIKKDIEGGLQSGVMAVPALFVNGILYRDCWNIKQLIATIIASSY