Your browser is old and dusty. Try Google Chrome!

Details for slr0291

ORF slr0291
Accession NP_441833.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_4 Forward -234 -220 16.6169 0.295
NP_440557.1_1 Reverse -381 -400 1.37609 0.256
NP_440795.1_7 Forward -355 -348 11.1505 0.108
NP_440795.1_7 Forward -334 -327 8.8889 0.188
NP_442100.1_4 Forward -283 -264 11.5033 0.278
NP_441453.1_4 Reverse -326 -334 11.6225 0.0403
NP_441453.1_4 Reverse -347 -355 4.93597 0.224
NP_441453.1_7 Reverse -146 -153 12.9205 0.23
NP_441623.1_1 Reverse -146 -164 -5.09406 0.283
NP_441623.1_6 Forward -222 -203 10.3242 0.298
NP_440226.1_1 Reverse -326 -345 2.16274 0.276
NP_441630.1_3 Reverse -119 -138 0.0977854 0.285
NP_442744.1_9 Forward -223 -209 14.4836 0.266
NP_442744.1_9 Forward -59 -45 12.8353 0.288
NP_442744.1_9 Reverse -45 -59 12.1566 0.288
NP_443002.1_5 Forward -319 -301 17.5212 0.192
NP_442752.1_4 Forward -148 -141 12.1338 0.0546
NP_442752.1_4 Reverse -232 -239 5.25066 0.256
NP_442975.1_10 Reverse -204 -218 7.86545 0.116
NP_440061.1_9 Forward -243 -229 5.50552 0.283
NP_439979.1_9 Forward -241 -223 8.57394 0.26
NP_441900.1_2 Reverse -106 -124 -4.99644 0.288
NP_441859.1_3 Reverse -346 -365 1.47364 0.284
NP_440304.1_4 Forward -226 -216 4.10993 0.272
NP_440304.1_4 Reverse -231 -241 2.63497 0.299
NP_441781.1_7 Reverse -133 -152 6.98095 0.182
NP_440908.1_5 Forward -134 -117 10.2653 0.252
NP_441352.1_2 Forward -231 -212 15.4374 0.0713
NP_441935.1_7 Forward -67 -48 12.0942 0.164
NP_441594.1_6 Forward -233 -214 1.67108 0.264
NP_442742.1_9 Forward -291 -272 -13.4719 0.274
NP_442110.1_7 Reverse -380 -394 1.47456 0.226
NP_441083.1_5 Forward -162 -152 2.83163 0.191
NP_441738.1_2 Forward -387 -380 9.57686 0.166
NP_440538.1_2 Forward -275 -256 9.7334 0.276
NP_441327.1_1 Forward -50 -31 4.30948 0.272
NP_441163.1_1 Forward -231 -214 8.10125 0.233
NP_440747.1_10 Reverse -229 -241 -12.1541 0.227
NP_441014.1_5 Forward -246 -228 9.36059 0.276
NP_443018.1_3 Reverse -327 -334 4.56234 0.241
NP_443018.1_3 Forward -334 -327 4.46401 0.244
NP_440376.1_1 Reverse -347 -356 5.60459 0.125
NP_440376.1_1 Reverse -232 -241 3.34298 0.206
NP_440376.1_1 Forward -148 -139 0.0980582 0.285
NP_441588.1_4 Forward -387 -377 7.45319 0.178
NP_441588.1_4 Reverse -61 -71 6.46988 0.193
NP_441588.1_4 Forward -333 -323 5.78156 0.235
NP_440266.1_1 Reverse -353 -372 13.9625 0.247
NP_442687.1_7 Reverse -238 -248 8.73149 0.101
NP_441013.1_2 Forward -130 -112 -1.06249 0.281
NP_441080.1_7 Forward -59 -41 13.1947 0.238
NP_440360.1_10 Reverse -349 -363 12.6843 0.131
NP_442658.1_1 Forward -337 -327 4.7978 0.297
NP_440141.1_8 Reverse -296 -315 7.7676 0.236
NP_442782.1_2 Reverse -269 -283 2.85119 0.271
NP_442782.1_2 Reverse -127 -141 1.27789 0.281
NP_441414.1_9 Reverse -232 -251 -5.11376 0.169
NP_441958.1_5 Reverse -231 -241 -0.609952 0.215
NP_441958.1_5 Forward -149 -139 -2.47824 0.273
NP_440203.1_5 Reverse -142 -152 15.6142 0.0701
NP_440984.1_7 Forward -246 -232 16.0275 0.0466
NP_442911.1_2 Forward -366 -347 2.65439 0.0491
NP_443055.1_6 Reverse -215 -233 8.57317 0.142
NP_442002.1_1 Forward -157 -139 -9.32229 0.279
NP_442002.1_1 Reverse -118 -136 -10.1089 0.29
NP_440147.1_4 Reverse -213 -226 6.90245 0.0803
NP_440147.1_4 Reverse -324 -337 4.05085 0.173
NP_440147.1_4 Reverse -49 -62 3.06754 0.196
NP_441916.1_7 Reverse -326 -336 4.69992 0.163
NP_441916.1_7 Reverse -347 -357 3.02829 0.232
NP_441041.1_4 Forward -241 -222 -10.4236 0.232
NP_441041.1_7 Forward -227 -215 13.3454 0.0485
NP_441041.1_7 Forward -359 -347 4.79381 0.295
NP_440569.1_7 Forward -136 -117 8.35759 0.289
NP_442004.1_6 Reverse -380 -394 5.30946 0.191
NP_441725.1_5 Reverse -140 -150 -1.19994 0.294
NP_441725.1_5 Reverse -348 -358 -1.29827 0.299
NP_440736.1_3 Reverse -206 -225 5.50599 0.223
NP_440736.1_3 Forward -391 -372 1.0811 0.282
NP_442281.1_1 Reverse -46 -60 7.96378 0.089
NP_442281.1_1 Reverse -375 -389 6.98048 0.111
NP_442281.1_1 Reverse -210 -224 5.70218 0.15
NP_441079.1_7 Forward -392 -373 -3.24622 0.233
NP_441556.1_10 Forward -361 -347 13.2393 0.182
NP_441556.1_10 Reverse -299 -313 10.2218 0.273
NP_441644.1_6 Forward -241 -231 7.45273 0.124
NP_440652.1_10 Reverse -302 -321 4.62101 0.283
NP_442215.1_2 Forward -244 -228 0.0585348 0.157
NP_442215.1_2 Reverse -137 -153 -3.18639 0.211
NP_442215.1_2 Forward -226 -210 -7.21796 0.289
NP_440253.1_2 Forward -60 -42 -0.374176 0.209
NP_442933.1_10 Forward -335 -326 4.42462 0.246
NP_442933.1_10 Reverse -380 -389 4.12963 0.28
NP_442554.1_4 Forward -126 -107 9.43923 0.277
NP_442554.1_8 Reverse -233 -243 2.43831 0.272
NP_442292.1_1 Forward -355 -346 -0.590259 0.258
NP_440919.1_1 Reverse -148 -167 -7.96535 0.286
NP_440919.1_7 Forward -247 -229 10.4641 0.171
NP_443009.1_5 Forward -225 -214 6.35136 0.165
NP_443009.1_5 Forward -61 -50 5.26972 0.21
NP_440125.1_10 Forward -28 -9 13.7658 0.279
NP_441198.1_8 Forward -337 -327 10.7322 0.247
NP_440379.1_5 Forward -245 -226 -5.99873 0.227
NP_441468.1_1 Forward -334 -327 3.97235 0.277
NP_441015.1_8 Reverse -226 -245 5.11266 0.258
NP_441426.1_7 Reverse -265 -282 17.6401 0.282
NP_441637.1_9 Reverse -207 -225 -3.22577 0.296
NP_442868.1_6 Reverse -345 -355 0.668351 0.213
NP_442719.1_2 Reverse -208 -226 -9.51964 0.266
NP_441612.1_2 Forward -119 -109 7.19391 0.26
NP_441612.1_2 Forward -142 -132 7.09709 0.266
NP_442808.1_1 Forward -284 -274 1.25791 0.289
NP_442789.1_4 Forward -164 -145 -3.14714 0.246
NP_441878.1_6 Forward -225 -215 -6.90313 0.198
NP_441878.1_6 Forward -357 -347 -7.68978 0.255
NP_441036.1_8 Forward -390 -380 8.4365 0.174
NP_441433.1_8 Forward -153 -134 -3.63879 0.283
NP_441739.1_2 Forward -106 -90 4.18776 0.245
NP_442397.1_9 Reverse -304 -323 3.34271 0.264
NP_442397.1_9 Forward -149 -130 1.67108 0.283
NP_440356.1_4 Reverse -128 -147 3.93269 0.203
NP_441574.1_1 Reverse -127 -146 0.0977854 0.196
NP_441467.1_10 Reverse -100 -114 5.30946 0.281
NP_442645.1_2 Forward -256 -237 -14.7502 0.18
NP_441037.1_4 Reverse -125 -135 10.7287 0.187
NP_442047.1_2 Forward -153 -139 11.6026 0.297
NP_442317.1_6 Reverse -210 -229 4.42435 0.247
NP_441633.1_3 Reverse -213 -226 2.37923 0.0969
NP_441633.1_3 Reverse -64 -77 -7.25721 0.3
NP_442998.1_5 Forward -143 -133 11.1898 0.191
NP_442998.1_10 Forward -354 -347 4.07068 0.276
NP_440299.1_1 Reverse -322 -335 11.5234 0.0484
NP_440299.1_1 Reverse -343 -356 4.14862 0.217
NP_441799.1_1 Reverse -322 -336 4.62054 0.242
NP_441007.1_10 Forward -361 -348 9.55739 0.0928
NP_442334.1_2 Reverse -191 -208 -7.43431 0.291
NP_442007.1_3 Forward -393 -374 18.2882 0.137
NP_441559.1_8 Reverse -227 -241 -7.67023 0.297
NP_441270.1_5 Reverse -298 -317 13.9702 0.211
NP_440717.1_2 Forward -241 -222 -10.522 0.245
NP_441866.1_4 Forward -56 -43 12.3695 0.282
NP_441464.1_8 Reverse -215 -229 9.63603 0.189
NP_441464.1_8 Reverse -347 -361 7.27608 0.215
NP_440787.1_5 Reverse -207 -221 10.6193 0.256
NP_440787.1_5 Forward -390 -376 9.34103 0.272
NP_441199.1_3 Forward -237 -219 7.19731 0.179
NP_442386.1_9 Reverse -138 -147 6.78414 0.219
NP_442386.1_9 Forward -242 -233 5.21086 0.262
NP_442054.1_3 Reverse -43 -62 -6.09707 0.297
NP_441340.1_5 Reverse -327 -334 11.0522 0.0749
NP_441947.1_4 Forward -38 -19 11.4058 0.259
NP_440327.1_6 Reverse -293 -312 9.0459 0.212
NP_440586.1_8 Forward -313 -306 5.64364 0.297
NP_440586.1_8 Reverse -60 -67 5.64364 0.297
NP_442251.1_6 Forward -388 -381 9.77388 0.162
NP_440684.1_9 Forward -223 -209 9.73436 0.216
NP_439937.1_9 Forward -293 -276 -11.3682 0.251
NP_441657.1_5 Reverse -228 -247 -0.000545616 0.237
NP_440398.1_6 Forward -159 -140 3.6377 0.294
NP_440439.1_1 Reverse -229 -242 -0.177378 0.209
NP_440171.1_3 Forward -78 -59 3.83436 0.284
NP_441138.1_1 Forward -79 -60 11.6025 0.216
NP_439977.1_5 Reverse -221 -240 -1.86883 0.263
NP_442384.1_10 Forward -241 -228 11.1307 0.0383
NP_442384.1_10 Reverse -139 -152 2.57589 0.22
NP_442262.1_10 Reverse -327 -334 7.90559 0.266
NP_441689.1_5 Forward -391 -381 8.3377 0.132
NP_440531.1_6 Reverse -224 -243 3.73603 0.14
NP_442529.1_4 Reverse -371 -390 7.47261 0.289
NP_440297.1_9 Forward -241 -231 4.20827 0.238
NP_440297.1_9 Reverse -140 -150 -0.314959 0.282
NP_440700.1_10 Forward -97 -78 17.1519 0.289
NP_440894.1_7 Forward -93 -74 11.6017 0.234
NP_440999.1_2 Forward -128 -109 8.16093 0.296
NP_440600.1_4 Forward -343 -325 -6.56903 0.285
NP_440600.1_5 Reverse -224 -243 18.1898 0.162
NP_439969.1_1 Reverse -137 -156 -3.63879 0.288
NP_442077.1_9 Forward -331 -312 -6.98204 0.299
NP_441543.1_2 Reverse -327 -336 7.57121 0.113
NP_441543.1_2 Forward -355 -346 5.89959 0.169
NP_442845.1_2 Reverse -133 -147 5.80112 0.224
NP_442845.1_2 Reverse -320 -334 5.50613 0.231
NP_441304.1_10 Forward -227 -218 14.7494 0.164
NP_442966.1_8 Forward -180 -162 15.4571 0.262
NP_442337.1_7 Reverse -130 -148 17.3254 0.132
NP_442337.1_8 Reverse -336 -355 -0.590531 0.276
NP_442337.1_8 Reverse -103 -122 -0.983855 0.278
NP_441462.1_2 Reverse -347 -357 0.0783647 0.168
NP_440668.1_9 Reverse -118 -137 11.1109 0.249
NP_443062.1_6 Forward -222 -203 3.14605 0.243
NP_443062.1_6 Reverse -207 -226 1.37609 0.276
NP_440936.1_1 Reverse -28 -47 21.6323 0.0145
NP_442204.1_1 Forward -152 -141 1.63197 0.267
NP_441351.1_1 Forward -91 -72 16.4207 0.171
NP_442428.1_5 Forward -334 -327 4.36568 0.271
NP_441443.1_1 Forward -149 -130 -5.31042 0.298
NP_442120.1_10 Reverse -215 -234 -15.7335 0.294
NP_441867.1_2 Forward -126 -107 -14.1602 0.277
NP_440436.1_4 Forward -388 -379 3.93256 0.294
NP_441004.1_1 Forward -91 -72 -16.5201 0.286
NP_441004.1_1 Forward -230 -211 -18.1918 0.298
NP_441004.1_2 Forward -235 -216 -3.44213 0.28
NP_439949.1_7 Forward -78 -64 19.1741 0.0579
NP_439949.1_7 Forward -56 -42 12.0943 0.269
NP_442694.1_9 Forward -180 -161 8.06259 0.277
NP_442206.1_10 Forward -241 -226 -0.216765 0.287
NP_443054.1_2 Forward -226 -212 3.14618 0.24
NP_443054.1_2 Forward -62 -48 0.491246 0.262
NP_443054.1_2 Reverse -213 -227 0.392915 0.267
NP_441851.1_10 Forward -149 -139 6.27322 0.178
NP_441668.1_4 Forward -251 -232 -2.45882 0.288
NP_442515.1_1 Reverse -346 -360 13.8643 0.0278
NP_442843.1_1 Forward -91 -72 -11.2103 0.286
NP_442843.1_1 Reverse -266 -285 -11.6036 0.291
NP_441477.1_10 Forward -248 -230 -0.275845 0.291
NP_440431.1_3 Forward -73 -54 -12.2919 0.298
NP_439950.1_1 Forward -77 -68 15.0444 0.156
NP_442006.1_2 Forward -155 -138 -15.5958 0.228
NP_441003.1_9 Forward -389 -370 5.89931 0.255
NP_441078.1_4 Forward -241 -232 5.01461 0.122
NP_441078.1_4 Forward -356 -347 -1.18024 0.237
NP_442443.1_1 Forward -232 -213 -1.18052 0.231
NP_441432.1_8 Forward -336 -327 3.04799 0.268
NP_441432.1_9 Forward -57 -44 8.30749 0.29
NP_442344.1_7 Forward -388 -369 -6.98204 0.176
NP_440760.1_1 Reverse -232 -251 -13.8652 0.115
NP_440760.1_1 Reverse -239 -258 -21.0434 0.228
NP_440913.1_1 Reverse -263 -281 12.7038 0.148
NP_441023.1_1 Forward -241 -223 14.0805 0.18
NP_441072.1_2 Forward -79 -60 9.73422 0.216
NP_442489.1_7 Forward -241 -232 -1.57357 0.213
NP_442489.1_7 Forward -224 -215 -1.86856 0.259
NP_442489.1_7 Reverse -215 -224 -1.96689 0.28
NP_440941.1_1 Reverse -272 -282 15.8113 0.277
NP_441659.2_8 Reverse -347 -357 3.32329 0.164
NP_441659.2_8 Reverse -139 -149 2.04498 0.215
NP_441022.1_1 Reverse -85 -94 11.6421 0.274
NP_442913.1_10 Forward -250 -231 -4.03212 0.225
NP_441040.1_2 Forward -219 -200 -12.3902 0.255
NP_441800.1_3 Forward -241 -223 3.3624 0.293
NP_442346.1_5 Forward -336 -326 9.12481 0.118
NP_442346.1_5 Reverse -126 -136 5.68323 0.234
NP_440545.1_3 Reverse -343 -360 8.98696 0.0411
NP_440545.1_3 Forward -240 -223 -3.5994 0.208
NP_440459.1_2 Reverse -230 -247 14.0018 0.119
NP_440459.1_2 Reverse -118 -135 8.69197 0.253
NP_441653.1_2 Reverse -348 -367 4.30269 0.258
NP_442551.1_4 Reverse -192 -207 -2.38005 0.259
NP_442603.1_7 Reverse -139 -153 6.68548 0.232
NP_441833.1_3 Forward -337 -323 16.1259 0.213
NP_441833.1_4 Forward -388 -381 11.0522 0.0559
NP_441833.1_6 Forward -125 -106 18.4857 0.191
NP_441833.1_7 Forward -321 -302 20.1573 0.0605
NP_440875.1_9 Forward -239 -229 12.5575 0.113
NP_440875.1_9 Reverse -229 -239 10.8055 0.196
NP_440594.1_5 Forward -104 -85 4.91521 0.293
NP_440590.1_4 Reverse -233 -246 -3.61896 0.255
NP_440821.1_4 Forward -358 -348 -0.314959 0.251
NP_440665.1_1 Forward -374 -355 -14.6519 0.262
NP_442270.1_9 Reverse -300 -319 -4.72043 0.201
NP_440219.1_1 Forward -50 -31 15.1332 0.184
NP_442643.1_3 Forward -135 -116 -5.80207 0.261
NP_442643.1_5 Forward -65 -46 0.884433 0.25
NP_442643.1_5 Reverse -235 -254 -6.29373 0.293
NP_441541.1_7 Forward -45 -27 13.3421 0.218
NP_442216.1_4 Reverse -68 -76 8.08217 0.255
NP_441617.1_6 Forward -224 -205 2.3594 0.2
NP_440546.1_4 Reverse -326 -336 11.5004 0.0806
NP_440546.1_4 Reverse -380 -390 10.3369 0.109
NP_440546.1_4 Forward -148 -138 8.78555 0.171
NP_440546.1_4 Forward -335 -325 8.6886 0.176
NP_440546.1_4 Forward -217 -207 7.71902 0.224
NP_440675.1_1 Forward -245 -226 1.37609 0.292
NP_442402.1_4 Reverse -102 -121 2.06362 0.172
NP_441084.1_6 Forward -337 -323 16.8098 0.0523
NP_441084.1_6 Reverse -230 -244 12.8346 0.152
NP_441084.1_6 Reverse -206 -220 12.1559 0.169
NP_441084.1_6 Forward -150 -136 9.63499 0.273
NP_441811.1_1 Forward -163 -144 11.1109 0.26
NP_440505.1_3 Reverse -230 -240 5.48657 0.227
NP_440520.1_10 Forward -22 -3 12.29 0.286
NP_441203.1_1 Reverse -381 -400 -15.0452 0.21
NP_441576.1_10 Forward -61 -42 13.7658 0.234
NP_441408.2_7 Forward -337 -318 9.3409 0.103
NP_440914.1_1 Forward -241 -231 12.6163 0.0518
NP_440914.1_1 Reverse -311 -321 6.3705 0.283
NP_442101.1_10 Reverse -119 -138 -7.57203 0.214
NP_442533.1_6 Forward -241 -232 12.5861 0.0277
NP_442533.1_6 Reverse -139 -148 4.12963 0.191
NP_442533.1_6 Reverse -195 -204 2.35967 0.259
NP_442533.1_6 Forward -203 -194 1.47469 0.298
NP_441089.1_10 Forward -376 -357 10.2259 0.205
NP_442232.1_3 Forward -79 -60 -8.55534 0.228
NP_442232.1_3 Forward -232 -213 -14.8485 0.288
NP_443016.1_1 Reverse -341 -360 -0.983855 0.219
NP_441482.1_7 Forward -395 -381 -11.2101 0.245
NP_439944.1_9 Reverse -381 -391 10.2065 0.0917
NP_440816.1_2 Forward -262 -243 7.11264 0.27
NP_442202.1_6 Forward -400 -381 3.34271 0.265
NP_441527.1_8 Forward -382 -363 7.57094 0.279
NP_440007.1_9 Forward -152 -138 2.5562 0.277
NP_440007.1_9 Reverse -229 -243 0.687908 0.292
NP_441106.1_1 Forward -336 -327 4.62128 0.213
NP_441106.1_1 Forward -390 -381 4.52295 0.219
NP_439903.1_6 Forward -323 -304 3.73524 0.207
NP_441286.1_1 Reverse -346 -358 -4.18925 0.152
NP_441930.1_3 Reverse -40 -59 4.88709 0.266
NP_440886.1_7 Reverse -214 -224 3.51951 0.279
NP_442614.1_2 Reverse -347 -361 16.6175 0.0675
NP_442072.1_1 Reverse -45 -63 10.7372 0.231
NP_442072.1_9 Forward -225 -207 -13.5505 0.115
NP_441403.1_4 Reverse -344 -362 6.80398 0.282
NP_440841.1_4 Forward -150 -131 -7.37537 0.229
NP_441626.1_2 Reverse -348 -355 11.1505 0.0716
NP_442615.1_1 Reverse -317 -335 -0.964162 0.123
NP_442615.1_1 Reverse -130 -148 -6.56903 0.252
NP_441962.1_4 Forward -229 -210 -14.3569 0.286
NP_441836.1_2 Reverse -226 -245 -4.42544 0.255
NP_442437.1_8 Forward -235 -216 5.80098 0.242
NP_440287.1_6 Forward -226 -207 2.0644 0.254
NP_440766.1_5 Forward -353 -341 6.89186 0.291
NP_441237.1_9 Reverse -233 -243 11.0914 0.2
NP_439910.1_2 Reverse -43 -60 -14.3175 0.183
NP_440502.1_3 Forward -206 -196 14.1795 0.257
NP_440457.1_1 Forward -152 -140 15.2803 0.0611
NP_441801.1_4 Forward -158 -148 2.92996 0.231
NP_440801.1_8 Reverse -207 -226 -0.197208 0.263
NP_440801.1_9 Forward -244 -230 13.8049 0.262
NP_440473.1_1 Reverse -229 -248 11.3538 0.276
NP_440554.1_4 Reverse -327 -337 4.79825 0.175
NP_441885.1_5 Forward -356 -346 0.373358 0.164
NP_441885.1_5 Reverse -232 -242 -0.314959 0.195
NP_441885.1_5 Forward -335 -325 -1.10161 0.25
NP_440898.1_6 Reverse -45 -64 11.3075 0.22
NP_442341.1_7 Forward -163 -149 5.60446 0.151
NP_442341.1_7 Reverse -319 -333 1.67122 0.282
NP_442341.1_9 Reverse -230 -244 11.1104 0.13
NP_442341.1_9 Forward -156 -142 4.8172 0.291
NP_441173.1_9 Reverse -135 -143 12.9004 0.206
NP_441173.1_9 Reverse -112 -120 12.0154 0.214
NP_441842.1_10 Reverse -373 -387 8.55439 0.218
NP_441842.1_10 Reverse -340 -354 6.3911 0.291
NP_440175.1_7 Reverse -355 -373 10.4366 0.253
NP_441105.1_3 Forward -367 -348 -2.55715 0.164
NP_441105.1_3 Forward -247 -228 -9.73531 0.295
NP_440172.1_1 Reverse -215 -225 8.1415 0.0678
NP_440172.1_1 Forward -241 -231 2.63497 0.274
NP_441226.1_7 Reverse -140 -147 8.29857 0.205
NP_441757.1_2 Forward -163 -145 8.47561 0.276
NP_441111.1_7 Forward -355 -347 -0.570565 0.233
NP_441766.1_2 Forward -356 -347 3.14632 0.23
NP_443052.1_9 Reverse -72 -91 -0.4922 0.211
NP_442116.1_6 Reverse -13 -30 14.5669 0.16
NP_440261.1_5 Forward -240 -227 -6.96221 0.201
NP_440261.1_5 Reverse -348 -361 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAAGTGCCAAAAAGATCGCTGATTTGACCAACCAAATGGTCGGTGCTGTCGCCAAACTAAGTGAAGCTATGGCTAAACACGACTTTGCCAACACCGAAGAGAAGTTGCAGTATTGCGCCCAAACTCTCCGTCCCCTGATGGATGAAGTACGGACTTTTGCCGATGCCCTGGAAGGGGAAATTGCCGATAGTTTCTGGCCCCTGCCTACCTACCAGGAAATGTTGTTTATCAAATAGTGCATATCACCCCAGGGGGATGGGTAAAACCATCTCCCAATGCTGGGGTAAACCAGCTTAAAGTCCCCTCAAGCTTTTGGAAGTTTGGGGGGATTAATGATCGGGAAATTGCTGATTTTTTAGATATACCTTTAAAATTGGTCAATAGATTTGATTAAAACCC

CDS

ATGAAAAACCAACTTTACGAAACGGATTTTGTACGGTGGACAGAAGAACAGGCACAATATATTCAACAAAATGACTTGGAATCCATTGACTGGCAAAATATTCAGGAAGAAATAAGTGCCTTGGGTCGCAGTGAAAAACATGAGCTAGAAAATCGTCTTGAAGTTCTCCTGGAGCATCTGTTAAAACGAGGCTATATCAATAGCGCTTACGATAATCGTGGCTGGGAAATTACTATTAAAGAACAACGAAAGAAAATTCGACGGTTATTACGAGATTCCCCTAGTTTAAAGAATTACGGCGAGGCCTTAATTCCAGAAATCTGGCAGGAGGCACGCTCTGATATCCAAGACATTTATCCGACTACTCCACTGCCCACAATCAATCCATTTGGTGAAAGTTTGGATCAATTATTAACGGTTACTTTTTGGCAATAA

Protein

MKNQLYETDFVRWTEEQAQYIQQNDLESIDWQNIQEEISALGRSEKHELENRLEVLLEHLLKRGYINSAYDNRGWEITIKEQRKKIRRLLRDSPSLKNYGEALIPEIWQEARSDIQDIYPTTPLPTINPFGESLDQLLTVTFWQ