Your browser is old and dusty. Try Google Chrome!

Details for slr0303

ORF slr0303
Accession NP_442599.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Reverse -82 -101 10.074 0.214
NP_441453.1_7 Forward -355 -348 11.6422 0.298
NP_441098.1_3 Reverse -10 -29 -2.7694 0.28
NP_441098.1_3 Reverse -298 -317 -4.49207 0.28
NP_441098.1_3 Forward -110 -91 -6.59756 0.28
NP_441098.1_3 Forward -39 -20 -7.17178 0.285
NP_442975.1_10 Reverse -133 -147 1.5723 0.296
NP_442062.1_3 Forward -118 -99 -1.47551 0.259
NP_442972.1_2 Reverse -240 -254 19.3701 0.108
NP_441581.1_9 Forward -27 -8 5.1084 0.296
NP_440916.1_1 Reverse -135 -149 12.291 0.206
NP_440769.1_8 Forward -111 -92 12.2908 0.161
NP_440769.1_8 Forward -273 -254 8.06259 0.246
NP_441434.1_1 Forward -260 -246 8.60589 0.254
NP_441738.1_2 Forward -395 -388 8.29857 0.176
NP_440331.1_5 Reverse -296 -315 -8.65367 0.142
NP_441716.1_2 Reverse -82 -101 0.293125 0.264
NP_441716.1_2 Reverse -83 -102 -1.62095 0.289
NP_441327.1_1 Reverse -82 -101 9.30716 0.205
NP_441327.1_1 Forward -102 -83 8.05774 0.225
NP_441327.1_1 Reverse -253 -272 3.54061 0.277
NP_441327.1_5 Forward -292 -283 16.2243 0.164
NP_442111.1_3 Reverse -89 -102 12.1892 0.294
NP_440851.1_3 Forward -109 -90 2.3594 0.248
NP_442973.1_5 Reverse -139 -158 10.3242 0.287
NP_442145.1_4 Reverse -11 -30 2.62561 0.299
NP_440057.1_5 Forward -140 -121 11.8967 0.297
NP_440580.1_9 Forward -333 -314 13.9625 0.161
NP_441846.1_10 Forward -351 -332 -22.125 0.257
NP_440360.1_9 Reverse -116 -135 5.99764 0.278
NP_442599.1_4 Forward -362 -343 20.944 0.0672
NP_442599.1_10 Forward -337 -318 22.7139 0.0143
NP_440184.1_1 Reverse -76 -95 4.79023 0.22
NP_442690.1_1 Forward -101 -82 -2.95047 0.142
NP_442690.1_1 Forward -102 -83 -8.16202 0.183
NP_442690.1_1 Reverse -92 -111 -11.8003 0.233
NP_442690.1_1 Reverse -80 -99 -12.1936 0.241
NP_442911.1_1 Forward -105 -92 14.672 0.291
NP_441654.1_5 Forward -240 -221 14.2356 0.252
NP_441654.1_6 Reverse -251 -269 19.4823 0.101
NP_440569.1_10 Forward -112 -93 2.14815 0.296
NP_439966.1_9 Reverse -42 -51 3.83464 0.253
NP_441514.1_1 Forward -104 -94 14.2496 0.274
NP_441079.1_7 Forward -263 -244 -2.55791 0.22
NP_441566.1_3 Forward -155 -136 16.0274 0.198
NP_441071.1_2 Forward -263 -244 13.3207 0.291
NP_442933.1_2 Reverse -77 -95 6.30445 0.274
NP_442933.1_6 Forward -22 -3 14.5621 0.284
NP_442970.1_1 Forward -249 -235 17.4866 0.269
NP_442970.1_3 Forward -100 -82 11.925 0.255
NP_442476.1_1 Forward -243 -224 15.0396 0.225
NP_441731.1_1 Forward -111 -93 12.225 0.292
NP_442719.1_2 Reverse -225 -243 -8.63467 0.252
NP_442227.1_2 Forward -363 -344 -3.24547 0.29
NP_441849.1_2 Reverse -96 -115 1.4797 0.25
NP_442692.1_10 Reverse -235 -248 16.229 0.216
NP_440630.1_1 Forward -260 -241 6.29264 0.263
NP_441534.1_5 Forward -110 -91 4.71934 0.293
NP_441557.1_8 Reverse -335 -345 10.796 0.275
NP_442267.1_4 Forward -357 -338 5.11266 0.198
NP_441433.1_8 Reverse -343 -362 -4.13045 0.289
NP_441458.1_8 Reverse -50 -69 7.28984 0.229
NP_441458.1_8 Forward -243 -224 5.65597 0.259
NP_441458.1_8 Reverse -16 -35 2.77268 0.293
NP_441819.1_5 Forward -103 -84 9.88299 0.261
NP_441819.1_5 Forward -102 -83 9.59652 0.262
NP_442594.1_8 Forward -352 -333 9.14423 0.199
NP_442594.1_10 Reverse -316 -335 9.83173 0.28
NP_442998.1_5 Forward -291 -281 10.7964 0.204
NP_441296.1_9 Reverse -336 -349 10.7368 0.251
NP_441866.1_4 Reverse -225 -238 14.7038 0.273
NP_441866.1_4 Reverse -260 -273 13.8285 0.273
NP_440306.1_8 Forward -178 -159 -1.96793 0.241
NP_441494.1_6 Forward -148 -135 5.91914 0.292
NP_441340.1_9 Forward -105 -95 9.60492 0.236
NP_440146.1_1 Forward -101 -83 18.05 0.0978
NP_439976.1_5 Reverse -314 -328 12.3887 0.257
NP_443051.1_5 Forward -386 -367 4.71934 0.273
NP_443051.1_5 Forward -70 -51 3.44104 0.298
NP_443051.1_9 Reverse -320 -334 13.7659 0.265
NP_441604.1_4 Forward -357 -338 -4.91709 0.247
NP_441877.1_9 Forward -30 -13 7.90532 0.244
NP_442165.1_5 Forward -269 -250 20.4523 0.0355
NP_440350.1_5 Forward -196 -177 6.68596 0.134
NP_442280.1_10 Forward -360 -342 14.3179 0.13
NP_442454.1_2 Reverse -247 -266 9.31004 0.291
NP_441304.1_10 Forward -64 -55 12.5861 0.297
NP_442710.1_7 Forward -231 -212 -1.9367 0.231
NP_440255.1_7 Forward -384 -367 9.57695 0.277
NP_442780.1_3 Reverse -221 -240 9.02356 0.249
NP_440314.1_1 Forward -234 -215 10.1275 0.253
NP_441733.1_10 Reverse -385 -398 6.70579 0.176
NP_439949.1_7 Forward -337 -323 10.6193 0.291
NP_440508.1_2 Reverse -94 -113 17.7348 0.234
NP_442689.1_8 Forward -98 -81 -6.84433 0.289
NP_442689.1_8 Reverse -84 -101 -8.41762 0.294
NP_439960.1_10 Reverse -340 -358 -3.81576 0.282
NP_441124.1_5 Forward -105 -95 14.2496 0.215
NP_440431.1_3 Forward -115 -96 -9.34199 0.244
NP_440431.1_4 Reverse -178 -197 -7.01908 0.262
NP_440431.1_4 Forward -67 -48 -9.02441 0.275
NP_440431.1_7 Forward -199 -180 10.8159 0.0785
NP_439950.1_1 Forward -336 -327 12.1928 0.296
NP_440040.1_8 Reverse -175 -194 9.50102 0.203
NP_443024.1_3 Reverse -42 -52 14.238 0.255
NP_441022.1_1 Reverse -92 -101 13.2728 0.216
NP_441968.1_1 Reverse -179 -187 15.162 0.257
NP_441329.1_6 Forward -275 -256 1.67069 0.232
NP_441329.1_6 Forward -289 -270 -1.67153 0.293
NP_440912.1_3 Forward -220 -201 10.3234 0.254
NP_442045.1_7 Reverse -289 -308 4.62101 0.212
NP_442073.1_8 Forward -90 -71 18.0915 0.0921
NP_442669.1_1 Reverse -292 -311 30.3837 0.00000828
NP_442669.1_1 Reverse -354 -373 3.04771 0.17
NP_440219.1_1 Reverse -11 -30 13.4144 0.254
NP_441874.1_1 Forward -254 -240 8.55439 0.298
NP_440900.1_4 Forward -52 -33 17.1159 0.271
NP_442216.1_4 Forward -396 -388 8.1805 0.255
NP_442216.1_4 Reverse -337 -345 8.08217 0.255
NP_440374.1_3 Forward -240 -222 20.3418 0.0996
NP_442479.1_9 Reverse -33 -52 -2.85214 0.227
NP_440812.1_1 Reverse -335 -354 1.47442 0.267
NP_442402.1_2 Forward -172 -158 16.9119 0.263
NP_440036.1_9 Reverse -346 -359 18.9972 0.191
NP_441848.1_4 Forward -270 -254 9.84247 0.269
NP_441848.1_4 Forward -109 -93 8.79206 0.288
NP_441848.1_4 Forward -239 -223 7.35968 0.29
NP_441848.1_5 Forward -268 -249 14.3516 0.22
NP_442360.1_2 Reverse -345 -358 21.6514 0.0215
NP_441959.1_8 Forward -238 -225 12.4691 0.286
NP_441959.1_8 Reverse -272 -285 12.3727 0.286
NP_441959.1_8 Reverse -85 -98 10.6374 0.286
NP_441959.1_8 Reverse -64 -77 8.70929 0.286
NP_442532.1_4 Forward -152 -134 7.48014 0.297
NP_442541.1_10 Forward -54 -40 18.4851 0.182
NP_441697.1_5 Reverse -80 -99 -7.87851 0.251
NP_441697.1_5 Reverse -93 -112 -8.45146 0.26
NP_441697.1_5 Forward -272 -253 -9.97933 0.278
NP_441697.1_5 Reverse -243 -262 -11.5072 0.295
NP_441527.1_4 Forward -275 -256 15.135 0.0458
NP_441527.1_4 Reverse -116 -135 4.15348 0.111
NP_441527.1_4 Reverse -183 -202 -10.4568 0.27
NP_441527.1_4 Reverse -176 -195 -10.4568 0.27
NP_441527.1_4 Forward -274 -255 -11.9847 0.285
NP_440083.1_9 Forward -295 -276 11.1637 0.281
NP_440404.1_9 Reverse -123 -142 8.35512 0.25
NP_441463.1_2 Reverse -257 -275 -1.26321 0.293
NP_442805.1_5 Forward -172 -153 -6.49113 0.284
NP_440935.1_6 Forward -140 -123 14.9489 0.0755
NP_441853.1_5 Reverse -353 -372 0.491109 0.279
NP_440492.1_10 Reverse -260 -274 17.0959 0.275
NP_442930.1_1 Reverse -92 -102 15.1225 0.202
NP_442930.1_1 Reverse -93 -103 11.091 0.26
NP_442867.1_8 Forward -364 -345 5.50599 0.276
NP_441801.1_4 Reverse -338 -348 3.02829 0.231
NP_442680.1_5 Forward -335 -316 9.84127 0.134
NP_442680.1_5 Forward -279 -260 8.47361 0.165
NP_441332.1_4 Reverse -356 -375 5.60432 0.261
NP_442936.1_5 Reverse -257 -276 14.4541 0.0782
NP_442936.1_10 Forward -264 -250 17.8772 0.216
NP_442514.1_5 Reverse -339 -358 -2.95123 0.222
NP_440628.1_1 Reverse -177 -187 15.0317 0.248
NP_442703.1_8 Forward -371 -353 11.9164 0.265
NP_441173.1_9 Forward -167 -159 9.75379 0.284
NP_440750.1_5 Forward -272 -258 7.07942 0.234
NP_440552.1_5 Reverse -100 -119 17.9207 0.174
NP_440560.1_5 Reverse -97 -116 10.2934 0.265
NP_442638.1_3 Forward -66 -47 14.3711 0.275
NP_441635.1_1 Forward -270 -251 7.4002 0.236
NP_441207.1_7 Reverse -182 -196 13.2247 0.229
NP_440258.1_7 Reverse -270 -289 11.7928 0.287
NP_442116.1_6 Forward -23 -6 12.7526 0.172
NP_442116.1_6 Reverse -84 -101 9.60133 0.227
NP_442046.1_2 Reverse -251 -264 15.1482 0.248
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCCTAAATCCCCACTTAACAAGGGAGACTTTTCTGACAGTTCCTCCCTTGGGCAGGGGAGTTAGGAGGGATTAAACAGCCAGAATTCAACTTTCCAAACAGGCTCTAAGGGATAAATTTAGAGTAAATAAAGTCAGAAAAAATATTTTTGATTTGGTGGATAATTAGTCAAAATTTATACAGTTATTGATGTAATAATTGGAACTATTATTGTTTTTCTTGTTGACTCACATTTCTCCACAACGCTATAATCTGGGGGCAACTTTATTTTCTACTATCCATTTTAAAGAATGGTTAGGAAAATTTTTTATTAAAATCTATTCAATCTAGAATAAAAAGGGTAATTTACCAATTCCAGCTCAATTATTGAATTATTAAATTTCTAAACATTAACTTCACT

CDS

ATGACCTATCTGCAAACCACCGCCGACTTTTACGCTGAAGTTGCCCAGACCCCAGAAGTGGGACTCTGTTGTGTTCAGAGTAGCCCTCTCCAACTGCCGGGGTTAGTGATTCCCGCTGTCATGCAGGAAATGAATTATGGCTGTGGTAGCACCGTCCATCCCAACGAGTTGGGTAATAAGTCTAAGGTGCTTTATGTCGGTGTTGGTGGTGGTCTGGAGGCATTGCAATTTGCCTATTTTTGCCGTCAGCCAGGGGCCGTGATCGCAGTGGATCCCGTGGAAGCCATGCGCCAGGCCGCCCAGCGAAATTTGCAGTTAGCCGCCGAAAAAAATGATTGGTTTAGTGTCGATTTTGTCGATATTCGTGCAGGGGATGCTTTTACTTTGCCGGTGCCGGACAACTCGGTAGATGTGGTGGCACAAAATTGCCTATTTAATATTTTTGAGCCGGAAGATTTATCCCGAGCTTTGAAGGAAGCTTATCGGGTTCTAAAACCCCATGGTCGGTTAATCATGAGTGATCCCATTGCTGCCCGGCCTATTCCCCAACATTTGCGTCAGGACGAACGGTTACGGGCCATGTGTTTATCCGGAGCATTAACCTATGCAGAATACATTCAACATTTAATTGATACTGGTTTTGGGCAAATAGAAATTCGCGCCCGCCGTCCCTATCGTTTGCTCGATTCTGTCACCTATAAACTGGATGAAAATTTATTATTAGAAAGTTTAGATTCCGTTTCTTTCAAAGTGCCTATTCCTAGTGATGGAGCCTGTGTTTTTACTGGCAAAACCGCTATTTATGCTGGTTCAGACCCCCTATTCGATGACCAAGCTGGCCATATTCTTCAGCAGGGAGTTCCTAGTGCGGTATGCGATAAAACAGCGTTGAACTTAGGTTCTACCTATCCAAACAAAATACTCATCACTGATTCAACTTGGTACTATGACGGTGGCGGCTGTTGTTGA

Protein

MTYLQTTADFYAEVAQTPEVGLCCVQSSPLQLPGLVIPAVMQEMNYGCGSTVHPNELGNKSKVLYVGVGGGLEALQFAYFCRQPGAVIAVDPVEAMRQAAQRNLQLAAEKNDWFSVDFVDIRAGDAFTLPVPDNSVDVVAQNCLFNIFEPEDLSRALKEAYRVLKPHGRLIMSDPIAARPIPQHLRQDERLRAMCLSGALTYAEYIQHLIDTGFGQIEIRARRPYRLLDSVTYKLDENLLLESLDSVSFKVPIPSDGACVFTGKTAIYAGSDPLFDDQAGHILQQGVPSAVCDKTALNLGSTYPNKILITDSTWYYDGGGCC