Your browser is old and dusty. Try Google Chrome!

Details for slr0309

ORF slr0309
Accession NP_442606.1
Symbol
Category Other
Definition probable methyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -223 -209 18.3875 0.0204
NP_441061.1_2 Reverse -216 -230 -0.590395 0.234
NP_440795.1_7 Forward -223 -216 14.6904 0.0123
NP_440795.1_7 Reverse -216 -223 14.6904 0.0123
NP_441418.1_6 Reverse -215 -234 -11.1119 0.0445
NP_442291.1_5 Forward -225 -209 8.41667 0.0558
NP_442291.1_5 Reverse -366 -382 7.92501 0.0589
NP_442272.1_2 Reverse -265 -284 10.1695 0.258
NP_441453.1_4 Reverse -215 -223 16.539 0.00633
NP_441453.1_4 Forward -224 -216 16.539 0.00633
NP_441623.1_3 Reverse -267 -286 15.3408 0.263
NP_442151.1_6 Forward -224 -210 8.06273 0.183
NP_441818.1_1 Forward -223 -212 15.8894 0.0244
NP_440226.1_1 Forward -224 -205 2.0644 0.278
NP_442173.1_1 Forward -223 -215 15.4574 0.00633
NP_442173.1_1 Reverse -216 -224 15.4574 0.00633
NP_442752.1_4 Forward -224 -217 13.8055 0.0199
NP_442752.1_4 Reverse -215 -222 13.8055 0.0199
NP_443027.1_4 Reverse -213 -223 14.0414 0.0452
NP_443027.1_4 Forward -226 -216 11.8781 0.0872
NP_443027.1_4 Forward -378 -368 9.81313 0.15
NP_442975.1_10 Forward -228 -214 12.782 0.0459
NP_440784.1_7 Forward -223 -216 15.9687 0.0123
NP_440784.1_7 Reverse -216 -223 15.9687 0.0123
NP_442909.1_7 Forward -223 -209 9.93039 0.14
NP_440061.1_6 Forward -151 -133 13.293 0.239
NP_440061.1_9 Reverse -213 -227 9.93039 0.134
NP_440061.1_9 Forward -226 -212 9.43874 0.145
NP_441499.1_1 Forward -394 -375 13.7658 0.237
NP_442062.1_3 Forward -158 -139 10.9142 0.152
NP_442062.1_3 Reverse -264 -283 -0.4922 0.245
NP_442062.1_8 Reverse -215 -225 19.4496 0.000558
NP_442062.1_8 Forward -224 -214 17.3846 0.00193
NP_442062.1_8 Reverse -344 -354 2.92996 0.292
NP_441859.1_3 Reverse -214 -233 8.35677 0.139
NP_440304.1_4 Reverse -213 -223 10.8948 0.051
NP_440304.1_4 Forward -226 -216 1.84832 0.299
NP_440304.1_10 Forward -375 -357 13.6872 0.215
NP_442242.1_4 Forward -223 -216 14.3954 0.0124
NP_442242.1_4 Reverse -216 -223 14.3954 0.0124
NP_441619.1_8 Reverse -209 -223 8.94708 0.237
NP_442726.1_1 Forward -372 -353 9.53756 0.247
NP_442726.1_1 Reverse -210 -229 9.3409 0.252
NP_440856.1_4 Forward -231 -212 -3.63879 0.234
NP_441083.1_5 Forward -224 -214 20.3345 0.00053
NP_441083.1_5 Reverse -215 -225 11.3864 0.0159
NP_442827.1_8 Forward -226 -207 -0.492971 0.228
NP_441738.1_2 Forward -222 -215 15.28 0.0102
NP_441738.1_2 Reverse -217 -224 15.28 0.0102
NP_441738.1_2 Reverse -369 -376 6.03696 0.295
NP_440209.1_1 Reverse -215 -223 18.1123 0.00295
NP_440209.1_1 Forward -224 -216 18.1123 0.00295
NP_442136.1_1 Forward -150 -131 10.9142 0.205
NP_442889.1_8 Forward -227 -213 21.0417 0.00339
NP_440178.1_7 Forward -225 -206 -22.6167 0.268
NP_441716.1_1 Forward -224 -210 4.32615 0.256
NP_442111.1_4 Reverse -214 -228 20.9441 0.00257
NP_440906.1_5 Forward -223 -216 15.8704 0.0124
NP_440906.1_5 Reverse -216 -223 15.8704 0.0124
NP_440438.2_8 Reverse -131 -150 3.04771 0.254
NP_442596.1_10 Reverse -165 -184 6.4893 0.293
NP_440747.1_10 Reverse -212 -224 7.4138 0.00422
NP_440747.1_10 Forward -227 -215 7.21714 0.00643
NP_441130.1_10 Reverse -213 -227 9.34103 0.126
NP_441486.1_1 Reverse -212 -226 4.22782 0.0475
NP_441486.1_1 Forward -227 -213 2.85119 0.074
NP_442145.1_4 Forward -282 -263 6.54077 0.216
NP_442145.1_4 Forward -262 -243 4.53544 0.282
NP_442634.1_4 Forward -226 -212 -1.96703 0.149
NP_443017.1_1 Forward -28 -9 14.6414 0.274
NP_441014.1_10 Forward -225 -206 -2.36125 0.274
NP_442848.1_1 Forward -382 -368 0.786239 0.263
NP_442848.1_1 Reverse -209 -223 -1.37704 0.263
NP_443018.1_3 Forward -223 -216 14.8871 0.0123
NP_443018.1_3 Reverse -216 -223 14.8871 0.0123
NP_441634.1_8 Reverse -213 -227 3.73617 0.143
NP_440376.1_1 Forward -224 -215 19.4693 0.000692
NP_440376.1_1 Reverse -215 -224 19.4693 0.000692
NP_441588.1_4 Forward -222 -212 6.37155 0.2
NP_442687.1_7 Forward -225 -215 15.8113 0.0125
NP_442687.1_7 Reverse -214 -224 8.92815 0.0994
NP_442687.1_7 Reverse -357 -367 4.0116 0.271
NP_441077.1_6 Reverse -358 -374 6.65814 0.238
NP_441077.1_6 Reverse -248 -264 3.38031 0.271
NP_442958.1_3 Reverse -204 -223 -2.65548 0.297
NP_440642.1_8 Reverse -217 -236 17.9002 0.0742
NP_441013.1_2 Forward -229 -211 -4.60241 0.299
NP_441422.1_7 Forward -226 -209 -3.69774 0.235
NP_442658.1_1 Forward -226 -216 17.0891 0.00615
NP_442658.1_1 Reverse -213 -223 6.76441 0.214
NP_442544.1_6 Forward -231 -212 -5.9004 0.298
NP_441414.1_9 Forward -224 -205 12.7825 0.0151
NP_441414.1_9 Reverse -215 -234 -0.787193 0.0943
NP_440184.1_1 Reverse -132 -151 11.7766 0.0971
NP_440720.1_1 Forward -364 -345 6.19431 0.198
NP_442937.1_5 Forward -229 -210 11.6025 0.133
NP_441958.1_1 Reverse -99 -118 14.4648 0.27
NP_441958.1_5 Forward -225 -215 12.2714 0.00183
NP_441958.1_5 Reverse -214 -224 12.2714 0.00183
NP_442605.1_1 Reverse -365 -383 24.8969 0.00572
NP_442605.1_2 Reverse -137 -153 15.7908 0.291
NP_442605.1_4 Reverse -218 -237 21.9273 0.0247
NP_442685.1_2 Reverse -267 -277 16.598 0.121
NP_439905.1_1 Forward -96 -83 10.4424 0.216
NP_439990.1_5 Reverse -210 -223 7.6891 0.186
NP_442690.1_1 Forward -157 -138 -10.0303 0.209
NP_442690.1_1 Forward -147 -128 -10.0303 0.209
NP_442911.1_2 Forward -234 -215 16.1257 0.00978
NP_442911.1_2 Reverse -205 -224 10.3242 0.0151
NP_440153.1_5 Reverse -216 -230 0.786239 0.289
NP_442119.1_6 Forward -226 -207 12.5858 0.12
NP_441099.1_5 Reverse -205 -224 -2.75381 0.126
NP_441099.1_5 Forward -234 -215 -9.93197 0.237
NP_441099.1_8 Forward -268 -250 17.0296 0.141
NP_442002.1_9 Forward -225 -218 10.7572 0.185
NP_441294.1_7 Forward -228 -214 9.4426 0.244
NP_441646.1_1 Forward -231 -212 3.34271 0.207
NP_441000.1_6 Reverse -214 -228 -2.45868 0.216
NP_440147.1_4 Forward -226 -213 9.95071 0.0362
NP_440147.1_4 Reverse -213 -226 8.47575 0.0504
NP_441295.1_4 Reverse -210 -229 -3.83545 0.29
NP_441550.1_8 Reverse -213 -223 12.3692 0.0336
NP_441550.1_8 Forward -226 -216 8.82935 0.112
NP_441916.1_7 Reverse -215 -225 18.4663 0.00144
NP_441916.1_7 Forward -224 -214 10.3048 0.0261
NP_441041.1_7 Reverse -364 -376 8.48655 0.135
NP_441041.1_7 Forward -227 -215 8.48655 0.135
NP_442396.1_5 Reverse -211 -224 18.6038 0.0171
NP_440703.1_9 Reverse -358 -371 4.93527 0.293
NP_441725.1_4 Forward -229 -215 12.0937 0.0693
NP_441725.1_5 Forward -223 -213 11.2881 0.0247
NP_441725.1_5 Reverse -216 -226 2.04498 0.115
NP_439966.1_7 Forward -226 -216 17.9741 0.00631
NP_439966.1_7 Reverse -213 -223 15.8108 0.0124
NP_439966.1_9 Forward -226 -217 0.884706 0.253
NP_442941.1_3 Forward -223 -213 19.9412 0.00262
NP_442941.1_3 Reverse -216 -226 10.7964 0.0116
NP_440289.1_2 Forward -227 -214 11.1307 0.0212
NP_440289.1_2 Reverse -212 -225 -2.93064 0.262
NP_442281.1_1 Forward -229 -215 11.307 0.0487
NP_442281.1_1 Reverse -210 -224 8.25877 0.0832
NP_441079.1_7 Reverse -247 -266 -7.27777 0.29
NP_440177.1_9 Reverse -207 -226 13.4708 0.226
NP_442256.1_2 Forward -226 -208 -8.83064 0.236
NP_441644.1_6 Forward -224 -214 17.3841 0.00127
NP_441644.1_6 Reverse -215 -225 10.1076 0.0628
NP_442215.1_2 Forward -226 -210 -6.62797 0.277
NP_440253.1_2 Reverse -215 -233 18.8004 0.00815
NP_440253.1_2 Forward -224 -206 5.32902 0.0936
NP_440929.1_8 Forward -224 -215 19.2726 0.000701
NP_440929.1_8 Reverse -215 -224 19.2726 0.000701
NP_440780.1_1 Forward -288 -269 12.0793 0.242
NP_440780.1_1 Forward -119 -100 10.9334 0.254
NP_442933.1_10 Forward -224 -215 17.601 0.00325
NP_442933.1_10 Reverse -215 -224 17.601 0.00325
NP_441751.2_8 Forward -223 -209 15.4376 0.0119
NP_442554.1_8 Forward -223 -213 15.9097 0.00747
NP_442554.1_8 Reverse -216 -226 14.1397 0.0144
NP_441762.1_7 Reverse -214 -226 2.98891 0.0676
NP_441762.1_7 Forward -225 -213 2.30059 0.0676
NP_442142.1_4 Reverse -212 -225 8.77016 0.108
NP_442142.1_4 Forward -227 -214 5.91857 0.178
NP_442292.1_1 Forward -223 -214 18.486 0.00229
NP_442292.1_1 Reverse -216 -225 9.63616 0.0183
NP_442292.1_1 Forward -96 -87 3.04799 0.211
NP_440122.1_2 Forward -375 -356 1.86774 0.237
NP_442476.1_6 Reverse -216 -230 11.0127 0.0601
NP_442476.1_6 Forward -223 -209 1.47456 0.214
NP_443009.1_5 Reverse -214 -225 18.3477 0.00265
NP_441715.1_4 Reverse -216 -226 18.8596 0.00741
NP_441715.1_4 Forward -223 -213 14.828 0.0268
NP_441468.1_1 Forward -223 -216 15.8704 0.0124
NP_441468.1_1 Reverse -216 -223 15.8704 0.0124
NP_441020.2_6 Reverse -213 -230 6.33202 0.267
NP_441673.1_1 Forward -224 -215 20.8459 0.000698
NP_441673.1_1 Reverse -215 -224 20.8459 0.000698
NP_441876.1_9 Forward -306 -296 12.6642 0.267
NP_441826.1_2 Reverse -209 -223 4.03116 0.105
NP_442811.1_2 Reverse -213 -232 2.45773 0.252
NP_441764.1_4 Forward -150 -133 15.3292 0.116
NP_441764.1_4 Reverse -262 -279 10.9366 0.232
NP_441764.1_8 Forward -119 -109 13.5119 0.284
NP_442868.1_6 Forward -226 -216 10.3048 0.038
NP_442868.1_6 Reverse -213 -223 9.91146 0.038
NP_440806.1_1 Reverse -325 -343 15.6538 0.106
NP_441612.1_2 Forward -224 -214 8.54929 0.21
NP_441612.1_2 Reverse -299 -309 6.61303 0.283
NP_442427.1_8 Reverse -335 -354 7.57094 0.211
NP_441911.1_10 Reverse -243 -262 8.94462 0.247
NP_442808.1_1 Forward -225 -215 18.4657 0.00201
NP_442808.1_1 Reverse -214 -224 8.63269 0.0481
NP_442542.1_2 Forward -226 -213 17.6205 0.0422
NP_442050.1_5 Reverse -213 -223 16.4991 0.00812
NP_442050.1_5 Forward -226 -216 6.96107 0.27
NP_440558.1_2 Reverse -206 -225 -5.60541 0.262
NP_441518.1_3 Reverse -205 -224 -12.2919 0.263
NP_441878.1_6 Forward -225 -215 10.4031 0.0176
NP_441878.1_6 Reverse -214 -224 10.4031 0.0176
NP_441036.1_8 Forward -225 -215 17.7779 0.000554
NP_441036.1_8 Reverse -214 -224 8.33817 0.174
NP_441557.1_5 Forward -224 -215 19.9609 0.000699
NP_441557.1_5 Reverse -215 -224 19.9609 0.000699
NP_442066.2_9 Reverse -211 -224 11.229 0.154
NP_442066.2_9 Forward -228 -215 10.8357 0.154
NP_441308.1_8 Reverse -365 -375 9.7148 0.226
NP_441458.1_10 Reverse -335 -354 2.16274 0.273
NP_442183.1_1 Forward -224 -210 20.3541 0.00441
NP_442183.1_1 Reverse -215 -229 12.8809 0.05
NP_441819.1_5 Reverse -255 -274 14.1801 0.195
NP_442347.1_2 Forward -223 -214 12.4878 0.056
NP_442347.1_2 Reverse -216 -225 11.1111 0.056
NP_442645.1_2 Reverse -207 -226 2.85105 0.0352
NP_441037.1_4 Forward -226 -216 6.92787 0.237
NP_442317.1_2 Forward -389 -370 11.8975 0.176
NP_441633.1_3 Forward -226 -213 5.62415 0.0481
NP_441633.1_3 Reverse -213 -226 1.39592 0.109
NP_441633.1_5 Reverse -202 -221 19.1606 0.0982
NP_440136.1_2 Forward -223 -216 15.9687 0.0123
NP_440136.1_2 Reverse -216 -223 15.9687 0.0123
NP_441728.2_4 Reverse -128 -147 15.326 0.214
NP_442998.1_10 Forward -222 -215 15.5754 0.0102
NP_442998.1_10 Reverse -217 -224 15.5754 0.0102
NP_440299.1_1 Forward -228 -215 18.5049 0.00393
NP_440299.1_1 Reverse -211 -224 12.9984 0.0319
NP_441799.1_1 Reverse -211 -225 14.8469 0.0221
NP_441799.1_1 Forward -228 -214 3.44058 0.298
NP_441007.1_5 Reverse -216 -235 10.3242 0.22
NP_441007.1_10 Reverse -210 -223 8.37742 0.115
NP_442201.1_10 Forward -235 -216 -14.1602 0.28
NP_440256.1_1 Reverse -212 -231 12.9791 0.0106
NP_440087.1_1 Reverse -206 -225 0.0977854 0.167
NP_441362.1_2 Reverse -256 -275 6.9924 0.243
NP_440709.1_1 Forward -283 -264 2.35861 0.22
NP_441559.1_8 Forward -229 -215 3.44117 0.143
NP_440915.1_6 Forward -228 -214 12.1926 0.0218
NP_442158.1_2 Forward -119 -100 14.4666 0.276
NP_441704.1_8 Reverse -333 -352 5.30853 0.297
NP_440702.1_8 Forward -136 -117 10.4225 0.29
NP_440695.1_6 Reverse -269 -283 10.1205 0.269
NP_442993.1_1 Forward -224 -208 -8.98791 0.178
NP_442386.1_9 Forward -225 -216 15.7322 0.0144
NP_442386.1_9 Reverse -214 -223 13.8639 0.0289
NP_441340.1_5 Forward -223 -216 15.6737 0.0124
NP_441340.1_5 Reverse -216 -223 15.6737 0.0124
NP_441340.1_9 Forward -119 -109 7.00193 0.297
NP_442484.1_2 Reverse -77 -96 2.16274 0.226
NP_440168.1_9 Forward -226 -207 -2.16383 0.28
NP_440211.1_4 Reverse -316 -326 16.6963 0.21
NP_440586.1_8 Forward -223 -216 13.2151 0.026
NP_440586.1_8 Reverse -216 -223 13.2151 0.026
NP_442251.1_6 Forward -223 -216 15.2804 0.0124
NP_442251.1_6 Reverse -216 -223 15.2804 0.0124
NP_442959.1_5 Reverse -267 -286 9.43923 0.224
NP_440684.1_9 Reverse -209 -223 19.2725 0.0283
NP_441262.1_3 Reverse -215 -222 14.7888 0.0223
NP_441262.1_3 Forward -224 -217 14.7888 0.0223
NP_443051.1_1 Reverse -214 -223 10.4228 0.00754
NP_443051.1_1 Forward -225 -216 10.4228 0.00754
NP_439937.1_9 Reverse -214 -231 -8.61494 0.176
NP_441595.1_2 Reverse -261 -274 17.5368 0.252
NP_440439.1_1 Forward -227 -214 2.96921 0.122
NP_440439.1_1 Reverse -212 -225 0.0192843 0.203
NP_440372.1_2 Forward -223 -216 16.3621 0.0124
NP_440372.1_2 Reverse -216 -223 16.3621 0.0124
NP_440271.1_2 Reverse -349 -368 0.294447 0.292
NP_440819.1_5 Reverse -356 -364 7.8859 0.266
NP_439977.1_5 Forward -230 -211 5.211 0.15
NP_440139.1_1 Forward -230 -211 8.06178 0.118
NP_442384.1_10 Reverse -215 -228 19.4888 0.00338
NP_442384.1_10 Forward -224 -211 15.8506 0.00946
NP_440948.1_1 Forward -80 -61 11.5033 0.22
NP_442114.1_2 Forward -117 -98 0.392778 0.262
NP_442114.1_4 Reverse -215 -226 9.20345 0.17
NP_441877.1_7 Forward -229 -210 5.2102 0.218
NP_442790.1_4 Forward -233 -214 2.3594 0.0729
NP_442790.1_4 Reverse -206 -225 -15.7335 0.297
NP_442262.1_10 Forward -223 -216 14.1988 0.0123
NP_442262.1_10 Reverse -216 -223 14.1988 0.0123
NP_441689.1_5 Reverse -213 -223 15.3192 0.0403
NP_440163.1_10 Reverse -212 -222 10.4031 0.201
NP_440344.1_10 Forward -231 -214 11.8386 0.006
NP_441965.1_10 Forward -227 -211 10.6783 0.107
NP_440297.1_9 Forward -223 -213 9.32148 0.0917
NP_440297.1_9 Reverse -216 -226 -0.118297 0.282
NP_440350.1_1 Forward -177 -158 -1.86883 0.235
NP_440350.1_5 Reverse -34 -53 -2.45882 0.235
NP_441592.1_4 Forward -224 -205 -3.04881 0.274
NP_441896.1_3 Forward -233 -214 -3.04881 0.294
NP_442378.1_9 Forward -281 -262 13.175 0.246
NP_440999.1_9 Forward -228 -214 12.0943 0.0414
NP_440888.1_2 Reverse -215 -229 16.9119 0.00511
NP_440888.1_2 Forward -224 -210 14.8469 0.0144
NP_440600.1_4 Forward -232 -214 -6.96235 0.291
NP_440600.1_9 Forward -323 -304 11.6018 0.285
NP_442948.1_2 Reverse -214 -233 6.19431 0.244
NP_442077.1_9 Forward -284 -265 -6.78538 0.29
NP_441543.1_2 Reverse -216 -225 18.486 0.00236
NP_441543.1_2 Forward -223 -214 16.9127 0.00359
NP_442845.1_2 Reverse -209 -223 16.7159 0.0608
NP_442710.1_7 Reverse -267 -286 -4.05112 0.268
NP_442710.1_7 Reverse -319 -338 -7.31885 0.294
NP_441469.1_8 Forward -225 -216 16.126 0.00797
NP_441469.1_8 Reverse -214 -223 6.48957 0.227
NP_443064.1_6 Forward -224 -214 12.5669 0.0796
NP_442578.1_7 Forward -223 -216 14.5921 0.026
NP_442578.1_7 Reverse -216 -223 14.5921 0.026
NP_441462.1_2 Forward -224 -214 11.5831 0.00406
NP_441462.1_2 Reverse -215 -225 11.5831 0.00406
NP_443062.1_1 Forward -224 -206 5.5232 0.227
NP_443062.1_1 Reverse -215 -233 5.5232 0.227
NP_443062.1_6 Reverse -207 -226 1.27776 0.276
NP_440936.1_10 Forward -279 -260 -1.76702 0.241
NP_442204.1_1 Forward -228 -217 2.12362 0.266
NP_440454.1_2 Reverse -138 -152 19.8739 0.114
NP_440516.1_8 Forward -224 -215 16.9127 0.00442
NP_440516.1_8 Reverse -215 -224 16.9127 0.00442
NP_442428.1_5 Forward -223 -216 15.8704 0.0124
NP_442428.1_5 Reverse -216 -223 15.8704 0.0124
NP_441267.1_3 Forward -261 -243 6.21323 0.293
NP_440673.1_3 Forward -222 -215 12.4288 0.0426
NP_440673.1_3 Reverse -217 -224 12.4288 0.0426
NP_441052.1_2 Forward -224 -214 19.9412 0.00106
NP_441052.1_2 Reverse -215 -225 10.5014 0.0285
NP_442219.1_9 Forward -223 -214 17.7976 0.00718
NP_442219.1_9 Reverse -216 -225 8.35786 0.0681
NP_440436.1_4 Reverse -216 -225 18.1905 0.00233
NP_440436.1_4 Forward -223 -214 17.2072 0.00233
NP_441884.1_9 Forward -227 -208 -25.9599 0.29
NP_440314.1_9 Forward -223 -204 0.786102 0.0952
NP_439982.1_7 Forward -43 -24 16.7157 0.0576
NP_441719.1_4 Forward -223 -216 16.3621 0.0124
NP_441719.1_4 Reverse -216 -223 16.3621 0.0124
NP_441733.1_10 Reverse -212 -225 7.19745 0.156
NP_441004.1_1 Reverse -209 -228 -12.6852 0.25
NP_441004.1_2 Forward -87 -68 -3.04881 0.271
NP_442366.1_3 Forward -225 -207 -2.83245 0.234
NP_440129.1_10 Forward -231 -217 4.22782 0.185
NP_442873.1_2 Forward -238 -219 10.815 0.266
NP_442206.1_10 Reverse -215 -230 0.864876 0.243
NP_443054.1_2 Reverse -213 -227 3.14618 0.24
NP_442586.1_3 Forward -197 -181 20.708 0.058
NP_441851.1_2 Reverse -219 -238 1.17943 0.243
NP_441851.1_10 Forward -225 -215 16.008 0.00552
NP_441851.1_10 Reverse -214 -224 15.8113 0.00552
NP_441157.1_1 Reverse -143 -157 5.70218 0.235
NP_441668.1_4 Reverse -205 -224 2.16274 0.205
NP_442515.1_1 Forward -225 -211 11.3077 0.0416
NP_442515.1_1 Reverse -214 -228 4.71948 0.107
NP_440593.1_3 Forward -358 -339 -5.11376 0.258
NP_441982.1_6 Reverse -242 -251 13.0583 0.274
NP_442709.1_3 Reverse -208 -227 8.16093 0.121
NP_440338.1_4 Forward -22 -3 10.3234 0.219
NP_442689.1_8 Forward -153 -136 5.9387 0.155
NP_440432.1_9 Reverse -216 -231 -3.95334 0.194
NP_440474.1_8 Forward -223 -209 6.39049 0.227
NP_440396.1_10 Forward -223 -207 16.3807 0.151
NP_441150.1_6 Forward -356 -337 14.5516 0.251
NP_441477.1_10 Reverse -208 -226 4.6407 0.201
NP_440431.1_3 Reverse -214 -233 -3.44213 0.178
NP_442450.1_5 Reverse -213 -223 9.32148 0.115
NP_440588.1_2 Reverse -206 -225 -1.47551 0.155
NP_441078.1_4 Forward -224 -215 19.6659 0.0007
NP_441078.1_4 Reverse -215 -224 19.6659 0.0007
NP_442729.1_8 Reverse -211 -224 19.1938 0.0312
NP_442729.1_8 Forward -228 -215 9.06573 0.125
NP_441663.1_8 Forward -230 -211 -2.36049 0.266
NP_442443.1_1 Forward -84 -65 -5.50708 0.282
NP_440526.1_3 Forward -223 -212 0.943182 0.267
NP_441432.1_8 Reverse -214 -223 16.8143 0.00595
NP_441432.1_8 Forward -225 -216 8.25953 0.0755
NP_442320.1_8 Forward -230 -216 14.7492 0.0132
NP_442320.1_8 Reverse -209 -223 3.14618 0.0674
NP_441732.1_2 Forward -228 -212 -15.4778 0.147
NP_440760.1_1 Forward -224 -205 6.29264 0.0115
NP_440760.1_1 Forward -353 -334 -18.4868 0.214
NP_442797.1_2 Reverse -353 -371 17.4251 0.113
NP_440199.1_10 Reverse -212 -222 7.64985 0.231
NP_440578.1_10 Forward -217 -198 10.0292 0.278
NP_442353.1_4 Forward -230 -211 4.22689 0.205
NP_442489.1_7 Forward -224 -215 20.1576 0.000695
NP_442489.1_7 Reverse -215 -224 20.1576 0.000695
NP_440559.1_1 Forward -223 -214 17.4043 0.00658
NP_440559.1_1 Reverse -216 -225 8.75118 0.0586
NP_441659.2_8 Forward -224 -214 18.1713 0.00133
NP_441659.2_8 Reverse -215 -225 11.9764 0.0147
NP_442913.1_10 Forward -362 -343 -2.55715 0.187
NP_442346.1_5 Reverse -214 -224 16.6963 0.00248
NP_442346.1_5 Forward -225 -215 9.02648 0.118
NP_440352.1_4 Reverse -320 -334 18.728 0.154
NP_442603.1_7 Forward -224 -210 15.6336 0.0422
NP_442603.1_7 Reverse -215 -229 8.3571 0.176
NP_441888.1_7 Forward -229 -215 22.4191 0.0094
NP_441833.1_4 Forward -223 -216 15.9687 0.0124
NP_441833.1_4 Reverse -216 -223 15.9687 0.0124
NP_441329.1_6 Forward -59 -40 -3.1994 0.298
NP_441895.1_10 Reverse -261 -280 -9.63698 0.281
NP_442162.1_9 Forward -223 -216 16.2637 0.0124
NP_442162.1_9 Reverse -216 -223 16.2637 0.0124
NP_440788.1_8 Reverse -289 -308 6.09597 0.286
NP_440671.1_1 Forward -160 -141 4.88691 0.267
NP_442199.1_5 Forward -232 -213 -3.24547 0.201
NP_442140.1_3 Reverse -216 -226 14.238 0.0486
NP_442140.1_3 Forward -223 -213 4.40493 0.243
NP_440875.1_9 Reverse -217 -227 8.46937 0.233
NP_441813.1_5 Forward -226 -216 19.4496 0.00647
NP_441813.1_5 Reverse -213 -223 15.9097 0.01
NP_442028.1_1 Reverse -52 -65 7.70113 0.289
NP_440590.1_4 Reverse -216 -229 13.0973 0.013
NP_440590.1_4 Forward -223 -210 -5.97891 0.296
NP_440567.1_1 Forward -223 -209 8.84938 0.0528
NP_440567.1_1 Reverse -216 -230 6.6861 0.0816
NP_442497.1_10 Forward -223 -214 10.4228 0.0087
NP_442497.1_10 Reverse -216 -225 10.4228 0.0087
NP_440821.1_4 Reverse -213 -223 18.2696 0.00448
NP_440821.1_4 Forward -226 -216 10.2065 0.0163
NP_441239.1_9 Forward -226 -214 14.1986 0.0288
NP_441239.1_9 Reverse -213 -225 6.92215 0.173
NP_442568.1_1 Forward -282 -263 2.9486 0.267
NP_441727.1_3 Forward -231 -212 6.29264 0.244
NP_442627.1_4 Reverse -252 -270 16.1401 0.262
NP_440624.1_5 Forward -285 -267 9.88474 0.222
NP_441508.1_1 Reverse -265 -284 19.0152 0.0922
NP_441017.1_6 Forward -228 -214 11.9953 0.232
NP_441541.1_1 Reverse -252 -270 -4.19966 0.272
NP_440212.1_9 Forward -285 -266 2.09897 0.252
NP_440949.1_7 Forward -232 -213 12.3883 0.214
NP_440354.1_7 Reverse -152 -170 8.57394 0.236
NP_440546.1_4 Reverse -215 -225 11.8882 0.0679
NP_440546.1_4 Forward -224 -214 10.046 0.109
NP_440462.1_6 Forward -226 -216 17.2863 0.00752
NP_440462.1_6 Reverse -213 -223 7.74818 0.0699
NP_442899.1_1 Forward -258 -240 10.0489 0.253
NP_440868.1_4 Reverse -211 -223 8.10212 0.0602
NP_440868.1_4 Forward -228 -216 3.48056 0.135
NP_441204.1_1 Forward -233 -214 6.39097 0.263
NP_441497.1_4 Forward -153 -136 18.6234 0.23
NP_442499.1_3 Forward -225 -207 6.70565 0.282
NP_442479.1_5 Forward -115 -96 9.01884 0.222
NP_441868.1_2 Forward -364 -345 12.3892 0.246
NP_440638.2_10 Reverse -270 -287 18.2301 0.103
NP_440812.1_4 Forward -395 -376 13.0855 0.25
NP_442358.1_1 Reverse -207 -225 16.5388 0.152
NP_442882.1_6 Reverse -277 -294 18.8193 0.0693
NP_442039.1_4 Forward -223 -216 15.1821 0.0124
NP_442039.1_4 Reverse -216 -223 15.1821 0.0124
NP_441811.1_8 Reverse -209 -223 5.99778 0.289
NP_442829.1_2 Reverse -257 -273 12.4896 0.287
NP_441926.1_3 Forward -224 -208 6.45005 0.17
NP_442786.1_6 Forward -277 -264 18.2553 0.232
NP_442837.1_3 Forward -223 -216 15.7721 0.0124
NP_442837.1_3 Reverse -216 -223 15.7721 0.0124
NP_439994.1_4 Forward -369 -350 8.94757 0.291
NP_442053.1_1 Forward -224 -215 18.3876 0.0007
NP_442053.1_1 Reverse -215 -224 18.3876 0.0007
NP_440505.1_3 Reverse -213 -223 16.303 0.00696
NP_440505.1_3 Forward -226 -216 15.9097 0.00857
NP_442532.1_7 Reverse -215 -229 5.89945 0.171
NP_440914.1_1 Forward -224 -214 17.5935 0.000537
NP_440914.1_1 Reverse -215 -225 8.6151 0.186
NP_441011.1_8 Reverse -216 -225 16.9127 0.00602
NP_441011.1_8 Forward -223 -214 8.25953 0.144
NP_441011.1_8 Forward -307 -298 7.57121 0.17
NP_442533.1_6 Forward -224 -215 17.2076 0.00137
NP_442533.1_6 Reverse -215 -224 17.2076 0.00137
NP_440854.1_6 Reverse -260 -279 14.1801 0.26
NP_441482.1_7 Forward -230 -216 5.01447 0.0426
NP_441482.1_7 Reverse -209 -223 -3.44199 0.124
NP_439944.1_9 Forward -223 -213 19.0562 0.00329
NP_442203.1_3 Forward -345 -326 7.46992 0.257
NP_441697.1_5 Forward -286 -267 0.90675 0.191
NP_441697.1_5 Forward -285 -266 -10.3613 0.278
NP_441697.1_5 Forward -117 -98 -11.4117 0.295
NP_442664.1_10 Forward -352 -333 14.9458 0.213
NP_441527.1_4 Reverse -251 -270 -8.16498 0.241
NP_441527.1_4 Reverse -248 -267 -11.6027 0.284
NP_441527.1_4 Reverse -238 -257 -12.2711 0.285
NP_441527.1_7 Forward -268 -249 10.52 0.282
NP_443045.1_2 Forward -359 -340 13.5691 0.287
NP_441602.1_3 Reverse -210 -229 -3.44213 0.246
NP_441106.1_1 Forward -225 -216 18.191 0.0028
NP_441106.1_1 Reverse -214 -223 9.63616 0.0311
NP_441106.1_3 Forward -151 -132 18.6823 0.0578
NP_439903.1_6 Forward -227 -208 4.52188 0.193
NP_439903.1_6 Reverse -206 -225 -0.886293 0.287
NP_441186.1_4 Reverse -143 -153 16.1058 0.223
NP_441286.1_1 Forward -225 -213 11.8387 0.0114
NP_441286.1_1 Reverse -214 -226 6.03717 0.0258
NP_442674.1_2 Forward -348 -329 8.06259 0.262
NP_440670.1_8 Forward -224 -215 18.3876 0.000699
NP_440670.1_8 Reverse -215 -224 18.3876 0.000699
NP_441930.1_3 Reverse -246 -265 4.79098 0.266
NP_440886.1_7 Forward -225 -215 17.7774 0.0011
NP_440886.1_7 Reverse -214 -224 7.94438 0.0805
NP_442072.1_9 Reverse -214 -232 -23.0886 0.277
NP_439899.1_1 Reverse -261 -279 7.20476 0.205
NP_440907.2_8 Reverse -216 -226 7.94438 0.117
NP_440841.1_4 Reverse -213 -232 -5.80207 0.208
NP_441463.1_2 Forward -153 -135 18.6315 0.0462
NP_441463.1_3 Forward -234 -215 -6.29373 0.243
NP_441463.1_3 Forward -318 -299 -10.4236 0.294
NP_441463.1_6 Reverse -213 -227 5.73949 0.287
NP_442842.1_10 Reverse -25 -44 0.562511 0.264
NP_441626.1_2 Forward -223 -216 15.7721 0.0124
NP_441626.1_2 Reverse -216 -223 15.7721 0.0124
NP_442365.1_7 Reverse -211 -230 0.294447 0.177
NP_442365.1_7 Forward -228 -209 -1.47551 0.191
NP_441460.1_2 Reverse -112 -125 19.1932 0.0556
NP_442794.1_1 Forward -228 -216 7.61046 0.136
NP_442794.1_1 Reverse -211 -223 7.02048 0.152
NP_441962.1_4 Reverse -210 -229 -9.63698 0.218
NP_441962.1_4 Forward -229 -210 -10.1286 0.224
NP_440387.1_1 Forward -224 -208 22.3797 0.00192
NP_440387.1_1 Reverse -215 -231 0.648521 0.122
NP_441836.1_2 Forward -230 -211 -4.6221 0.261
NP_441993.1_1 Reverse -209 -228 0.484826 0.298
NP_440114.1_10 Forward -224 -210 5.80112 0.292
NP_440766.1_4 Reverse -346 -360 0.491246 0.28
NP_440766.1_5 Reverse -262 -274 7.27382 0.29
NP_439910.1_2 Forward -232 -215 -21.9873 0.202
NP_440457.1_1 Forward -228 -216 6.33216 0.123
NP_440457.1_1 Reverse -211 -223 -0.0593532 0.25
NP_442680.1_5 Reverse -242 -261 1.04913 0.254
NP_442509.1_9 Reverse -215 -225 16.2041 0.00739
NP_442509.1_9 Forward -224 -214 8.14104 0.192
NP_441489.1_3 Reverse -260 -274 7.84196 0.244
NP_440554.1_4 Reverse -216 -226 16.4996 0.0189
NP_440554.1_4 Forward -223 -213 7.05986 0.106
NP_441885.1_5 Forward -224 -214 20.9245 0.000538
NP_441885.1_5 Reverse -215 -225 11.4848 0.00668
NP_440478.1_10 Forward -226 -212 6.58777 0.288
NP_442341.1_7 Forward -225 -211 13.6676 0.0334
NP_442341.1_7 Reverse -214 -228 12.1926 0.0467
NP_442341.1_9 Forward -226 -212 10.3237 0.135
NP_441756.1_5 Reverse -118 -137 -3.04881 0.287
NP_442395.2_4 Reverse -214 -233 2.16195 0.224
NP_440191.1_4 Forward -363 -353 12.9542 0.282
NP_440750.1_5 Reverse -257 -271 4.22782 0.294
NP_440423.1_6 Reverse -207 -226 -6.78538 0.138
NP_443000.1_7 Reverse -213 -223 17.0896 0.00865
NP_443000.1_7 Forward -226 -216 11.5831 0.0344
NP_440552.1_8 Reverse -133 -150 21.5378 0.0101
NP_440552.1_8 Forward -279 -262 20.3919 0.0199
NP_441842.1_10 Forward -231 -217 6.78443 0.272
NP_440275.1_3 Forward -226 -216 15.418 0.0178
NP_440275.1_3 Reverse -213 -223 8.1415 0.0602
NP_440091.1_1 Reverse -211 -223 -0.452677 0.273
NP_443010.1_10 Reverse -364 -381 8.56882 0.16
NP_440175.1_4 Reverse -207 -226 -12.7836 0.237
NP_442606.1_1 Forward -359 -340 23.1063 0.00741
NP_442606.1_3 Forward -103 -84 25.9588 0.00743
NP_441105.1_3 Forward -235 -216 11.2092 0.0372
NP_440216.1_1 Reverse -215 -229 7.27608 0.00942
NP_440216.1_1 Forward -224 -210 -10.7185 0.146
NP_440172.1_1 Forward -224 -214 15.0247 0.00945
NP_440172.1_1 Reverse -215 -225 8.73149 0.0586
NP_440390.1_1 Forward -157 -138 13.6675 0.255
NP_442015.1_10 Forward -228 -215 12.8023 0.0365
NP_442015.1_10 Reverse -211 -224 0.412608 0.227
NP_441226.1_7 Forward -223 -216 14.4934 0.0123
NP_441226.1_7 Reverse -216 -223 14.4934 0.0123
NP_441111.1_7 Forward -223 -215 18.7023 0.00294
NP_441111.1_7 Reverse -216 -224 18.7023 0.00294
NP_442379.1_10 Reverse -208 -225 -1.23946 0.223
NP_441766.1_2 Forward -224 -215 17.5026 0.00297
NP_441766.1_2 Reverse -215 -224 17.5026 0.00297
NP_442417.1_5 Reverse -215 -229 19.7641 0.0165
NP_442116.1_6 Reverse -257 -274 11.3202 0.199
NP_442116.1_6 Forward -273 -256 9.69683 0.227
NP_442116.1_6 Forward -274 -257 9.41035 0.227
NP_442116.1_6 Reverse -258 -275 8.64641 0.244
NP_442116.1_6 Forward -285 -268 5.49518 0.296
NP_440591.1_9 Reverse -208 -226 3.95239 0.294
NP_440261.1_5 Forward -223 -210 -10.4038 0.201
NP_440261.1_5 Reverse -216 -229 -11.9771 0.268
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTATTGCTAGGCAAAGTAAGGATAGGGATCTTCGCTTTTGCCCGGTTTCAATTGCCAAAACTAATTAGTTTATTAATTGTGCCATCTAATTTGTTATCCCCTACCATTCTGGCAAATAGCTTAACAATTTTTTTCAAATACTTGCTTTTTTTTAACTAGCTCCGAGAATTACTCCGGCGATCGCCATAATCTCATTAGCTAGAAAACTAGGAGTGCCTAACAACAGACTTACCCGGATGGAGTTACAGTTTTGTTAAGATTAGTTACAGGTTAATCCGGCAGGGAAAAGTTAATATTCTTGACGACATTGCAAGAACGGTCGAGTTAATGCCACATAACAAATTAAATGTAGTAGACAAAGAACAGAGTTAGGATACAAACCTTGAAATACCATCTACC

CDS

ATGGAGCACAAGCCAAACGAGTTTGTGAAACGAGCCATGAAAATCGATATCATTATTGTCTACATTCAGCGATATCGAAAGGGACATGAGGTTCATTTTGTCCCGCCGCTGACTGGTATCCATCTTGCTGCCCTGACCCCGGCAAAACATACTGTTCGAGTTATTCACCAACAGGTTGAAACCGTAAATCTAGACAGCGAAGCTGATGTAATTGTCCTCTCCTTCTTCAGTGGTTTTGCCCCGGAAGCATATCGCTTAGCAACGGAATATCGAAAACGGGGCAAGATAACAATCGCGGGTGGTCCTCATGTAACTTTTGCCCCAGAGGAAGCTCTGAGATTTGTGGATAGTATTGTCATCGGCGAAGGGGAGTCGGTCTGGGAGCAAATTTTCCAAGATATCGAACAGAACACTCTTCAGCAGCGATATATTGGTGAAGCAATTCCCCTCACAAATATCCCCACTCCCCGGTACGACCTGTTACCTCCGCAGTACTTCATTCGACGGGTTGTTCAAGCCACTAGAGGATGTCCATTTACCTGCTCATTCTGCACTGTACCCGTTCTCAATCCCGGCTTTCGTACTCGCCCTGTCGAGGCGGTGCTGAACGACATCCGATACAACAAATTCAAATGGTGGTGGCAACGAAAAACTGTCTGGTTTTGGGATGATAATTTGACGGCAAATAGACCCTATATCAAAGAACTTCTGCGCCAGATGATACCCCTGCGAAAGTGGTGGTTGACCCAAGCAAGTATGGATATTACCAAGGATGACGAGCTGTTAGATTTAATGCGAGACTCTGGTTGCATCGGAATTTTTTTCGGGATTGAGTCATTTGGCCAGGAATCCTTGGAGGATGCGGGAAAACGCCAAAACAAAGTCGCAGAATATCAAGGCAAAATCAAAAAATTGCATGACCGTGGCATTGGCGTGATGGCTGGTTTTATTTCCGGTTTGGATGGAGATACCCCAGAAAGCATCCGGGATATGGCCAACCAACTGGAGGAAATTGGTGTTGATGTGCCATTTTTGAGCATTCTTACTCCTTTTAAAGGCACGCGTTCATACTCAAAGATGATGGATACGGATCGGTTGCGTTCGGATTTGGGGTGGGAGTTTTACAATGGCTATAATGTCACATTCGTGCCCAGTAAAATGACCCCTGCAGAGCTTTTAAAAGCCCACCGAGATTTGTGGAGATCAGCCTTTAGCCTGCAAGCAATCTTTCGTCGGATTGGTAGATCCTTATTTACTTTGCGCGGGGGGGCAATGATGATGTGTAGCATCATGAATCTCTTCTACGGGCTAAAAGCTCTCACAAATAATGAACCGATTAGCTTTGAAGGAACGGATGAATATAAATCAATTCGGGAAACTATCGATTTGATTCCATACAGTCGCCAGAATTCACTAAGTTGA

Protein

MEHKPNEFVKRAMKIDIIIVYIQRYRKGHEVHFVPPLTGIHLAALTPAKHTVRVIHQQVETVNLDSEADVIVLSFFSGFAPEAYRLATEYRKRGKITIAGGPHVTFAPEEALRFVDSIVIGEGESVWEQIFQDIEQNTLQQRYIGEAIPLTNIPTPRYDLLPPQYFIRRVVQATRGCPFTCSFCTVPVLNPGFRTRPVEAVLNDIRYNKFKWWWQRKTVWFWDDNLTANRPYIKELLRQMIPLRKWWLTQASMDITKDDELLDLMRDSGCIGIFFGIESFGQESLEDAGKRQNKVAEYQGKIKKLHDRGIGVMAGFISGLDGDTPESIRDMANQLEEIGVDVPFLSILTPFKGTRSYSKMMDTDRLRSDLGWEFYNGYNVTFVPSKMTPAELLKAHRDLWRSAFSLQAIFRRIGRSLFTLRGGAMMMCSIMNLFYGLKALTNNEPISFEGTDEYKSIRETIDLIPYSRQNSLS