Your browser is old and dusty. Try Google Chrome!

Details for slr0298

ORF slr0298
Accession NP_442594.1
Symbol
Category Other
Definition FraH protein homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -395 -381 -0.393733 0.228
NP_440795.1_7 Reverse -382 -389 11.3472 0.0978
NP_442272.1_2 Forward -213 -194 16.9494 0.15
NP_440897.1_6 Reverse -140 -159 2.35861 0.165
NP_441453.1_4 Reverse -381 -389 7.19758 0.0757
NP_441453.1_4 Forward -390 -382 4.93597 0.224
NP_441453.1_7 Forward -259 -252 14.1988 0.175
NP_441453.1_7 Reverse -133 -140 12.9205 0.23
NP_441960.1_3 Reverse -341 -360 13.1279 0.291
NP_441818.1_9 Forward -104 -85 -2.65548 0.208
NP_442173.1_1 Forward -389 -381 5.62429 0.206
NP_442173.1_1 Reverse -382 -390 4.73931 0.258
NP_442752.1_4 Reverse -381 -388 10.8555 0.0846
NP_442752.1_4 Reverse -179 -186 10.8555 0.0846
NP_443027.1_4 Forward -392 -382 8.33817 0.207
NP_439997.1_3 Reverse -326 -345 11.1109 0.214
NP_440784.1_7 Forward -389 -382 12.4288 0.0475
NP_440784.1_7 Reverse -382 -389 6.23397 0.241
NP_440061.1_9 Forward -392 -378 15.3386 0.0468
NP_441054.1_2 Forward -122 -103 9.83255 0.284
NP_441476.1_5 Reverse -376 -395 -5.70374 0.267
NP_440878.1_9 Forward -165 -146 2.85105 0.174
NP_442062.1_8 Reverse -381 -391 7.45319 0.0985
NP_442062.1_8 Forward -390 -380 4.79825 0.198
NP_440304.1_4 Reverse -379 -389 16.303 0.0205
NP_440011.1_1 Forward -105 -86 12.4875 0.264
NP_441723.1_1 Forward -348 -331 14.9851 0.243
NP_440132.1_6 Reverse -154 -173 18.9773 0.0526
NP_440856.1_7 Forward -301 -282 -3.44213 0.199
NP_441083.1_5 Reverse -381 -391 0.865012 0.218
NP_441083.1_5 Forward -390 -380 0.176696 0.241
NP_441558.1_5 Reverse -379 -398 3.93269 0.294
NP_441942.1_5 Reverse -124 -143 15.1424 0.146
NP_440209.1_1 Reverse -381 -389 8.37755 0.0576
NP_440209.1_1 Reverse -179 -187 5.0343 0.194
NP_440447.1_5 Forward -260 -250 15.418 0.277
NP_441713.1_1 Reverse -375 -394 -6.58872 0.12
NP_441713.1_5 Reverse -288 -307 8.16093 0.255
NP_442570.1_3 Forward -398 -379 -8.55534 0.288
NP_442570.1_8 Forward -113 -95 12.8022 0.179
NP_441716.1_1 Reverse -179 -193 4.12949 0.258
NP_442111.1_4 Forward -391 -377 10.226 0.0553
NP_440343.1_3 Forward -155 -137 4.14829 0.266
NP_440906.1_5 Forward -187 -180 8.79057 0.149
NP_440906.1_5 Reverse -382 -389 6.23397 0.234
NP_440906.1_5 Forward -389 -382 6.0373 0.262
NP_440747.1_10 Forward -393 -381 -2.91095 0.0732
NP_440747.1_10 Reverse -378 -390 -11.6624 0.131
NP_440747.1_10 Forward -191 -179 -12.1541 0.227
NP_440747.1_10 Reverse -319 -331 -12.4491 0.282
NP_441130.1_10 Reverse -379 -393 6.78443 0.177
NP_441854.1_10 Forward -111 -92 0.58944 0.282
NP_441265.1_3 Reverse -375 -389 5.50613 0.181
NP_440842.1_10 Reverse -92 -106 12.6843 0.251
NP_441014.1_8 Reverse -88 -107 -2.75381 0.238
NP_441012.1_4 Forward -388 -375 6.21414 0.284
NP_443018.1_3 Reverse -382 -389 13.8055 0.024
NP_443018.1_3 Forward -389 -382 13.6088 0.0352
NP_441634.1_8 Forward -392 -378 3.63784 0.145
NP_440376.1_1 Reverse -381 -390 6.48957 0.0963
NP_440376.1_1 Forward -390 -381 -0.196935 0.285
NP_443065.1_9 Forward -135 -116 10.5209 0.231
NP_442687.1_1 Reverse -192 -205 15.1616 0.243
NP_442191.1_4 Forward -264 -250 11.6718 0.247
NP_441077.1_6 Forward -210 -194 4.05516 0.261
NP_441077.1_6 Forward -211 -195 3.09109 0.272
NP_440642.1_10 Forward -261 -247 1.5723 0.29
NP_441422.1_7 Reverse -287 -304 -7.43431 0.258
NP_440667.1_2 Forward -306 -287 -2.16383 0.232
NP_442658.1_1 Reverse -379 -389 16.7941 0.00966
NP_440141.1_10 Reverse -76 -95 -1.37794 0.19
NP_440656.1_2 Forward -170 -151 3.34271 0.221
NP_441958.1_5 Reverse -380 -390 1.65166 0.0872
NP_442836.1_10 Reverse -147 -157 11.2881 0.269
NP_440203.1_5 Forward -387 -377 11.9759 0.168
NP_440203.1_6 Forward -216 -197 19.0502 0.214
NP_441097.1_2 Forward -323 -306 3.18543 0.293
NP_442911.1_2 Forward -198 -179 -4.03212 0.124
NP_442911.1_2 Reverse -371 -390 -7.57203 0.214
NP_442911.1_2 Forward -400 -381 -9.44032 0.257
NP_440153.1_8 Forward -304 -291 3.65753 0.21
NP_440153.1_8 Forward -390 -377 3.16588 0.21
NP_440369.1_5 Reverse -154 -173 9.73422 0.272
NP_443055.1_6 Forward -268 -250 -1.6532 0.281
NP_440993.1_3 Forward -161 -142 -0.886293 0.273
NP_442002.1_1 Forward -323 -305 0.314141 0.192
NP_442002.1_9 Reverse -178 -185 14.1004 0.074
NP_442438.1_10 Reverse -376 -390 2.2612 0.182
NP_441752.1_6 Reverse -290 -309 3.14605 0.235
NP_441000.1_6 Reverse -380 -394 -4.22864 0.231
NP_440147.1_4 Forward -392 -379 6.70579 0.0856
NP_441550.1_8 Reverse -379 -389 10.1076 0.0759
NP_441550.1_8 Forward -392 -382 8.73102 0.116
NP_441916.1_7 Reverse -295 -305 1.74999 0.275
NP_440569.1_5 Reverse -131 -150 13.5691 0.158
NP_442996.1_7 Reverse -187 -206 12.0296 0.296
NP_441547.1_2 Reverse -370 -388 5.42735 0.223
NP_441547.1_2 Forward -109 -91 3.55906 0.281
NP_441725.1_5 Forward -389 -379 16.2046 0.0247
NP_441725.1_5 Forward -187 -177 1.55333 0.133
NP_439966.1_7 Forward -392 -382 9.12434 0.119
NP_439966.1_9 Forward -65 -56 6.39124 0.253
NP_442941.1_3 Reverse -382 -392 0.0783647 0.231
NP_442941.1_3 Forward -187 -177 -0.609952 0.264
NP_440674.1_3 Forward -98 -79 0.982764 0.284
NP_440289.1_2 Reverse -176 -189 -3.4223 0.267
NP_440260.1_8 Forward -399 -381 -1.16082 0.232
NP_441514.1_1 Forward -78 -68 13.8676 0.284
NP_442281.1_1 Reverse -376 -390 4.42388 0.195
NP_441079.1_7 Forward -211 -192 -2.8529 0.223
NP_441079.1_7 Reverse -191 -210 -5.80282 0.268
NP_442575.1_8 Reverse -147 -166 -5.99873 0.277
NP_440437.1_1 Forward -194 -175 -2.55715 0.219
NP_441644.1_6 Reverse -381 -391 13.2542 0.0212
NP_441644.1_6 Forward -390 -380 4.60114 0.233
NP_443049.1_6 Reverse -380 -390 11.7385 0.24
NP_440652.1_1 Forward -341 -322 6.58763 0.258
NP_442215.1_1 Reverse -377 -396 4.52268 0.252
NP_442215.1_2 Forward -392 -376 -7.11963 0.286
NP_440253.1_4 Reverse -232 -251 12.6841 0.27
NP_440929.1_8 Reverse -381 -390 7.66954 0.0624
NP_440929.1_8 Forward -390 -381 7.57121 0.0706
NP_442933.1_10 Reverse -381 -390 5.70292 0.165
NP_441310.1_10 Reverse -150 -160 14.4292 0.279
NP_442671.1_2 Forward -211 -192 3.34057 0.194
NP_441751.2_8 Forward -389 -375 4.03116 0.0563
NP_441751.2_8 Forward -187 -173 -6.19526 0.255
NP_442554.1_8 Forward -389 -379 15.9097 0.00747
NP_442554.1_8 Reverse -382 -392 11.7798 0.0325
NP_442142.1_4 Reverse -378 -391 2.772 0.278
NP_442292.1_1 Reverse -382 -391 8.1612 0.0478
NP_442292.1_1 Forward -389 -380 6.5879 0.101
NP_442476.1_6 Forward -389 -375 7.86607 0.112
NP_442476.1_6 Reverse -382 -396 6.88276 0.118
NP_441264.1_9 Reverse -376 -390 8.75105 0.274
NP_441711.1_2 Forward -155 -136 12.1917 0.27
NP_441523.1_6 Reverse -287 -306 8.35759 0.19
NP_443009.1_5 Reverse -178 -189 5.76138 0.189
NP_443009.1_5 Forward -391 -380 4.08976 0.263
NP_443009.1_5 Forward -189 -178 3.49977 0.292
NP_441198.1_8 Reverse -379 -389 12.8807 0.116
NP_441468.1_1 Reverse -382 -389 13.8055 0.0242
NP_441468.1_1 Forward -389 -382 6.0373 0.223
NP_441015.1_10 Forward -300 -281 -7.4737 0.267
NP_441015.1_10 Reverse -376 -395 -10.6203 0.286
NP_441673.1_1 Reverse -381 -390 1.37636 0.114
NP_441673.1_1 Forward -390 -381 1.1797 0.163
NP_441876.1_9 Forward -18 -8 10.5993 0.287
NP_441426.1_3 Reverse -288 -307 12.585 0.256
NP_441764.1_8 Reverse -188 -198 11.3107 0.284
NP_442868.1_6 Reverse -379 -389 7.05986 0.0898
NP_442868.1_6 Forward -392 -382 0.668351 0.213
NP_442719.1_2 Reverse -260 -278 1.29671 0.162
NP_442677.1_3 Reverse -122 -141 -1.7705 0.257
NP_441612.1_2 Forward -84 -74 8.6461 0.21
NP_441612.1_2 Reverse -386 -396 7.38753 0.255
NP_442227.1_2 Forward -156 -137 5.211 0.202
NP_441315.1_2 Reverse -285 -303 14.7946 0.245
NP_440145.1_3 Reverse -371 -390 4.916 0.0747
NP_442542.1_2 Reverse -379 -392 10.4424 0.126
NP_442050.1_1 Forward -100 -81 7.27595 0.274
NP_440558.1_2 Forward -399 -380 -3.44213 0.236
NP_442593.1_3 Reverse -134 -153 21.3361 0.0759
NP_441878.1_6 Reverse -380 -390 11.4848 0.0176
NP_441878.1_6 Forward -391 -381 -0.41329 0.177
NP_441036.1_3 Reverse -153 -172 1.96607 0.168
NP_441557.1_5 Forward -390 -381 7.57121 0.049
NP_441557.1_5 Reverse -381 -390 1.08137 0.0794
NP_441445.1_8 Forward -102 -83 -11.5053 0.277
NP_441433.1_8 Forward -300 -281 -3.3438 0.28
NP_440084.1_8 Reverse -194 -208 16.2452 0.18
NP_440084.1_8 Forward -206 -192 9.17885 0.29
NP_440101.1_10 Reverse -289 -308 5.70265 0.208
NP_442397.1_9 Reverse -214 -233 3.24438 0.264
NP_441549.1_9 Forward -394 -376 1.00246 0.11
NP_442645.1_2 Forward -398 -379 -22.715 0.293
NP_441037.1_4 Reverse -379 -389 17.6482 0.0127
NP_441037.1_4 Reverse -177 -187 6.34312 0.267
NP_442594.1_7 Forward -173 -154 19.1731 0.0492
NP_442594.1_8 Forward -322 -303 17.7974 0.146
NP_441633.1_3 Forward -392 -379 15.2606 0.0108
NP_440136.1_2 Reverse -382 -389 6.52896 0.116
NP_440136.1_2 Forward -389 -382 6.13563 0.193
NP_440136.1_2 Forward -187 -180 3.97235 0.288
NP_442998.1_10 Forward -388 -381 6.13563 0.181
NP_442998.1_10 Forward -186 -179 6.0373 0.205
NP_440299.1_1 Forward -394 -381 14.1783 0.0259
NP_440640.1_6 Forward -132 -113 3.14605 0.227
NP_441007.1_10 Reverse -376 -389 10.5407 0.0656
NP_442334.1_2 Forward -314 -297 -5.36936 0.2
NP_442334.1_2 Forward -286 -269 -7.23765 0.289
NP_440456.1_7 Forward -255 -241 10.521 0.292
NP_440915.1_6 Reverse -377 -391 2.45787 0.118
NP_442158.1_4 Forward -106 -96 10.6981 0.283
NP_440748.1_4 Reverse -364 -383 12.585 0.292
NP_442993.1_1 Forward -188 -172 -8.39793 0.166
NP_442386.1_9 Forward -391 -382 11.1107 0.103
NP_441340.1_5 Forward -389 -382 13.5105 0.0314
NP_441340.1_5 Reverse -382 -389 6.23397 0.132
NP_442484.1_2 Reverse -306 -325 6.88262 0.156
NP_442240.1_1 Reverse -296 -315 3.63691 0.286
NP_440586.1_8 Forward -389 -382 11.3468 0.0736
NP_440586.1_8 Reverse -382 -389 9.47853 0.146
NP_440586.1_8 Reverse -330 -337 7.02027 0.279
NP_440969.1_3 Reverse -228 -246 12.6047 0.242
NP_441262.1_3 Reverse -381 -388 5.25066 0.215
NP_440027.1_3 Reverse -381 -399 5.1316 0.246
NP_440027.1_8 Reverse -302 -321 7.37347 0.266
NP_443051.1_1 Reverse -380 -389 8.35786 0.0371
NP_440451.1_10 Reverse -221 -240 12.9783 0.202
NP_440451.1_10 Forward -389 -370 7.07848 0.292
NP_439937.1_9 Reverse -178 -195 -15.4981 0.287
NP_439937.1_9 Forward -391 -374 -16.2847 0.287
NP_440372.1_2 Reverse -382 -389 6.62729 0.151
NP_440372.1_2 Forward -389 -382 6.52896 0.188
NP_440316.1_10 Reverse -145 -155 9.61647 0.235
NP_440316.1_10 Reverse -380 -390 7.25653 0.251
NP_439977.1_5 Forward -396 -377 12.9791 0.0531
NP_440139.1_1 Forward -396 -377 3.63691 0.201
NP_440139.1_1 Reverse -140 -159 2.26028 0.235
NP_441572.1_7 Reverse -375 -394 7.47261 0.0771
NP_442384.1_10 Reverse -381 -394 9.65572 0.0508
NP_442262.1_10 Reverse -382 -389 13.0188 0.0314
NP_442262.1_10 Forward -389 -382 11.6422 0.092
NP_440282.1_2 Reverse -289 -308 5.50599 0.295
NP_440297.1_9 Forward -389 -379 9.81313 0.0917
NP_440297.1_9 Reverse -382 -392 -0.118297 0.282
NP_440297.1_9 Forward -187 -177 -0.41329 0.283
NP_442280.1_10 Forward -400 -382 13.8309 0.13
NP_441592.1_4 Forward -383 -364 -4.03212 0.293
NP_442067.1_4 Reverse -84 -103 5.211 0.244
NP_440888.1_2 Forward -151 -137 6.48882 0.232
NP_440491.1_1 Forward -135 -116 7.20938 0.274
NP_440575.1_1 Reverse -69 -88 -3.14789 0.294
NP_441543.1_2 Forward -389 -380 7.07956 0.131
NP_442845.1_2 Reverse -375 -389 6.98109 0.199
NP_442845.1_2 Forward -314 -300 4.22782 0.264
NP_441178.1_6 Reverse -85 -104 3.34192 0.269
NP_442710.1_7 Forward -212 -193 -7.51107 0.296
NP_442710.1_7 Forward -210 -191 -8.18384 0.299
NP_441469.1_8 Reverse -380 -389 12.1928 0.123
NP_441469.1_8 Forward -391 -382 5.60459 0.258
NP_442337.1_8 Forward -241 -222 -1.86883 0.292
NP_440710.1_1 Forward -156 -138 -6.86402 0.228
NP_440710.1_1 Forward -398 -380 -8.14232 0.257
NP_441462.1_2 Forward -390 -380 0.471689 0.148
NP_441621.1_7 Forward -392 -378 -3.93365 0.198
NP_442204.1_1 Forward -324 -313 -0.137991 0.286
NP_440255.1_3 Reverse -201 -211 14.0586 0.298
NP_440516.1_8 Reverse -146 -155 0.0980582 0.143
NP_440516.1_8 Reverse -381 -390 -0.196935 0.185
NP_442428.1_5 Reverse -382 -389 14.1988 0.0242
NP_442428.1_5 Forward -389 -382 6.0373 0.212
NP_441867.1_2 Forward -323 -304 -12.1936 0.253
NP_440673.1_2 Forward -400 -381 10.292 0.217
NP_440673.1_3 Forward -388 -381 11.6422 0.0724
NP_441052.1_2 Reverse -381 -391 7.05986 0.0818
NP_440436.1_4 Forward -389 -380 12.979 0.0276
NP_442907.1_9 Reverse -376 -395 1.37609 0.189
NP_441719.1_4 Reverse -382 -389 6.62729 0.151
NP_441719.1_4 Forward -389 -382 6.52896 0.188
NP_441733.1_10 Forward -311 -298 4.34585 0.266
NP_441004.1_1 Forward -319 -300 -18.2901 0.299
NP_440296.1_6 Reverse -193 -211 14.8032 0.283
NP_440296.1_10 Reverse -378 -397 -13.1769 0.269
NP_440328.1_4 Forward -142 -123 -1.08219 0.298
NP_443054.1_2 Reverse -170 -184 -0.0987402 0.284
NP_442308.1_4 Reverse -316 -335 11.2092 0.267
NP_441851.1_10 Reverse -380 -390 15.8113 0.00552
NP_441851.1_10 Reverse -178 -188 5.68323 0.203
NP_441851.1_10 Forward -189 -179 4.89658 0.24
NP_441851.1_10 Forward -391 -381 4.40493 0.271
NP_440682.1_2 Reverse -226 -245 -7.57203 0.234
NP_442939.1_3 Reverse -2 -16 14.9084 0.288
NP_442515.1_1 Reverse -380 -394 0.687908 0.183
NP_440593.1_3 Forward -395 -376 -5.40875 0.259
NP_441982.1_6 Reverse -62 -71 11.244 0.288
NP_441046.1_2 Forward -77 -58 -2.26216 0.299
NP_441349.1_10 Forward -400 -381 -8.35868 0.274
NP_441409.1_6 Forward -194 -175 -14.5535 0.259
NP_440432.1_9 Forward -389 -374 -4.445 0.209
NP_442450.1_5 Reverse -177 -187 7.74818 0.13
NP_440195.1_5 Reverse -375 -394 8.45592 0.17
NP_440040.1_4 Forward -64 -45 3.34271 0.294
NP_442006.1_2 Reverse -130 -147 -16.4808 0.254
NP_443047.1_7 Forward -168 -149 3.34271 0.3
NP_440483.1_1 Forward -241 -222 -5.50708 0.226
NP_441570.1_1 Reverse -381 -399 -17.3854 0.273
NP_441078.1_4 Reverse -381 -390 7.66954 0.052
NP_441078.1_4 Forward -390 -381 0.491382 0.188
NP_442348.1_2 Forward -114 -105 7.27622 0.28
NP_440526.1_3 Forward -389 -378 18.446 0.0306
NP_440526.1_3 Reverse -180 -191 5.17139 0.253
NP_441432.1_8 Reverse -380 -389 5.60459 0.147
NP_440760.1_1 Forward -390 -371 -15.2418 0.144
NP_440760.1_1 Forward -365 -346 -22.0267 0.248
NP_442797.1_1 Reverse -287 -306 7.86593 0.137
NP_442797.1_7 Forward -397 -379 3.95239 0.234
NP_440713.1_4 Forward -146 -127 2.85105 0.256
NP_440713.1_4 Reverse -132 -151 2.26107 0.266
NP_442489.1_7 Reverse -381 -390 8.1612 0.0294
NP_442489.1_7 Forward -390 -381 0.491382 0.178
NP_440559.1_1 Forward -389 -380 7.66954 0.0999
NP_440559.1_1 Reverse -382 -391 6.78456 0.128
NP_440559.1_1 Forward -187 -178 4.32629 0.288
NP_441659.2_8 Forward -390 -380 7.74818 0.0566
NP_441659.2_8 Reverse -381 -391 5.09324 0.117
NP_441659.2_8 Reverse -179 -189 2.83163 0.187
NP_441659.2_8 Forward -155 -145 0.373358 0.268
NP_442849.1_6 Reverse -318 -332 14.5526 0.236
NP_442776.1_1 Forward -147 -128 4.52268 0.274
NP_442346.1_1 Forward -131 -112 10.1275 0.27
NP_442346.1_5 Reverse -380 -390 15.9097 0.00378
NP_442346.1_5 Forward -391 -381 6.07655 0.216
NP_442346.1_5 Reverse -178 -188 5.68323 0.234
NP_440545.1_3 Reverse -377 -394 4.85706 0.0661
NP_440545.1_3 Forward -394 -377 1.61214 0.116
NP_440545.1_3 Forward -314 -297 -5.56602 0.253
NP_440545.1_3 Reverse -291 -308 -5.76269 0.259
NP_441629.1_3 Forward -155 -136 1.27698 0.231
NP_440486.1_6 Forward -149 -130 5.99764 0.284
NP_440010.1_3 Forward -100 -81 -0.983855 0.25
NP_440010.1_4 Reverse -285 -304 9.24175 0.169
NP_441585.1_5 Reverse -250 -269 5.80018 0.211
NP_441888.1_8 Reverse -254 -273 8.25926 0.296
NP_441833.1_4 Reverse -382 -389 6.23397 0.163
NP_441833.1_4 Forward -389 -382 6.13563 0.198
NP_441833.1_4 Forward -187 -180 4.56234 0.248
NP_442162.1_9 Reverse -382 -389 6.62729 0.142
NP_442162.1_9 Forward -389 -382 6.43063 0.208
NP_440671.1_4 Reverse -375 -389 6.48943 0.245
NP_442140.1_3 Forward -389 -379 10.9931 0.0874
NP_442140.1_3 Reverse -382 -392 10.3048 0.0902
NP_441813.1_5 Forward -392 -382 7.55152 0.0735
NP_441813.1_5 Reverse -379 -389 -0.806614 0.285
NP_440567.1_1 Forward -389 -375 12.291 0.0241
NP_442497.1_10 Forward -389 -380 10.0295 0.0222
NP_442497.1_10 Forward -187 -178 0.393051 0.175
NP_442497.1_10 Reverse -382 -391 -1.18024 0.256
NP_440821.1_4 Reverse -379 -389 9.81313 0.0246
NP_440821.1_4 Reverse -177 -187 0.176696 0.198
NP_441239.1_9 Reverse -379 -391 9.87208 0.0941
NP_441239.1_9 Forward -392 -380 9.38042 0.108
NP_441239.1_9 Forward -190 -178 3.08724 0.296
NP_441951.1_4 Forward -101 -82 0.982764 0.29
NP_440624.1_5 Forward -209 -191 13.4518 0.178
NP_440665.1_1 Reverse -127 -146 -15.0452 0.264
NP_440740.1_7 Forward -146 -128 16.7354 0.0646
NP_442809.1_6 Reverse -178 -197 6.78429 0.256
NP_440546.1_6 Reverse -59 -78 8.65258 0.255
NP_442041.1_2 Forward -104 -86 17.9154 0.153
NP_441184.1_3 Forward -318 -299 1.0811 0.296
NP_440341.1_1 Reverse -139 -158 3.93269 0.283
NP_442402.1_4 Forward -360 -341 -9.34271 0.288
NP_441848.1_4 Forward -84 -68 8.21911 0.288
NP_441848.1_7 Reverse -104 -123 -4.1312 0.287
NP_440696.1_3 Forward -400 -382 1.10079 0.22
NP_442039.1_4 Reverse -382 -389 6.3323 0.289
NP_442039.1_7 Forward -258 -248 10.9931 0.257
NP_442679.1_1 Reverse -177 -196 -1.27885 0.228
NP_442837.1_3 Reverse -382 -389 6.0373 0.25
NP_442837.1_3 Forward -389 -382 5.93897 0.265
NP_439994.1_3 Forward -250 -231 9.12141 0.258
NP_441701.1_3 Reverse -372 -389 10.1669 0.245
NP_441203.1_2 Forward -104 -85 -6.58872 0.267
NP_441576.1_10 Reverse -190 -209 10.6192 0.291
NP_440914.1_1 Reverse -381 -391 14.1778 0.0178
NP_442533.1_1 Reverse -137 -156 -16.4218 0.268
NP_442533.1_6 Forward -390 -381 7.66954 0.0897
NP_442533.1_6 Reverse -381 -390 6.8829 0.101
NP_442541.1_10 Forward -390 -376 1.5723 0.283
NP_442232.1_3 Reverse -373 -392 2.26107 0.103
NP_442322.1_3 Reverse -10 -24 17.5025 0.282
NP_441482.1_7 Reverse -375 -389 -9.04686 0.193
NP_439944.1_9 Forward -389 -379 7.84651 0.127
NP_439944.1_9 Reverse -382 -392 5.78156 0.221
NP_441697.1_5 Reverse -191 -210 -1.57604 0.206
NP_441697.1_5 Reverse -192 -211 -9.88384 0.278
NP_441697.1_5 Forward -209 -190 -10.2658 0.278
NP_441697.1_5 Reverse -193 -212 -11.0297 0.29
NP_441028.1_6 Reverse -246 -256 5.78111 0.243
NP_441028.1_6 Reverse -128 -138 4.01116 0.278
NP_441527.1_5 Reverse -177 -196 12.0176 0.297
NP_440115.1_6 Reverse -378 -388 9.51814 0.115
NP_440007.1_9 Reverse -377 -391 10.9143 0.163
NP_439965.1_1 Forward -399 -380 -6.58872 0.218
NP_441680.1_4 Reverse -86 -105 1.17943 0.246
NP_441347.1_5 Reverse -375 -389 8.75042 0.283
NP_441961.1_4 Reverse -373 -392 4.03102 0.277
NP_441602.1_3 Forward -395 -376 -0.0988766 0.219
NP_441106.1_1 Reverse -380 -389 6.5879 0.0893
NP_440429.1_9 Forward -133 -114 -0.295539 0.297
NP_441286.1_1 Forward -391 -379 13.117 0.00815
NP_441286.1_1 Forward -189 -177 -6.2542 0.254
NP_440670.1_8 Reverse -381 -390 6.78456 0.099
NP_440670.1_8 Forward -390 -381 5.3096 0.167
NP_440670.1_8 Forward -188 -179 3.53964 0.257
NP_440886.1_7 Forward -156 -146 11.5826 0.0805
NP_442614.1_2 Reverse -179 -193 7.17775 0.275
NP_440907.2_8 Forward -389 -379 9.81266 0.103
NP_440841.1_4 Reverse -379 -398 -3.44213 0.18
NP_441626.1_2 Reverse -382 -389 6.52896 0.137
NP_441626.1_2 Forward -389 -382 5.93897 0.231
NP_442615.1_1 Reverse -372 -390 -3.6191 0.165
NP_441962.1_4 Reverse -376 -395 -5.80207 0.174
NP_441431.1_2 Reverse -90 -104 6.98048 0.255
NP_441065.1_2 Reverse -191 -210 12.4921 0.18
NP_441836.1_2 Forward -396 -377 -2.65548 0.23
NP_440358.1_2 Reverse -81 -98 13.9027 0.194
NP_440293.1_3 Reverse -147 -166 -0.885524 0.238
NP_440293.1_3 Forward -105 -86 -1.86883 0.239
NP_440766.1_5 Forward -255 -243 6.79636 0.292
NP_441421.1_6 Forward -212 -195 23.6386 0.0092
NP_439988.1_3 Forward -394 -380 4.32615 0.295
NP_441237.1_9 Forward -389 -379 16.9913 0.00629
NP_442930.1_1 Forward -76 -66 9.51767 0.286
NP_441133.1_1 Forward -125 -106 12.2908 0.269
NP_440457.1_1 Reverse -377 -389 16.4603 0.0486
NP_440457.1_1 Reverse -142 -154 11.5437 0.092
NP_440457.1_1 Forward -192 -180 4.8572 0.151
NP_440457.1_1 Forward -318 -306 4.5622 0.158
NP_440798.1_6 Forward -389 -376 -0.0790467 0.297
NP_440801.1_10 Forward -308 -289 6.78429 0.287
NP_442509.1_4 Forward -301 -282 13.1758 0.276
NP_442509.1_5 Forward -156 -139 20.4909 0.0487
NP_442509.1_9 Forward -188 -178 11.6809 0.119
NP_442509.1_9 Forward -276 -266 7.64939 0.21
NP_442514.1_5 Reverse -86 -105 -0.787962 0.189
NP_442514.1_5 Reverse -87 -106 -5.60616 0.26
NP_440554.1_4 Forward -389 -379 3.32329 0.234
NP_441885.1_5 Reverse -381 -391 2.04498 0.0868
NP_442128.1_6 Reverse -336 -350 14.1593 0.29
NP_440423.1_6 Reverse -138 -157 -21.0434 0.279
NP_443000.1_3 Forward -97 -78 10.0681 0.289
NP_443000.1_7 Forward -392 -382 1.06167 0.274
NP_441842.1_10 Forward -121 -107 7.76774 0.245
NP_440275.1_3 Reverse -379 -389 9.81313 0.0507
NP_440275.1_3 Forward -392 -382 5.38824 0.153
NP_440275.1_3 Forward -190 -180 4.50326 0.188
NP_442451.1_2 Forward -398 -379 -6.98204 0.232
NP_440175.1_4 Reverse -379 -398 -10.7186 0.178
NP_440216.1_1 Reverse -381 -395 -11.2101 0.169
NP_440216.1_1 Reverse -179 -193 -12.5868 0.288
NP_440216.1_9 Reverse -252 -261 11.6028 0.254
NP_440216.1_9 Reverse -97 -106 8.25953 0.286
NP_440216.1_9 Reverse -383 -392 5.70292 0.29
NP_440172.1_1 Reverse -381 -391 5.68323 0.136
NP_441064.1_7 Forward -71 -52 15.4978 0.193
NP_442015.1_10 Forward -192 -179 2.77255 0.187
NP_441226.1_7 Forward -389 -382 14.1984 0.024
NP_441111.1_7 Forward -389 -381 8.86921 0.0589
NP_441766.1_2 Forward -390 -381 6.39124 0.0993
NP_441766.1_9 Forward -103 -84 -1.86883 0.275
NP_440416.1_9 Forward -397 -378 -9.83364 0.135
NP_440416.1_9 Reverse -304 -323 -16.5201 0.216
NP_441940.1_4 Forward -392 -373 13.8641 0.266
NP_441974.1_3 Reverse -183 -200 15.2893 0.257
NP_440261.1_5 Forward -389 -376 -1.25902 0.0687
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTCTGGTCTTGCCATCGCCCCGCCATAATACGCAGATAATTACCCAAGCTTTGTTCCAGTTGTTGATGGGAAAACACCAGGCTAGGGGAGTCGGGAGCCGTCGTTACCGTCGGGAGAGTTAGGGATAATCGGACAAAGTTTCCCTGGGGGACTAATTGCCACTCAGGATGGGGTGTGTCGTCACTCATCAAAAAAATTTAGAATTTTGCCGTAGGATCGCCCTTTACCTTAGCACTTCACTTTCCCCGACCGTCCTCCTCCCAGGGGGTCAATTCGAGCTGGGGTGGAGATTTTTTGCCCTGGGGCCGGGAGGGTTAGGAAAGACAAATTTTTCGCTACGATTGAAGAGAATCCTGCCATACTCCGCTGTGGTATTTAACATTAATCCCTACATTATTT

CDS

ATGGCTGTCTGTCCCACCTGTAATCACACCAATCCAGAAGGGGCCATCCAGTGTGAGGCCTGCTTTACCCCCCTGCCCACTCTGATGCCTTGTCCCCACTGTGGCAGCTCCGTGCAAAGTGATGCTACTTTTTGCGGCAACTGTGGACAGACCATTGATCCCCAACAATTAGTAGTAAGTGCTCCGGAGGAAGAAGAGGTCCCCATCCCGATCGCCGTAGCTCCAGAAAGTGCTGAACCCATTCCGGCCATTCCCGAAGTTTCCTCCACACCGGCCCCATTTCCCGTGGGCACCCAACTCCAATCCCAGGGAGCTTCCCTTGTCCATGTGCAGACCCAAACCACGTTGGAAATTCCTGCCGGCCTAACGGTAATCCACCTAGGAAAACCCAACGATAAGGTACCACCAGACATCGATGTATCGGGTTTTGCCAATTCCGATGTGGTGTCTAGGGTCCATGCCGATATCCGTCTGGAAGGCAATGAGTATTTCTTGGAAGATGTGGGCAGTGCCAATGGCACCTACGTTAACCACACGGCCCTCCTCCCAGGCAACCGTCATTTACTGCGTCCCGGCGATCGCCTTGCTTTGGGCAAAGGGGATTTGGTCACATTTATATTTCAGTTGCATTAG

Protein

MAVCPTCNHTNPEGAIQCEACFTPLPTLMPCPHCGSSVQSDATFCGNCGQTIDPQQLVVSAPEEEEVPIPIAVAPESAEPIPAIPEVSSTPAPFPVGTQLQSQGASLVHVQTQTTLEIPAGLTVIHLGKPNDKVPPDIDVSGFANSDVVSRVHADIRLEGNEYFLEDVGSANGTYVNHTALLPGNRHLLRPGDRLALGKGDLVTFIFQLH