Your browser is old and dusty. Try Google Chrome!

Details for slr0294

ORF slr0294
Accession NP_441839.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -266 -252 5.21113 0.14
NP_441061.1_2 Forward -257 -243 -0.590395 0.234
NP_440795.1_7 Forward -345 -338 14.1988 0.0267
NP_440795.1_7 Reverse -154 -161 14.1988 0.0267
NP_440795.1_7 Forward -55 -48 5.74231 0.279
NP_441418.1_6 Forward -162 -143 -21.1417 0.139
NP_441418.1_6 Reverse -153 -172 -21.4367 0.149
NP_441480.1_2 Reverse -283 -302 19.5673 0.116
NP_440897.1_6 Reverse -76 -95 13.2733 0.0588
NP_440897.1_6 Forward -346 -327 8.06178 0.074
NP_440897.1_6 Reverse -153 -172 1.57197 0.17
NP_441453.1_4 Reverse -47 -55 6.90259 0.121
NP_441453.1_4 Reverse -153 -161 6.80426 0.121
NP_441453.1_4 Forward -346 -338 6.80426 0.121
NP_441453.1_4 Reverse -337 -345 6.70593 0.121
NP_441453.1_4 Forward -162 -154 6.70593 0.121
NP_441453.1_4 Forward -56 -48 6.70593 0.121
NP_441453.1_6 Reverse -23 -37 20.7467 0.221
NP_441623.1_1 Reverse -315 -333 0.412472 0.226
NP_441623.1_1 Reverse -69 -87 -3.12744 0.256
NP_442151.1_6 Forward -346 -332 17.4042 0.0108
NP_442151.1_6 Forward -162 -148 14.1593 0.0395
NP_442151.1_6 Reverse -153 -167 10.226 0.127
NP_442151.1_6 Reverse -337 -351 6.3911 0.236
NP_442838.1_7 Reverse -71 -90 -11.4069 0.277
NP_441818.1_1 Forward -161 -150 9.79292 0.232
NP_440226.1_1 Forward -162 -143 16.5191 0.0215
NP_440226.1_1 Reverse -337 -356 11.9958 0.0484
NP_441630.1_3 Reverse -68 -87 2.16274 0.232
NP_440931.1_7 Forward -285 -267 10.8348 0.287
NP_442173.1_1 Reverse -48 -56 11.7208 0.034
NP_442173.1_1 Forward -55 -47 7.49257 0.171
NP_442173.1_1 Forward -345 -337 5.72262 0.203
NP_442173.1_1 Reverse -338 -346 5.72262 0.203
NP_442173.1_1 Forward -161 -153 5.72262 0.203
NP_442173.1_1 Reverse -154 -162 5.72262 0.203
NP_442752.1_4 Reverse -337 -344 13.5105 0.0314
NP_442752.1_4 Forward -162 -155 13.5105 0.0314
NP_442752.1_4 Reverse -153 -160 4.26735 0.293
NP_442752.1_4 Forward -346 -339 4.26735 0.293
NP_443027.1_4 Forward -58 -48 15.3197 0.0437
NP_443027.1_4 Reverse -151 -161 13.0581 0.055
NP_443027.1_4 Forward -348 -338 12.2714 0.0797
NP_443027.1_4 Reverse -370 -380 7.64985 0.238
NP_441812.1_3 Reverse -317 -331 8.84938 0.251
NP_441812.1_3 Forward -163 -149 7.47274 0.272
NP_442975.1_10 Forward -166 -152 18.5835 0.00673
NP_442975.1_10 Reverse -333 -347 8.25877 0.103
NP_442975.1_10 Forward -60 -46 6.88214 0.156
NP_442975.1_10 Forward -377 -363 5.60385 0.216
NP_440784.1_7 Reverse -338 -345 13.2155 0.0365
NP_440784.1_7 Forward -161 -154 13.2155 0.0365
NP_440784.1_7 Forward -345 -338 12.1338 0.0604
NP_440784.1_7 Reverse -154 -161 12.1338 0.0604
NP_440784.1_7 Reverse -48 -55 6.43063 0.218
NP_440784.1_7 Forward -55 -48 6.23397 0.241
NP_442062.1_8 Reverse -153 -163 9.7148 0.0559
NP_442062.1_8 Forward -346 -336 7.94484 0.0848
NP_442062.1_8 Forward -162 -152 7.64985 0.0911
NP_442062.1_8 Forward -56 -46 7.25653 0.104
NP_440761.1_4 Reverse -148 -167 -13.4719 0.257
NP_441859.1_5 Forward -300 -281 5.50599 0.295
NP_440304.1_4 Forward -58 -48 16.6963 0.0199
NP_442242.1_4 Reverse -48 -55 13.3138 0.027
NP_442242.1_4 Forward -345 -338 12.0355 0.0521
NP_442242.1_4 Reverse -154 -161 12.0355 0.0521
NP_442242.1_4 Reverse -338 -345 11.5438 0.089
NP_442242.1_4 Forward -161 -154 11.5438 0.089
NP_442242.1_4 Forward -84 -77 11.3472 0.105
NP_440044.1_8 Forward -84 -65 1.96607 0.161
NP_440044.1_8 Reverse -48 -67 0.982764 0.186
NP_441208.1_9 Reverse -334 -348 14.4542 0.0974
NP_442196.1_10 Forward -348 -329 11.4058 0.225
NP_441082.1_10 Reverse -238 -251 8.47575 0.272
NP_440856.1_4 Forward -196 -177 7.96426 0.06
NP_441083.1_5 Forward -346 -336 16.7946 0.00546
NP_441083.1_5 Forward -162 -152 10.6981 0.0184
NP_441083.1_5 Reverse -153 -163 8.82982 0.03
NP_441083.1_5 Reverse -337 -347 1.65166 0.2
NP_441083.1_5 Forward -56 -46 1.16001 0.215
NP_441083.1_5 Reverse -47 -57 -0.806614 0.28
NP_442827.1_8 Reverse -145 -164 -3.14789 0.298
NP_441434.1_7 Forward -344 -330 2.45787 0.284
NP_441738.1_2 Reverse -49 -56 13.3134 0.0335
NP_441738.1_2 Reverse -260 -267 10.2652 0.101
NP_441738.1_2 Forward -282 -275 6.52862 0.261
NP_440209.1_1 Forward -346 -338 8.37755 0.0576
NP_440209.1_1 Reverse -153 -161 8.37755 0.0576
NP_440209.1_1 Reverse -337 -345 8.27922 0.0687
NP_440209.1_1 Forward -162 -154 8.27922 0.0687
NP_440209.1_1 Forward -56 -48 8.27922 0.0687
NP_442889.1_8 Forward -165 -151 9.93039 0.0933
NP_442889.1_8 Forward -349 -335 5.80051 0.213
NP_442889.1_8 Forward -59 -45 5.30886 0.231
NP_442889.1_8 Reverse -369 -383 4.8172 0.25
NP_442398.1_1 Forward -368 -349 12.9791 0.205
NP_440178.1_7 Reverse -336 -355 -10.817 0.0832
NP_441716.1_1 Forward -162 -148 11.6026 0.0936
NP_442111.1_4 Reverse -152 -166 15.4376 0.022
NP_442111.1_4 Reverse -336 -350 9.34103 0.0609
NP_442111.1_4 Forward -347 -333 5.30946 0.169
NP_440906.1_5 Reverse -338 -345 13.3138 0.0268
NP_440906.1_5 Forward -161 -154 13.3138 0.0268
NP_440906.1_5 Reverse -48 -55 6.52896 0.199
NP_440906.1_5 Forward -345 -338 6.13563 0.241
NP_440906.1_5 Reverse -154 -161 6.13563 0.241
NP_440906.1_5 Forward -55 -48 6.0373 0.262
NP_440747.1_10 Reverse -150 -162 -2.22263 0.026
NP_440747.1_10 Forward -349 -337 -2.4193 0.0434
NP_440747.1_10 Reverse -334 -346 -4.28759 0.0903
NP_440747.1_10 Reverse -44 -56 -4.58258 0.109
NP_440747.1_10 Forward -165 -153 -11.9574 0.178
NP_440747.1_10 Forward -192 -180 -12.0557 0.199
NP_441130.1_10 Forward -164 -150 7.57108 0.155
NP_442973.1_5 Reverse -328 -347 11.7008 0.23
NP_441486.1_1 Reverse -150 -164 9.93102 0.0235
NP_441486.1_1 Forward -165 -151 1.37622 0.112
NP_441486.1_1 Reverse -73 -87 -5.60527 0.248
NP_442634.1_4 Forward -58 -44 -4.62196 0.211
NP_442634.1_4 Reverse -335 -349 -5.01529 0.228
NP_440842.1_3 Forward -246 -227 16.4207 0.0926
NP_441014.1_10 Forward -163 -144 -1.37794 0.26
NP_442848.1_9 Forward -352 -333 0.786102 0.265
NP_443018.1_3 Forward -338 -331 7.11894 0.16
NP_443018.1_3 Forward -345 -338 5.15232 0.226
NP_443018.1_3 Reverse -154 -161 5.15232 0.226
NP_443018.1_3 Reverse -48 -55 5.15232 0.226
NP_443018.1_3 Forward -161 -154 5.05399 0.238
NP_443018.1_3 Forward -55 -48 5.05399 0.238
NP_443018.1_3 Reverse -338 -345 5.05399 0.238
NP_440376.1_1 Reverse -337 -346 9.83282 0.0339
NP_440376.1_1 Forward -162 -153 9.83282 0.0339
NP_440376.1_1 Forward -346 -337 9.73449 0.0365
NP_440376.1_1 Reverse -153 -162 9.73449 0.0365
NP_440376.1_1 Forward -189 -180 4.52295 0.156
NP_440376.1_1 Reverse -47 -56 0.196389 0.283
NP_440376.1_1 Forward -56 -47 -0.196935 0.285
NP_441857.1_5 Reverse -69 -87 4.6407 0.222
NP_441857.1_5 Reverse -330 -348 4.34571 0.222
NP_441588.1_4 Forward -54 -44 7.05986 0.178
NP_441588.1_4 Forward -344 -334 6.66654 0.185
NP_442687.1_1 Forward -19 -6 11.4251 0.279
NP_442687.1_7 Reverse -336 -346 17.5813 0.0089
NP_442687.1_7 Forward -163 -153 14.828 0.0247
NP_442687.1_7 Reverse -179 -189 9.41981 0.0994
NP_441846.1_10 Reverse -276 -295 -22.0267 0.257
NP_441846.1_10 Reverse -265 -284 -22.6167 0.264
NP_442658.1_1 Forward -58 -48 6.17443 0.235
NP_442658.1_1 Forward -164 -154 6.0761 0.238
NP_442658.1_1 Reverse -335 -345 4.99446 0.288
NP_440141.1_8 Reverse -349 -368 5.30933 0.276
NP_440141.1_8 Forward -171 -152 5.11266 0.278
NP_441855.2_4 Forward -266 -247 10.2943 0.257
NP_441414.1_9 Reverse -153 -172 -5.99873 0.185
NP_441256.1_8 Reverse -269 -288 1.86774 0.288
NP_442937.1_5 Reverse -278 -297 6.19431 0.286
NP_441958.1_5 Forward -347 -337 11.4848 0.00522
NP_441958.1_5 Reverse -336 -346 10.6981 0.0112
NP_441958.1_5 Forward -57 -47 10.1081 0.0166
NP_441958.1_5 Reverse -152 -162 2.53664 0.0409
NP_441958.1_5 Forward -163 -153 2.43831 0.0422
NP_441127.1_1 Forward -267 -253 8.55439 0.29
NP_440984.1_7 Reverse -71 -85 9.83269 0.127
NP_440984.1_7 Forward -61 -47 4.81781 0.287
NP_442911.1_2 Forward -172 -153 3.93269 0.0406
NP_442911.1_2 Forward -356 -337 -6.39206 0.182
NP_442911.1_2 Reverse -143 -162 -9.53865 0.258
NP_440153.1_5 Reverse -154 -168 8.35772 0.149
NP_440153.1_5 Reverse -338 -352 4.42448 0.199
NP_440496.1_9 Forward -228 -209 -4.42544 0.29
NP_440138.1_1 Forward -190 -172 8.17984 0.214
NP_441129.1_3 Reverse -176 -195 -17.4051 0.281
NP_441099.1_5 Reverse -143 -162 -4.42544 0.146
NP_441099.1_5 Forward -356 -337 -10.1286 0.243
NP_442002.1_1 Reverse -240 -258 -7.55234 0.251
NP_442002.1_1 Reverse -266 -284 -9.0273 0.272
NP_442002.1_9 Reverse -140 -147 9.77388 0.258
NP_441294.1_7 Reverse -333 -347 12.2263 0.107
NP_442438.1_10 Forward -167 -153 1.17956 0.204
NP_442438.1_10 Forward -90 -76 -0.590395 0.269
NP_441456.1_6 Forward -330 -311 8.06259 0.294
NP_440147.1_4 Reverse -335 -348 10.4424 0.0355
NP_440147.1_4 Reverse -45 -58 8.37742 0.0518
NP_440147.1_4 Forward -348 -335 7.59077 0.0657
NP_440147.1_4 Reverse -307 -320 0.707601 0.247
NP_440147.1_4 Reverse -102 -115 0.412608 0.255
NP_441175.1_7 Reverse -337 -356 18.1907 0.0564
NP_441550.1_8 Reverse -335 -345 15.1225 0.0132
NP_441550.1_8 Forward -348 -338 10.6976 0.0648
NP_441550.1_8 Forward -58 -48 7.64939 0.153
NP_441550.1_8 Reverse -151 -161 7.25606 0.169
NP_441916.1_7 Reverse -47 -57 9.91146 0.03
NP_441916.1_7 Reverse -337 -347 9.12481 0.0396
NP_441916.1_7 Reverse -153 -163 8.73149 0.042
NP_441916.1_7 Forward -346 -336 7.15819 0.0745
NP_441041.1_4 Forward -162 -143 -6.1954 0.164
NP_441041.1_7 Reverse -334 -346 11.6934 0.0733
NP_443063.1_6 Reverse -139 -158 21.5339 0.027
NP_441725.1_4 Forward -351 -337 11.602 0.0797
NP_441725.1_5 Forward -345 -335 2.04498 0.115
NP_441725.1_5 Reverse -154 -164 1.55333 0.133
NP_441725.1_5 Forward -161 -151 1.455 0.135
NP_441725.1_5 Reverse -48 -58 -0.806614 0.271
NP_439966.1_7 Forward -164 -154 8.63269 0.132
NP_439966.1_7 Reverse -151 -161 6.27276 0.185
NP_439966.1_7 Forward -348 -338 4.7978 0.258
NP_439966.1_7 Forward -58 -48 4.20782 0.285
NP_442941.1_3 Forward -161 -151 10.4031 0.018
NP_442941.1_3 Reverse -338 -348 9.7148 0.0286
NP_442941.1_3 Reverse -154 -164 8.92815 0.0326
NP_442941.1_3 Reverse -319 -329 2.83163 0.14
NP_442941.1_3 Reverse -48 -58 1.55333 0.15
NP_442941.1_3 Forward -345 -335 -0.0199663 0.244
NP_442941.1_3 Forward -55 -45 -1.00328 0.282
NP_440289.1_2 Forward -165 -152 2.18257 0.102
NP_440289.1_2 Forward -400 -387 -0.964025 0.218
NP_440289.1_2 Reverse -334 -347 -2.53732 0.259
NP_440289.1_2 Reverse -150 -163 -3.12731 0.265
NP_440289.1_2 Forward -349 -336 -3.71729 0.267
NP_440983.1_5 Forward -258 -239 3.44104 0.194
NP_440260.1_8 Forward -390 -372 -4.79907 0.273
NP_442281.1_1 Reverse -332 -346 11.1104 0.0507
NP_442281.1_1 Forward -61 -47 1.96562 0.282
NP_442901.1_1 Forward -167 -148 11.1109 0.248
NP_440437.1_1 Forward -168 -149 9.83255 0.0484
NP_440437.1_1 Forward -91 -72 -3.63879 0.242
NP_442012.1_1 Reverse -98 -117 4.62101 0.164
NP_441087.1_6 Forward -229 -211 -1.6532 0.27
NP_441556.1_2 Reverse -237 -255 20.6687 0.236
NP_441644.1_6 Forward -346 -336 12.4676 0.0321
NP_441644.1_6 Reverse -337 -347 9.22267 0.0819
NP_441644.1_6 Forward -162 -152 7.55106 0.123
NP_441644.1_6 Reverse -47 -57 6.96107 0.141
NP_441644.1_6 Reverse -153 -163 6.86274 0.144
NP_442215.1_2 Forward -348 -332 7.53169 0.0679
NP_442215.1_2 Reverse -151 -167 -4.26803 0.23
NP_442215.1_2 Forward -164 -148 -4.85801 0.24
NP_442029.1_10 Forward -197 -178 26.5488 0.00335
NP_440253.1_2 Forward -162 -144 9.36059 0.0491
NP_440253.1_2 Forward -189 -171 2.67408 0.133
NP_440253.1_2 Reverse -153 -171 -1.35749 0.238
NP_440929.1_8 Forward -346 -337 9.53783 0.0296
NP_440929.1_8 Reverse -153 -162 9.53783 0.0296
NP_440929.1_8 Reverse -337 -346 9.4395 0.0326
NP_440929.1_8 Forward -162 -153 9.4395 0.0326
NP_442933.1_10 Reverse -337 -346 13.9627 0.0192
NP_442933.1_10 Forward -162 -153 13.9627 0.0192
NP_442933.1_10 Reverse -47 -56 7.96454 0.0937
NP_442933.1_10 Reverse -153 -162 7.86621 0.103
NP_442933.1_10 Forward -346 -337 7.86621 0.103
NP_442933.1_10 Forward -56 -47 7.76787 0.11
NP_442933.1_10 Forward -85 -76 4.32629 0.257
NP_440430.1_5 Forward -210 -191 19.764 0.219
NP_441751.2_8 Forward -161 -147 -5.80194 0.239
NP_442554.1_8 Reverse -48 -58 16.4996 0.0065
NP_442554.1_8 Reverse -338 -348 7.74818 0.0846
NP_442554.1_8 Forward -161 -151 6.37155 0.12
NP_442554.1_8 Forward -84 -74 5.87989 0.135
NP_442554.1_8 Forward -345 -335 4.50326 0.184
NP_442554.1_8 Reverse -154 -164 4.10993 0.198
NP_441762.1_7 Reverse -46 -58 -5.36923 0.203
NP_441762.1_7 Forward -86 -74 -6.5492 0.284
NP_441762.1_7 Reverse -152 -164 -6.84419 0.284
NP_441762.1_7 Forward -190 -178 -7.53251 0.293
NP_441762.1_7 Forward -163 -151 -7.53251 0.293
NP_442313.1_5 Forward -194 -175 5.50599 0.256
NP_442142.1_4 Reverse -150 -163 12.7034 0.0423
NP_442292.1_1 Reverse -48 -57 15.4377 0.0122
NP_442292.1_1 Forward -161 -152 9.04618 0.0226
NP_442292.1_1 Reverse -338 -347 8.06287 0.0554
NP_442292.1_1 Forward -84 -75 6.5879 0.101
NP_442292.1_1 Reverse -154 -163 -0.0986038 0.239
NP_442292.1_1 Forward -345 -336 -0.196935 0.239
NP_442292.1_1 Forward -55 -46 -0.295266 0.24
NP_440919.1_7 Forward -200 -182 4.87249 0.287
NP_443009.1_5 Reverse -336 -347 13.1362 0.0376
NP_443009.1_5 Reverse -152 -163 9.10461 0.0965
NP_443009.1_5 Forward -347 -336 7.82632 0.118
NP_442250.1_5 Reverse -322 -333 16.7744 0.259
NP_441715.1_4 Reverse -154 -164 16.303 0.0117
NP_441715.1_4 Reverse -338 -348 7.55152 0.108
NP_441715.1_4 Reverse -48 -58 5.97822 0.165
NP_441715.1_4 Forward -161 -151 5.5849 0.197
NP_441715.1_4 Forward -55 -45 4.10993 0.299
NP_440379.1_5 Reverse -177 -196 -11.1119 0.288
NP_441468.1_1 Reverse -48 -55 13.0188 0.0383
NP_441468.1_1 Reverse -338 -345 6.3323 0.202
NP_441468.1_1 Forward -161 -154 6.3323 0.202
NP_441468.1_1 Forward -345 -338 6.13563 0.209
NP_441468.1_1 Reverse -154 -161 6.13563 0.209
NP_441468.1_1 Forward -55 -48 6.0373 0.223
NP_441020.2_6 Forward -58 -41 7.512 0.229
NP_441673.1_1 Forward -346 -337 11.1111 0.0121
NP_441673.1_1 Reverse -153 -162 11.1111 0.0121
NP_441673.1_1 Reverse -337 -346 11.0128 0.018
NP_441673.1_1 Forward -162 -153 11.0128 0.018
NP_441673.1_1 Reverse -47 -56 1.37636 0.114
NP_441673.1_1 Forward -56 -47 1.1797 0.163
NP_441826.1_2 Forward -168 -154 10.816 0.044
NP_441826.1_2 Reverse -331 -345 4.22782 0.104
NP_442868.1_6 Forward -348 -338 0.865012 0.205
NP_442868.1_6 Forward -286 -276 0.471689 0.226
NP_442868.1_6 Reverse -151 -161 0.373358 0.234
NP_442808.1_1 Forward -163 -153 8.82935 0.0481
NP_442808.1_1 Reverse -179 -189 4.89613 0.185
NP_442808.1_1 Reverse -123 -133 1.06124 0.296
NP_442775.1_6 Forward -351 -332 11.7008 0.277
NP_440145.1_3 Forward -356 -337 2.94938 0.111
NP_442542.1_2 Reverse -241 -254 4.64084 0.299
NP_442050.1_5 Forward -58 -48 7.55106 0.251
NP_442050.1_5 Reverse -151 -161 6.96107 0.27
NP_442342.1_9 Reverse -335 -351 2.51681 0.286
NP_441878.1_6 Reverse -336 -346 10.4031 0.0176
NP_441878.1_6 Forward -347 -337 0.766681 0.134
NP_441878.1_6 Reverse -152 -162 0.668351 0.139
NP_441878.1_6 Forward -163 -153 0.57002 0.14
NP_441878.1_6 Forward -190 -180 -7.39479 0.222
NP_441036.1_8 Forward -163 -153 8.92815 0.174
NP_441036.1_8 Reverse -46 -56 6.56821 0.225
NP_441036.1_8 Forward -347 -337 5.97822 0.246
NP_442503.1_9 Forward -367 -348 11.6025 0.179
NP_442503.1_9 Forward -190 -171 8.06259 0.233
NP_441557.1_5 Forward -346 -337 10.2261 0.0144
NP_441557.1_5 Reverse -153 -162 10.2261 0.0144
NP_441557.1_5 Reverse -337 -346 10.1278 0.0188
NP_441557.1_5 Forward -162 -153 10.1278 0.0188
NP_441557.1_5 Forward -56 -47 8.84951 0.0343
NP_441557.1_5 Reverse -47 -56 0.786375 0.106
NP_441557.1_5 Reverse -76 -85 -0.885252 0.26
NP_441445.1_1 Reverse -144 -163 9.24257 0.108
NP_442066.2_9 Forward -60 -47 10.5407 0.154
NP_442066.2_9 Forward -350 -337 10.4424 0.154
NP_441308.1_8 Forward -164 -154 12.0747 0.22
NP_442183.1_1 Reverse -47 -61 14.3559 0.0336
NP_441116.1_6 Forward -333 -314 7.86593 0.287
NP_441467.1_5 Reverse -138 -148 17.0896 0.213
NP_442347.1_2 Forward -161 -152 14.7494 0.056
NP_442347.1_2 Reverse -338 -347 5.60459 0.229
NP_442347.1_2 Reverse -154 -163 4.71961 0.266
NP_442645.1_2 Forward -354 -335 -2.85214 0.0487
NP_441037.1_4 Reverse -102 -112 9.75413 0.21
NP_441037.1_4 Reverse -335 -345 7.61007 0.237
NP_441037.1_4 Forward -58 -48 7.02532 0.237
NP_442317.1_6 Reverse -42 -61 3.14605 0.264
NP_441633.1_3 Forward -348 -335 3.46087 0.0699
NP_441633.1_3 Reverse -151 -164 -0.964025 0.151
NP_441633.1_3 Reverse -45 -58 -5.97891 0.236
NP_441633.1_3 Forward -164 -151 -6.07724 0.236
NP_441633.1_3 Forward -191 -178 -6.2739 0.242
NP_440136.1_2 Reverse -48 -55 6.52896 0.116
NP_440136.1_2 Forward -161 -154 6.43063 0.154
NP_440136.1_2 Reverse -338 -345 6.43063 0.154
NP_440136.1_2 Forward -345 -338 6.23397 0.171
NP_440136.1_2 Reverse -154 -161 6.23397 0.171
NP_440136.1_2 Forward -55 -48 6.13563 0.193
NP_442998.1_5 Reverse -190 -200 10.9931 0.199
NP_442998.1_10 Reverse -49 -56 12.3305 0.0564
NP_442998.1_10 Reverse -339 -346 5.93897 0.206
NP_442998.1_10 Forward -160 -153 5.93897 0.206
NP_442998.1_10 Forward -344 -337 5.84064 0.235
NP_442998.1_10 Reverse -155 -162 5.84064 0.235
NP_440299.1_1 Forward -166 -153 10.7368 0.0541
NP_440299.1_1 Forward -89 -76 2.47701 0.288
NP_441799.1_1 Reverse -43 -57 13.5686 0.0311
NP_441799.1_1 Reverse -149 -163 8.45543 0.114
NP_441799.1_4 Reverse -364 -383 -5.99873 0.249
NP_441007.1_10 Forward -61 -48 0.805932 0.216
NP_440256.1_1 Reverse -150 -169 15.1424 0.00705
NP_440256.1_1 Reverse -334 -353 -2.75381 0.122
NP_440256.1_1 Forward -349 -330 -6.68705 0.217
NP_441559.1_8 Forward -194 -180 -0.393733 0.175
NP_441559.1_8 Forward -351 -337 -5.01529 0.245
NP_442860.1_7 Forward -367 -349 9.67299 0.283
NP_440915.1_6 Forward -350 -336 8.55439 0.0533
NP_440915.1_6 Reverse -333 -347 5.70279 0.0879
NP_440915.1_6 Reverse -245 -259 -2.75368 0.28
NP_441179.1_4 Reverse -180 -199 10.52 0.225
NP_440717.1_3 Forward -297 -283 8.16044 0.27
NP_440306.1_9 Forward -375 -356 12.2908 0.208
NP_440695.1_5 Reverse -153 -172 2.75272 0.252
NP_441494.1_6 Reverse -317 -330 8.57408 0.23
NP_442993.1_1 Forward -162 -146 -8.39793 0.166
NP_442386.1_9 Forward -163 -154 6.29249 0.226
NP_442386.1_9 Reverse -46 -55 5.50585 0.25
NP_440570.1_5 Forward -225 -206 6.78429 0.183
NP_441340.1_5 Forward -345 -338 5.93897 0.198
NP_441340.1_5 Reverse -154 -161 5.93897 0.198
NP_441340.1_5 Reverse -48 -55 5.93897 0.198
NP_441340.1_5 Reverse -338 -345 5.84064 0.208
NP_441340.1_5 Forward -161 -154 5.84064 0.208
NP_441340.1_5 Forward -55 -48 5.84064 0.208
NP_441947.1_4 Reverse -326 -345 17.3057 0.0942
NP_440327.1_6 Reverse -319 -338 10.0292 0.201
NP_442240.1_2 Reverse -338 -357 -13.8652 0.173
NP_442950.1_1 Forward -211 -192 -5.80207 0.285
NP_440586.1_8 Forward -345 -338 11.1501 0.0845
NP_440586.1_8 Reverse -154 -161 11.1501 0.0845
NP_442251.1_6 Forward -345 -338 13.7071 0.0268
NP_442251.1_6 Reverse -154 -161 13.7071 0.0268
NP_442251.1_6 Reverse -48 -55 13.0188 0.0408
NP_443051.1_1 Forward -347 -338 9.83282 0.0203
NP_443051.1_1 Forward -57 -48 9.73449 0.0265
NP_443051.1_1 Reverse -336 -345 8.25953 0.0414
NP_443051.1_1 Reverse -152 -161 0.688044 0.134
NP_443051.1_1 Forward -163 -154 0.589713 0.143
NP_439937.1_9 Reverse -180 -197 -17.268 0.296
NP_440439.1_1 Forward -349 -336 3.06754 0.121
NP_440372.1_2 Forward -345 -338 6.62729 0.151
NP_440372.1_2 Reverse -154 -161 6.62729 0.151
NP_440372.1_2 Reverse -48 -55 6.62729 0.151
NP_440372.1_2 Reverse -338 -345 6.52896 0.188
NP_440372.1_2 Forward -161 -154 6.52896 0.188
NP_440372.1_2 Forward -55 -48 6.52896 0.188
NP_441803.1_2 Forward -351 -332 6.58763 0.151
NP_439977.1_5 Forward -352 -333 1.67108 0.19
NP_441572.1_7 Reverse -331 -350 0.884433 0.159
NP_442384.1_10 Reverse -337 -350 18.1122 0.00545
NP_442384.1_10 Reverse -153 -166 12.8023 0.0249
NP_442384.1_10 Forward -346 -333 7.39411 0.0822
NP_442384.1_10 Forward -300 -287 0.215946 0.297
NP_442262.1_10 Reverse -48 -55 10.6589 0.14
NP_442262.1_10 Forward -338 -331 8.20058 0.25
NP_441689.1_5 Reverse -151 -161 5.78111 0.197
NP_441689.1_5 Forward -329 -319 5.68278 0.215
NP_441689.1_5 Reverse -45 -55 5.48612 0.251
NP_440344.1_10 Reverse -330 -347 -1.23946 0.0516
NP_440344.1_10 Forward -169 -152 -5.27103 0.105
NP_440344.1_10 Reverse -146 -163 -10.1876 0.17
NP_440282.1_2 Forward -310 -291 12.8808 0.134
NP_442910.1_1 Reverse -330 -349 2.3594 0.118
NP_442910.1_1 Reverse -97 -116 -5.50708 0.254
NP_440562.1_3 Forward -55 -38 4.07041 0.204
NP_441965.1_10 Forward -59 -43 5.6634 0.199
NP_442693.1_7 Reverse -173 -192 8.45592 0.273
NP_440297.1_9 Forward -345 -335 -0.118297 0.282
NP_440297.1_9 Reverse -154 -164 -0.41329 0.283
NP_440297.1_9 Forward -161 -151 -0.511621 0.289
NP_441896.1_3 Forward -355 -336 -2.26216 0.28
NP_440999.1_2 Reverse -142 -161 9.0459 0.285
NP_440999.1_9 Forward -166 -152 6.58777 0.0964
NP_440999.1_9 Reverse -333 -347 3.04785 0.137
NP_440888.1_2 Reverse -337 -351 14.4536 0.0176
NP_440888.1_2 Forward -162 -148 14.0603 0.0211
NP_440888.1_2 Reverse -153 -167 11.1104 0.0757
NP_440888.1_2 Reverse -47 -61 9.24208 0.134
NP_440600.1_4 Reverse -39 -57 -3.71743 0.24
NP_440179.1_6 Forward -55 -36 4.81767 0.246
NP_440052.1_5 Reverse -326 -345 -2.26216 0.212
NP_441949.1_2 Reverse -143 -162 4.03102 0.261
NP_441543.1_2 Reverse -154 -163 15.4377 0.00784
NP_441543.1_2 Forward -161 -152 7.07956 0.131
NP_441543.1_2 Forward -345 -336 6.29291 0.153
NP_441543.1_2 Reverse -48 -57 6.19458 0.153
NP_441543.1_2 Reverse -338 -347 6.09625 0.153
NP_441543.1_2 Forward -55 -46 4.22796 0.267
NP_442845.1_2 Reverse -243 -257 9.14437 0.18
NP_441834.1_1 Forward -356 -337 16.0274 0.216
NP_441469.1_8 Forward -163 -154 6.68623 0.227
NP_442637.1_9 Forward -276 -257 8.65258 0.284
NP_443064.1_6 Forward -346 -336 17.7057 0.065
NP_443064.1_6 Reverse -153 -163 8.6886 0.276
NP_442578.1_7 Forward -345 -338 12.5271 0.0544
NP_442578.1_7 Reverse -154 -161 12.5271 0.0544
NP_442578.1_7 Forward -55 -48 5.15232 0.291
NP_440710.1_1 Forward -354 -336 -1.94747 0.188
NP_441462.1_2 Forward -346 -336 10.4031 0.011
NP_441462.1_2 Reverse -337 -347 10.4031 0.011
NP_441462.1_2 Reverse -153 -163 1.84832 0.081
NP_441462.1_2 Forward -162 -152 1.74999 0.0811
NP_441462.1_2 Reverse -47 -57 0.766681 0.125
NP_441462.1_2 Forward -56 -46 0.766681 0.125
NP_441462.1_2 Reverse -76 -86 -0.41329 0.225
NP_441462.1_5 Reverse -280 -299 0.392778 0.296
NP_441621.1_7 Reverse -178 -192 -4.4253 0.223
NP_443062.1_1 Reverse -47 -65 5.71821 0.22
NP_443062.1_6 Reverse -145 -164 2.0644 0.262
NP_442204.1_1 Forward -350 -339 1.92696 0.266
NP_442204.1_5 Reverse -327 -346 8.16093 0.122
NP_442204.1_5 Forward -172 -153 2.26107 0.214
NP_440516.1_8 Forward -346 -337 7.17789 0.0754
NP_440516.1_8 Reverse -153 -162 7.17789 0.0754
NP_440516.1_8 Forward -162 -153 7.07956 0.0867
NP_440516.1_8 Reverse -337 -346 7.07956 0.0867
NP_440516.1_8 Forward -56 -47 -0.393597 0.255
NP_441785.1_1 Forward -162 -148 11.6718 0.289
NP_442428.1_5 Reverse -338 -345 13.1171 0.038
NP_442428.1_5 Forward -161 -154 13.1171 0.038
NP_442428.1_5 Forward -380 -373 7.90559 0.0969
NP_442428.1_5 Reverse -48 -55 6.3323 0.193
NP_442428.1_5 Forward -345 -338 6.23397 0.201
NP_442428.1_5 Reverse -154 -161 6.23397 0.201
NP_442428.1_5 Forward -55 -48 6.13563 0.209
NP_440783.1_8 Reverse -313 -332 10.2251 0.229
NP_442859.1_2 Reverse -338 -357 13.4708 0.0942
NP_442120.1_10 Reverse -226 -245 -1.47551 0.171
NP_440673.1_3 Reverse -339 -346 10.1672 0.149
NP_440673.1_3 Forward -160 -153 10.1672 0.149
NP_440673.1_3 Forward -371 -364 7.51227 0.252
NP_441052.1_2 Forward -162 -152 17.6796 0.00337
NP_441052.1_2 Reverse -337 -347 8.1415 0.0503
NP_441052.1_2 Reverse -153 -163 7.45319 0.0712
NP_441052.1_2 Forward -346 -336 7.35486 0.0742
NP_441052.1_2 Forward -56 -46 0.766681 0.256
NP_442219.1_9 Forward -161 -152 14.5527 0.0295
NP_442219.1_9 Forward -55 -46 8.84951 0.0681
NP_442219.1_9 Reverse -338 -347 5.01461 0.193
NP_440436.1_4 Reverse -154 -163 8.65242 0.0997
NP_440436.1_4 Forward -161 -152 7.37413 0.132
NP_440436.1_4 Forward -257 -248 6.78414 0.147
NP_440436.1_4 Forward -345 -336 6.39082 0.162
NP_440436.1_4 Forward -55 -46 6.29249 0.164
NP_440436.1_4 Forward -84 -75 4.22755 0.277
NP_441884.1_9 Forward -59 -40 -22.9117 0.284
NP_440314.1_9 Reverse -48 -67 -0.295539 0.106
NP_441719.1_4 Forward -345 -338 6.62729 0.151
NP_441719.1_4 Reverse -154 -161 6.62729 0.151
NP_441719.1_4 Reverse -48 -55 6.62729 0.151
NP_441719.1_4 Reverse -338 -345 6.52896 0.188
NP_441719.1_4 Forward -161 -154 6.52896 0.188
NP_441719.1_4 Forward -55 -48 6.52896 0.188
NP_441733.1_10 Reverse -73 -86 7.88576 0.148
NP_441733.1_10 Forward -59 -46 5.72248 0.208
NP_442366.1_3 Forward -163 -145 0.0191479 0.181
NP_442366.1_5 Reverse -101 -111 9.91099 0.298
NP_441115.1_4 Reverse -152 -170 10.2448 0.183
NP_441115.1_4 Forward -347 -329 8.86816 0.234
NP_442206.1_4 Reverse -319 -338 9.83255 0.234
NP_442206.1_10 Forward -56 -41 4.99478 0.178
NP_440094.1_9 Reverse -152 -171 -1.96717 0.21
NP_443054.1_2 Forward -348 -334 6.78443 0.18
NP_443054.1_2 Forward -191 -177 0.392915 0.267
NP_441851.1_10 Reverse -336 -346 8.1415 0.122
NP_441851.1_10 Forward -163 -153 6.66654 0.159
NP_441851.1_10 Reverse -152 -162 6.46988 0.167
NP_442515.1_1 Reverse -152 -166 3.73617 0.115
NP_442515.1_1 Reverse -46 -60 -4.91696 0.298
NP_440432.1_9 Reverse -48 -63 5.87976 0.0501
NP_440432.1_9 Forward -345 -330 -3.26502 0.179
NP_440432.1_9 Forward -84 -69 -3.36336 0.179
NP_442843.1_1 Reverse -250 -269 -11.7019 0.291
NP_442450.1_5 Reverse -335 -345 15.3197 0.0845
NP_442450.1_5 Forward -164 -154 7.25653 0.139
NP_440588.1_2 Forward -198 -179 -4.03212 0.203
NP_440588.1_2 Reverse -328 -347 -4.91709 0.233
NP_442006.1_2 Forward -340 -323 -10.7776 0.197
NP_442243.1_1 Forward -352 -334 -1.75153 0.279
NP_441570.1_1 Forward -162 -144 -11.3872 0.194
NP_441078.1_4 Forward -346 -337 10.1278 0.016
NP_441078.1_4 Reverse -153 -162 10.1278 0.016
NP_441078.1_4 Reverse -337 -346 9.83282 0.0226
NP_441078.1_4 Forward -162 -153 9.83282 0.0226
NP_441078.1_4 Reverse -47 -56 0.196389 0.205
NP_441078.1_4 Forward -56 -47 0.196389 0.205
NP_441078.1_4 Forward -189 -180 -1.96689 0.282
NP_442729.1_8 Forward -166 -153 9.75405 0.125
NP_441663.1_7 Forward -165 -146 3.6377 0.295
NP_440526.1_3 Forward -84 -73 8.71129 0.116
NP_440526.1_3 Forward -345 -334 2.02482 0.267
NP_440526.1_3 Reverse -105 -116 0.746521 0.271
NP_440526.1_3 Forward -161 -150 0.353199 0.287
NP_441432.1_8 Reverse -152 -161 13.7661 0.0281
NP_441432.1_8 Forward -347 -338 13.7661 0.0281
NP_441432.1_8 Forward -57 -48 7.17789 0.102
NP_441432.1_8 Reverse -363 -372 5.11294 0.187
NP_442320.1_8 Forward -62 -48 4.71948 0.0472
NP_442320.1_8 Forward -168 -154 3.73617 0.0578
NP_442320.1_8 Reverse -331 -345 -3.93365 0.136
NP_442320.1_8 Reverse -147 -161 -5.11362 0.206
NP_442320.1_8 Reverse -174 -188 -5.31028 0.217
NP_442320.1_8 Forward -91 -77 -5.9986 0.261
NP_442320.1_8 Reverse -70 -84 -6.29359 0.277
NP_441732.1_2 Reverse -85 -101 -8.49626 0.144
NP_441732.1_2 Forward -166 -150 -15.8711 0.163
NP_441732.1_2 Forward -89 -73 -16.9527 0.223
NP_441030.1_6 Reverse -335 -354 17.3761 0.155
NP_440760.1_1 Reverse -337 -356 7.47261 0.0115
NP_440760.1_1 Reverse -258 -277 -21.24 0.233
NP_440199.1_10 Reverse -150 -160 14.9263 0.0861
NP_440199.1_10 Reverse -361 -371 8.1415 0.231
NP_442624.1_3 Forward -377 -363 12.586 0.293
NP_442489.1_7 Reverse -153 -162 10.4228 0.0151
NP_442489.1_7 Forward -346 -337 10.4228 0.0151
NP_442489.1_7 Reverse -337 -346 10.3245 0.0193
NP_442489.1_7 Forward -162 -153 10.3245 0.0193
NP_442489.1_7 Reverse -47 -56 0.688044 0.152
NP_442489.1_7 Forward -56 -47 0.491382 0.178
NP_442489.1_7 Forward -189 -180 -1.27858 0.185
NP_440559.1_1 Forward -55 -46 7.66954 0.0999
NP_440559.1_1 Forward -345 -336 7.57121 0.106
NP_440559.1_1 Forward -161 -152 7.57121 0.106
NP_440559.1_1 Reverse -77 -86 4.32629 0.288
NP_441659.2_8 Reverse -337 -347 11.0914 0.0207
NP_441659.2_8 Forward -346 -336 9.61647 0.0284
NP_441659.2_8 Reverse -47 -57 8.92815 0.0381
NP_441659.2_8 Forward -162 -152 8.33817 0.0443
NP_441659.2_8 Forward -85 -75 2.83163 0.187
NP_441659.2_8 Reverse -153 -163 2.24165 0.207
NP_442913.1_10 Reverse -328 -347 -4.72043 0.244
NP_441040.1_2 Forward -198 -179 2.85105 0.119
NP_441040.1_2 Reverse -176 -195 -15.5368 0.286
NP_442776.1_6 Forward -58 -39 11.4058 0.195
NP_440779.1_5 Forward -85 -68 -6.25434 0.17
NP_442346.1_5 Reverse -336 -346 13.5497 0.0226
NP_442346.1_5 Reverse -152 -162 13.353 0.0261
NP_442346.1_5 Forward -347 -337 12.9597 0.0318
NP_442346.1_5 Forward -57 -47 6.17489 0.212
NP_442346.1_5 Reverse -46 -56 4.89658 0.269
NP_442346.1_5 Forward -86 -76 4.79825 0.272
NP_442346.1_5 Forward -163 -153 4.60159 0.281
NP_440352.1_5 Forward -344 -325 18.8853 0.0454
NP_440352.1_5 Forward -316 -297 11.877 0.25
NP_440545.1_3 Reverse -333 -350 -4.18939 0.22
NP_440459.1_2 Forward -348 -331 11.6419 0.169
NP_440010.1_4 Reverse -149 -168 -1.47628 0.267
NP_440847.1_3 Reverse -323 -337 13.372 0.217
NP_442603.1_7 Reverse -153 -167 11.307 0.117
NP_442603.1_7 Reverse -76 -90 6.98048 0.221
NP_440449.1_6 Reverse -329 -347 12.5354 0.114
NP_440170.1_6 Forward -351 -332 18.0924 0.0969
NP_440170.1_6 Forward -285 -266 12.6841 0.283
NP_441833.1_4 Reverse -48 -55 12.9205 0.0393
NP_441833.1_4 Reverse -338 -345 6.3323 0.134
NP_441833.1_4 Forward -161 -154 6.3323 0.134
NP_441833.1_4 Forward -345 -338 6.23397 0.163
NP_441833.1_4 Reverse -154 -161 6.23397 0.163
NP_441833.1_4 Forward -55 -48 6.13563 0.198
NP_442162.1_9 Forward -345 -338 6.52896 0.178
NP_442162.1_9 Reverse -154 -161 6.52896 0.178
NP_442162.1_9 Reverse -48 -55 6.52896 0.178
NP_442162.1_9 Reverse -338 -345 6.43063 0.208
NP_442162.1_9 Forward -161 -154 6.43063 0.208
NP_442162.1_9 Forward -55 -48 6.43063 0.208
NP_440671.1_4 Forward -168 -154 6.29277 0.252
NP_440017.1_3 Forward -339 -320 5.60432 0.139
NP_442199.1_5 Forward -64 -45 3.73603 0.12
NP_442199.1_5 Forward -197 -178 -1.08219 0.18
NP_442140.1_3 Forward -188 -178 4.89658 0.238
NP_442140.1_3 Forward -345 -335 3.81494 0.278
NP_441813.1_5 Forward -348 -338 8.4365 0.0432
NP_441813.1_5 Forward -164 -154 7.35486 0.0762
NP_441813.1_5 Reverse -151 -161 6.17489 0.1
NP_440590.1_4 Reverse -338 -351 1.78924 0.111
NP_440590.1_4 Reverse -154 -167 1.78924 0.111
NP_440590.1_4 Forward -345 -332 1.10092 0.133
NP_440590.1_4 Forward -161 -148 -4.79893 0.267
NP_440567.1_1 Forward -345 -331 4.81781 0.111
NP_440567.1_1 Forward -55 -41 0.294584 0.25
NP_442497.1_10 Forward -345 -336 10.1278 0.0166
NP_442497.1_10 Reverse -48 -57 7.86621 0.0695
NP_442497.1_10 Reverse -338 -347 7.76787 0.0731
NP_442497.1_10 Reverse -154 -163 0.688044 0.141
NP_442497.1_10 Forward -161 -152 0.589713 0.153
NP_440821.1_4 Forward -164 -154 9.41981 0.0286
NP_440821.1_4 Reverse -151 -161 8.53483 0.0468
NP_440821.1_4 Reverse -335 -345 1.35667 0.137
NP_440821.1_4 Forward -58 -48 0.963343 0.145
NP_440821.1_10 Forward -312 -294 17.6426 0.237
NP_441239.1_9 Forward -348 -336 6.82381 0.175
NP_441239.1_9 Forward -191 -179 5.93884 0.202
NP_441239.1_9 Forward -164 -152 3.67722 0.279
NP_441727.1_3 Forward -63 -44 5.01433 0.257
NP_442270.1_9 Reverse -65 -84 -7.86702 0.214
NP_442216.1_4 Reverse -391 -399 8.08217 0.255
NP_442138.1_10 Forward -162 -143 -7.08038 0.286
NP_440546.1_4 Reverse -249 -259 9.3673 0.142
NP_440546.1_4 Forward -56 -46 8.10685 0.203
NP_440462.1_6 Forward -58 -48 9.61647 0.0429
NP_440462.1_6 Forward -348 -338 9.02648 0.0498
NP_440462.1_6 Forward -164 -154 5.97822 0.135
NP_442039.1_4 Reverse -48 -55 11.3472 0.086
NP_442039.1_7 Forward -187 -177 7.55152 0.275
NP_441811.1_8 Forward -387 -373 10.3243 0.22
NP_441180.1_2 Forward -335 -316 13.7718 0.287
NP_442679.1_3 Forward -38 -20 1.39578 0.265
NP_441926.1_3 Forward -162 -146 3.50012 0.219
NP_441926.1_3 Forward -373 -357 2.71347 0.257
NP_442837.1_3 Reverse -338 -345 13.5105 0.0268
NP_442837.1_3 Forward -161 -154 13.5105 0.0268
NP_442837.1_3 Reverse -48 -55 6.52896 0.2
NP_442837.1_3 Forward -326 -319 6.52896 0.2
NP_442837.1_3 Reverse -154 -161 6.13563 0.25
NP_442837.1_3 Forward -345 -338 6.13563 0.25
NP_442837.1_3 Forward -55 -48 6.0373 0.25
NP_442053.1_1 Forward -346 -337 8.75118 0.0728
NP_442053.1_1 Reverse -153 -162 8.75118 0.0728
NP_442053.1_1 Reverse -337 -346 8.65285 0.0741
NP_442053.1_1 Forward -162 -153 8.65285 0.0741
NP_442053.1_1 Forward -56 -47 5.60459 0.176
NP_440505.1_3 Forward -348 -338 7.55152 0.151
NP_440505.1_3 Reverse -151 -161 6.66654 0.172
NP_440505.1_3 Forward -58 -48 5.68323 0.217
NP_440505.1_3 Forward -164 -154 4.69992 0.272
NP_440505.1_7 Forward -193 -174 -1.27885 0.272
NP_442532.1_7 Reverse -337 -351 4.32615 0.174
NP_440914.1_1 Forward -162 -152 7.83437 0.219
NP_440914.1_1 Reverse -153 -163 6.76087 0.267
NP_440914.1_1 Forward -346 -336 6.66328 0.269
NP_440914.1_1 Reverse -337 -347 6.56569 0.273
NP_440914.1_1 Forward -56 -46 6.07773 0.297
NP_441011.1_8 Reverse -338 -347 13.8644 0.0295
NP_441011.1_8 Reverse -154 -163 7.27622 0.179
NP_441011.1_8 Reverse -48 -57 7.07956 0.179
NP_441011.1_8 Forward -161 -152 5.50626 0.256
NP_442533.1_6 Forward -346 -337 14.651 0.01
NP_442533.1_6 Reverse -153 -162 14.651 0.01
NP_442533.1_6 Reverse -337 -346 7.37455 0.0898
NP_442533.1_6 Forward -162 -153 7.37455 0.0898
NP_442533.1_6 Forward -56 -47 6.19458 0.115
NP_442533.1_6 Forward -189 -180 3.93297 0.197
NP_441482.1_7 Forward -352 -338 14.2576 0.0125
NP_441482.1_7 Forward -168 -154 -1.5737 0.0755
NP_439944.1_9 Forward -161 -151 9.22315 0.1
NP_439944.1_9 Reverse -48 -58 8.04317 0.121
NP_439944.1_9 Forward -84 -74 7.45319 0.141
NP_439944.1_9 Forward -55 -45 4.99491 0.284
NP_441028.1_6 Forward -299 -289 3.8145 0.281
NP_441527.1_4 Forward -32 -13 -12.3666 0.285
NP_440007.1_9 Reverse -333 -347 2.65453 0.277
NP_441680.1_4 Forward -256 -237 -3.24547 0.288
NP_441059.1_1 Forward -338 -319 6.19431 0.179
NP_441602.1_3 Forward -351 -332 -2.45882 0.233
NP_441972.1_5 Forward -345 -326 -3.73712 0.201
NP_441106.1_1 Forward -347 -338 8.75118 0.0469
NP_441106.1_1 Forward -57 -48 8.65285 0.0522
NP_441106.1_1 Forward -163 -154 8.35786 0.0585
NP_442306.1_10 Forward -194 -175 -12.9802 0.195
NP_441286.1_1 Reverse -152 -164 4.75886 0.0287
NP_441286.1_1 Forward -163 -151 2.0056 0.0758
NP_441286.1_1 Forward -347 -335 -3.6976 0.146
NP_441286.1_1 Reverse -46 -58 -4.18925 0.152
NP_441286.1_1 Reverse -75 -87 -4.87757 0.18
NP_440670.1_8 Reverse -153 -162 8.84951 0.0606
NP_440670.1_8 Forward -346 -337 8.84951 0.0606
NP_440670.1_8 Reverse -337 -346 8.55452 0.066
NP_440670.1_8 Forward -162 -153 8.55452 0.066
NP_440670.1_8 Forward -56 -47 5.70292 0.14
NP_440670.1_8 Reverse -76 -85 3.83464 0.219
NP_440670.1_8 Forward -267 -258 3.34298 0.275
NP_440886.1_7 Forward -163 -153 7.94438 0.0805
NP_440886.1_7 Forward -347 -337 7.45273 0.093
NP_440886.1_7 Reverse -152 -162 7.35439 0.0966
NP_442072.1_9 Reverse -336 -354 -14.6322 0.153
NP_442072.1_9 Reverse -152 -170 -15.2222 0.174
NP_440907.2_8 Reverse -48 -58 9.616 0.103
NP_440907.2_8 Forward -345 -335 7.0594 0.132
NP_441021.1_1 Forward -161 -142 -7.08038 0.181
NP_441463.1_3 Forward -66 -47 5.99764 0.0683
NP_441463.1_3 Reverse -170 -189 -2.0655 0.149
NP_441463.1_3 Forward -172 -153 -7.4737 0.258
NP_441463.1_3 Reverse -143 -162 -9.73531 0.284
NP_440501.1_4 Reverse -258 -277 -7.86702 0.296
NP_441626.1_2 Forward -345 -338 6.0373 0.212
NP_441626.1_2 Reverse -154 -161 6.0373 0.212
NP_441626.1_2 Reverse -48 -55 6.0373 0.212
NP_441626.1_2 Reverse -338 -345 5.93897 0.231
NP_441626.1_2 Forward -161 -154 5.93897 0.231
NP_441626.1_2 Forward -55 -48 5.93897 0.231
NP_442794.1_1 Forward -166 -154 5.05386 0.236
NP_442615.1_1 Forward -65 -47 3.55906 0.0536
NP_442615.1_1 Reverse -38 -56 1.10079 0.0906
NP_442615.1_1 Reverse -328 -346 -6.07737 0.233
NP_441962.1_4 Forward -272 -253 -10.4236 0.228
NP_440387.1_1 Reverse -337 -353 5.46674 0.0322
NP_440387.1_1 Forward -56 -40 2.41848 0.0807
NP_440387.1_1 Reverse -153 -169 -3.67804 0.164
NP_441488.1_7 Forward -352 -333 1.47442 0.293
NP_441993.1_1 Reverse -331 -350 11.0102 0.121
NP_441993.1_1 Reverse -277 -296 1.75177 0.27
NP_439988.1_3 Reverse -272 -286 4.42448 0.295
NP_441237.1_9 Reverse -276 -286 10.5998 0.224
NP_442743.1_4 Forward -345 -326 -7.37537 0.279
NP_439910.1_2 Reverse -145 -162 -2.91109 0.0305
NP_441984.1_3 Forward -350 -332 5.42735 0.286
NP_442509.1_9 Forward -346 -336 8.3377 0.192
NP_442509.1_9 Forward -162 -152 8.04271 0.192
NP_442509.1_9 Reverse -337 -347 7.94438 0.195
NP_442509.1_9 Reverse -153 -163 7.15773 0.234
NP_440554.1_4 Reverse -48 -58 12.1731 0.0349
NP_440554.1_4 Reverse -338 -348 8.33817 0.0773
NP_440554.1_4 Reverse -154 -164 4.89658 0.171
NP_442862.1_3 Forward -200 -183 9.08529 0.232
NP_441885.1_5 Forward -162 -152 11.0914 0.00874
NP_441885.1_5 Forward -56 -46 10.1081 0.0145
NP_441885.1_5 Reverse -153 -163 2.04498 0.0868
NP_441885.1_5 Forward -346 -336 1.94665 0.0935
NP_441885.1_5 Reverse -337 -347 1.55333 0.109
NP_442341.1_7 Reverse -152 -166 18.1908 0.0111
NP_442341.1_7 Forward -347 -333 7.47274 0.105
NP_442341.1_9 Forward -348 -334 17.0102 0.0319
NP_442341.1_9 Forward -164 -150 4.91554 0.287
NP_442395.2_4 Reverse -179 -198 5.11187 0.169
NP_443000.1_7 Forward -348 -338 17.4829 0.00719
NP_443000.1_7 Reverse -151 -161 14.238 0.0256
NP_443000.1_7 Forward -164 -154 5.87989 0.126
NP_443000.1_7 Forward -58 -48 1.16001 0.271
NP_441842.1_10 Forward -63 -49 9.34103 0.192
NP_440275.1_3 Forward -58 -48 8.82982 0.0602
NP_440275.1_3 Forward -348 -338 6.37155 0.111
NP_440275.1_3 Reverse -74 -84 4.99491 0.167
NP_440091.1_1 Reverse -149 -161 13.412 0.0276
NP_440091.1_1 Reverse -72 -84 6.82381 0.0912
NP_443060.1_5 Reverse -329 -348 10.6184 0.175
NP_442451.1_2 Reverse -314 -333 -10.817 0.28
NP_440149.1_8 Reverse -153 -172 -5.01543 0.218
NP_440149.1_8 Forward -162 -143 -5.9004 0.235
NP_440149.1_8 Reverse -147 -166 -6.49039 0.253
NP_440149.1_8 Forward -85 -66 -6.98204 0.268
NP_441105.1_3 Forward -357 -338 -6.09707 0.229
NP_441105.1_3 Forward -67 -48 -8.45701 0.272
NP_441105.1_3 Reverse -238 -257 -8.65367 0.275
NP_441105.1_3 Forward -173 -154 -9.34199 0.288
NP_440216.1_1 Forward -346 -332 -1.37704 0.0312
NP_440216.1_1 Reverse -153 -167 -2.45868 0.0513
NP_440216.1_1 Reverse -337 -351 -2.85201 0.0608
NP_440216.1_1 Forward -318 -304 -5.60527 0.133
NP_440216.1_1 Forward -162 -148 -11.6035 0.203
NP_440216.1_1 Reverse -180 -194 -12.2918 0.256
NP_440216.1_9 Forward -337 -328 6.48957 0.289
NP_440172.1_1 Forward -56 -46 15.418 0.00945
NP_440172.1_1 Forward -346 -336 13.4514 0.021
NP_440172.1_1 Reverse -337 -347 7.74818 0.0738
NP_440172.1_1 Reverse -76 -86 7.15819 0.0897
NP_440172.1_1 Reverse -153 -163 5.87989 0.127
NP_440172.1_1 Forward -162 -152 5.19158 0.149
NP_442015.1_10 Reverse -333 -346 9.65572 0.0468
NP_442015.1_10 Forward -166 -153 7.98409 0.074
NP_442015.1_10 Forward -350 -337 1.9859 0.204
NP_441226.1_7 Reverse -181 -188 9.47853 0.147
NP_441111.1_7 Forward -345 -337 8.96754 0.0463
NP_441111.1_7 Reverse -154 -162 8.96754 0.0463
NP_441111.1_7 Reverse -48 -56 8.96754 0.0463
NP_441111.1_7 Reverse -338 -346 8.86921 0.0589
NP_441111.1_7 Forward -161 -153 8.86921 0.0589
NP_441766.1_2 Forward -56 -47 14.0611 0.0111
NP_441766.1_2 Reverse -153 -162 7.86621 0.0703
NP_441766.1_2 Forward -346 -337 7.86621 0.0703
NP_441766.1_2 Reverse -337 -346 7.66954 0.0723
NP_441766.1_2 Forward -162 -153 7.66954 0.0723
NP_441766.1_2 Reverse -76 -85 4.42462 0.181
NP_442417.1_5 Reverse -153 -167 10.9143 0.109
NP_443052.1_8 Reverse -143 -162 -9.93197 0.198
NP_440072.1_5 Reverse -243 -261 2.18243 0.236
NP_442116.1_6 Reverse -13 -30 5.2087 0.299
NP_440261.1_5 Forward -345 -332 -10.4038 0.201
NP_440988.1_10 Forward -269 -255 5.18926 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGGGAGTTAGACCGTTTTTGTGATGCCATGATTGCCATTTACCAAGAAGCTCAGGCGATCACCCATGGAGAAATTGATCCCGCTGATAACCCGTTGAAAAATGCTCCCCATACGGCCCAATCCCTCATCTGTGGCGAATGGAACCATCCCTACAGCCAGGAAGAAGCTGCTTACCCTGCTCCTTGGACTAAGCAGTTTAAATTTTGGCCCGCCGTTGGCCGCATTAATAATACCTACGGTGATCGCCATTTAGTTTGCTCCTGTGAAGGTATGGAGGCTTATAAGGAAGGATAGCCCAGGTAGCTTTATCCTAGAGAGATCGTCACTTGTGAAGGATTAATGAGGCGATCTCTAAAATGCTAGACTGAGAAACTGTAGTAAGAAATTCTGATTTTGAGT

CDS

ATGACGAAGAAAGAGGCTCTTACCTTCGCTCAAGGCTTGGGGTGGACAAAGGCTGATGCGGAAAGGGCTTATCAAGCTTTAAATGTTAATTTCTCCGACCTTCAATCCACCCTCGATTATTACAAACATGAGTACGGTATTGAGGATGTAACAGACCGAGATATAGCTGTTCTTTCACTCGTACTAGCAGATTTCGCAGGCGAGGTTTTGCTGGATAGGCAAAGGAAACAAGCTGCACAACAAGGTGAAGTAACAAAAAAGAAAAATAAAATCAAAGAAATCGAACAGAGTCACGCCCAAGAAATTGCTGATTTTAAAAAAAGCTTCCACGAGCAACACAGTGCATTAATGGAGCTTTTGATAAAGGTTTATAGCACGGCGAAAAGATTCGGTCTAAAACCGGAACCGTGGATTGAAGCTATGATTGATGCTTATGAGGAGGCAAAAATTGGAACTGATAACTCGCAAACAGTTGCTTGA

Protein

MTKKEALTFAQGLGWTKADAERAYQALNVNFSDLQSTLDYYKHEYGIEDVTDRDIAVLSLVLADFAGEVLLDRQRKQAAQQGEVTKKKNKIKEIEQSHAQEIADFKKSFHEQHSALMELLIKVYSTAKRFGLKPEPWIEAMIDAYEEAKIGTDNSQTVA