Your browser is old and dusty. Try Google Chrome!

Details for slr0287

ORF slr0287
Accession NP_441831.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -95 -109 16.0275 0.104
NP_442711.1_1 Reverse -128 -142 11.0127 0.256
NP_441061.1_2 Forward -109 -95 -1.67204 0.269
NP_441418.1_6 Reverse -196 -215 -13.5702 0.0775
NP_441418.1_6 Reverse -199 -218 -21.6334 0.156
NP_441418.1_6 Forward -217 -198 -29.4998 0.228
NP_441418.1_6 Forward -396 -377 -30.5815 0.286
NP_441418.1_6 Forward -77 -58 -30.7781 0.296
NP_441480.1_2 Reverse -98 -117 9.73422 0.299
NP_441453.1_4 Reverse -128 -136 7.19758 0.0757
NP_441453.1_4 Forward -137 -129 6.70593 0.121
NP_441453.1_4 Reverse -235 -243 4.05099 0.268
NP_441623.1_1 Reverse -189 -207 -4.60241 0.274
NP_442151.1_6 Forward -137 -123 8.16106 0.182
NP_441818.1_9 Reverse -86 -105 -2.16383 0.202
NP_442169.1_1 Reverse -88 -107 2.26107 0.261
NP_442169.1_1 Reverse -74 -93 -0.197208 0.261
NP_440259.1_4 Forward -308 -294 13.167 0.226
NP_442173.1_1 Reverse -129 -137 5.82095 0.2
NP_442173.1_1 Forward -136 -128 5.72262 0.203
NP_442752.1_4 Forward -137 -130 13.8055 0.0199
NP_443027.1_4 Forward -139 -129 8.04317 0.219
NP_440784.1_7 Reverse -129 -136 6.23397 0.241
NP_440784.1_7 Forward -136 -129 6.13563 0.241
NP_442000.2_3 Reverse -92 -111 11.1109 0.28
NP_442289.1_4 Reverse -191 -207 12.6449 0.219
NP_440110.1_8 Reverse -197 -216 8.75091 0.0906
NP_441476.1_5 Forward -213 -194 8.75091 0.0933
NP_442062.1_8 Reverse -128 -138 9.7148 0.0559
NP_442062.1_8 Forward -137 -127 7.84651 0.0871
NP_442062.1_8 Forward -396 -386 5.28991 0.176
NP_440761.1_8 Reverse -257 -276 14.7483 0.27
NP_442242.1_4 Forward -136 -129 12.4288 0.0393
NP_441208.1_9 Reverse -125 -139 5.40779 0.267
NP_442742.1_9 Forward -388 -369 -8.55534 0.265
NP_441925.1_4 Forward -228 -209 1.37531 0.155
NP_441925.1_4 Forward -108 -89 -14.8492 0.263
NP_441083.1_5 Forward -137 -127 10.6981 0.0184
NP_441083.1_5 Reverse -128 -138 2.14332 0.195
NP_441434.1_7 Reverse -130 -144 5.1128 0.225
NP_441738.1_2 Reverse -130 -137 15.28 0.0102
NP_441738.1_2 Reverse -389 -396 13.8051 0.0221
NP_441558.1_5 Forward -139 -120 8.55425 0.147
NP_440209.1_1 Forward -137 -129 14.8674 0.012
NP_440209.1_1 Reverse -128 -136 8.57422 0.0425
NP_440209.1_1 Reverse -387 -395 2.1827 0.254
NP_442889.1_1 Reverse -215 -234 -12.0953 0.218
NP_442889.1_8 Forward -140 -126 14.5519 0.0523
NP_442570.1_3 Reverse -219 -238 -9.24366 0.296
NP_441831.1_1 Forward -205 -186 29.5971 0.00028
NP_441831.1_2 Forward -109 -90 32.4477 0.0000398
NP_441831.1_3 Forward -256 -237 29.4004 0.000229
NP_441831.1_4 Forward -180 -161 33.137 0.0000458
NP_441831.1_5 Forward -289 -270 29.7937 0.0000746
NP_441831.1_6 Forward -157 -138 27.4338 0.0022
NP_441831.1_7 Forward -234 -215 27.3355 0.000509
NP_441831.1_8 Forward -82 -63 21.1406 0.0931
NP_441831.1_9 Forward -130 -111 24.2872 0.00954
NP_440906.1_5 Forward -136 -129 12.0355 0.0724
NP_440906.1_5 Reverse -129 -136 12.0355 0.0724
NP_440747.1_10 Reverse -125 -137 5.15219 0.0179
NP_440747.1_10 Forward -140 -128 -2.51763 0.0509
NP_441130.1_10 Forward -210 -196 6.88276 0.173
NP_441486.1_1 Forward -140 -126 4.32615 0.0462
NP_441486.1_1 Reverse -125 -139 -5.11362 0.222
NP_441880.2_10 Reverse -129 -147 12.0155 0.139
NP_440842.1_4 Reverse -246 -265 7.97961 0.115
NP_441014.1_8 Forward -103 -84 -1.67217 0.224
NP_442848.1_9 Forward -229 -210 -0.885524 0.281
NP_443018.1_3 Forward -395 -388 9.77388 0.118
NP_443018.1_3 Forward -136 -129 5.34899 0.212
NP_443018.1_3 Reverse -129 -136 5.34899 0.212
NP_441634.1_8 Reverse -126 -140 -4.52363 0.295
NP_440376.1_1 Forward -137 -128 9.73449 0.0365
NP_440376.1_1 Reverse -128 -137 9.73449 0.0365
NP_441588.1_4 Reverse -130 -140 7.05986 0.178
NP_441588.1_4 Forward -135 -125 6.07655 0.214
NP_442687.1_7 Forward -138 -128 14.238 0.0341
NP_442687.1_7 Reverse -386 -396 6.07655 0.179
NP_442687.1_7 Reverse -195 -205 4.99491 0.225
NP_442687.1_7 Reverse -4 -14 4.10993 0.266
NP_441846.1_10 Reverse -82 -101 -22.2233 0.257
NP_441950.1_7 Reverse -83 -102 -7.86702 0.283
NP_441950.1_7 Reverse -209 -228 -8.752 0.287
NP_441763.1_10 Reverse -16 -35 8.06178 0.224
NP_442658.1_1 Forward -139 -129 7.25606 0.214
NP_442198.1_3 Reverse -119 -138 9.63589 0.236
NP_441855.2_4 Reverse -379 -398 10.1015 0.261
NP_442496.1_5 Forward -125 -107 9.26226 0.231
NP_441414.1_9 Forward -137 -118 7.66927 0.0328
NP_440184.1_1 Reverse -281 -300 6.70429 0.181
NP_440184.1_7 Reverse -112 -131 17.616 0.12
NP_441317.1_4 Forward -304 -290 10.5144 0.289
NP_441958.1_5 Forward -138 -128 2.7333 0.0378
NP_441958.1_5 Reverse -127 -137 2.53664 0.0409
NP_439905.1_1 Forward -136 -123 6.4108 0.288
NP_440984.1_7 Reverse -123 -137 18.6825 0.0128
NP_440153.1_8 Forward -104 -91 6.31247 0.172
NP_440369.1_2 Forward -220 -201 14.1583 0.253
NP_441099.1_5 Forward -215 -196 -12.0953 0.294
NP_442002.1_9 Forward -138 -131 10.7572 0.185
NP_442002.1_9 Forward -397 -390 9.67555 0.27
NP_442598.1_2 Reverse -337 -346 14.2577 0.252
NP_441294.1_7 Reverse -11 -25 9.15464 0.256
NP_440411.1_4 Reverse -59 -78 15.5357 0.106
NP_442440.1_7 Forward -400 -381 9.43923 0.23
NP_442438.1_10 Forward -142 -128 2.94952 0.168
NP_442438.1_10 Forward -213 -199 0.392915 0.229
NP_442431.1_10 Reverse -83 -101 18.5054 0.0404
NP_442431.1_10 Reverse -89 -107 -0.472507 0.289
NP_441000.1_6 Reverse -127 -141 -3.04867 0.221
NP_442771.1_1 Reverse -194 -212 2.77242 0.0672
NP_440147.1_4 Reverse -126 -139 7.98409 0.0579
NP_440147.1_4 Forward -246 -233 5.42749 0.125
NP_440147.1_4 Forward -139 -126 0.60927 0.249
NP_441550.1_8 Reverse -126 -136 5.48612 0.247
NP_441916.1_7 Reverse -128 -138 8.92815 0.0405
NP_441041.1_4 Reverse -89 -108 -2.55715 0.114
NP_441041.1_4 Reverse -128 -147 -8.55534 0.204
NP_441041.1_7 Forward -140 -128 8.19502 0.143
NP_442396.1_5 Reverse -124 -137 11.6223 0.0913
NP_443063.1_7 Forward -158 -142 5.07341 0.288
NP_442004.1_6 Forward -208 -194 7.66941 0.157
NP_441725.1_4 Forward -70 -56 3.53891 0.278
NP_441725.1_5 Forward -395 -385 7.74818 0.0843
NP_439966.1_7 Forward -139 -129 8.14104 0.14
NP_439966.1_9 Forward -398 -389 7.86621 0.253
NP_439966.1_9 Forward -210 -201 7.57121 0.253
NP_439966.1_9 Forward -139 -130 0.884706 0.253
NP_442941.1_3 Forward -136 -126 1.25834 0.15
NP_442941.1_3 Reverse -129 -139 1.06167 0.153
NP_440289.1_2 Forward -140 -127 10.8357 0.0233
NP_440260.1_8 Forward -40 -22 1.69077 0.183
NP_440260.1_8 Forward -399 -381 -4.79907 0.273
NP_442281.1_1 Forward -142 -128 7.66879 0.0949
NP_441334.1_7 Reverse -194 -213 -19.6667 0.275
NP_440437.1_1 Reverse -381 -400 -1.37718 0.201
NP_440437.1_1 Forward -214 -195 -4.32711 0.256
NP_441644.1_6 Forward -137 -127 13.0576 0.0244
NP_440867.1_10 Forward -95 -76 1.76941 0.291
NP_442215.1_2 Forward -398 -382 2.12349 0.122
NP_442215.1_2 Forward -79 -63 -2.79306 0.204
NP_442215.1_2 Forward -139 -123 -4.66135 0.237
NP_442215.1_6 Reverse -201 -219 17.1279 0.176
NP_440253.1_2 Reverse -128 -146 -1.55415 0.244
NP_440929.1_8 Reverse -128 -137 9.73449 0.0257
NP_440929.1_8 Forward -137 -128 9.4395 0.0326
NP_442933.1_10 Forward -137 -128 13.9627 0.0192
NP_442933.1_10 Reverse -128 -137 8.1612 0.0885
NP_442671.1_2 Forward -344 -325 6.17969 0.141
NP_442554.1_8 Forward -136 -126 5.78156 0.138
NP_442554.1_8 Reverse -129 -139 4.40493 0.188
NP_442554.1_8 Forward -243 -233 4.20827 0.193
NP_440435.1_2 Forward -115 -96 21.7306 0.0163
NP_441762.1_7 Forward -138 -126 -0.256015 0.0768
NP_441762.1_7 Reverse -198 -210 -5.76255 0.238
NP_441762.1_7 Reverse -386 -398 -6.05754 0.268
NP_441762.1_7 Reverse -127 -139 -6.74586 0.284
NP_442142.1_4 Reverse -125 -138 5.82024 0.182
NP_442142.1_4 Forward -140 -127 4.14862 0.231
NP_442142.1_4 Reverse -384 -397 2.96866 0.269
NP_442292.1_1 Forward -136 -127 8.65285 0.0335
NP_442292.1_1 Reverse -129 -138 -0.0986038 0.239
NP_441525.1_1 Reverse -195 -208 19.1938 0.0967
NP_442476.1_6 Reverse -129 -143 4.22782 0.146
NP_442476.1_6 Forward -136 -122 3.63784 0.155
NP_443009.1_5 Reverse -127 -138 15.3978 0.0144
NP_442301.1_2 Forward -105 -86 10.52 0.19
NP_442408.2_5 Reverse -9 -28 17.3395 0.206
NP_441715.1_4 Reverse -129 -139 9.12481 0.103
NP_440379.1_5 Forward -217 -198 -10.9153 0.285
NP_440464.1_10 Forward -136 -126 12.7217 0.189
NP_441468.1_1 Reverse -129 -136 6.13563 0.209
NP_441468.1_1 Forward -136 -129 6.0373 0.223
NP_441020.2_6 Forward -398 -381 7.61033 0.225
NP_441015.1_10 Reverse -194 -213 -8.26035 0.272
NP_441015.1_10 Reverse -84 -103 -9.44032 0.282
NP_441015.1_10 Reverse -90 -109 -10.9153 0.289
NP_441673.1_1 Reverse -128 -137 11.1111 0.0121
NP_441673.1_1 Forward -137 -128 11.0128 0.018
NP_441172.1_1 Forward -230 -212 3.75572 0.179
NP_441826.1_2 Reverse -381 -395 3.8345 0.105
NP_441826.1_5 Reverse -149 -168 5.211 0.25
NP_442868.1_6 Forward -139 -129 0.471689 0.226
NP_442868.1_6 Reverse -126 -136 0.0783647 0.248
NP_442808.1_1 Forward -138 -128 8.63269 0.0481
NP_442808.1_1 Reverse -127 -137 7.35439 0.0814
NP_442808.1_1 Reverse -198 -208 2.33954 0.27
NP_442808.1_1 Forward -78 -68 1.94622 0.281
NP_440145.1_3 Forward -147 -128 6.09597 0.0557
NP_442542.1_2 Forward -398 -385 8.9674 0.142
NP_442050.1_5 Reverse -385 -395 8.3377 0.234
NP_442050.1_8 Forward -208 -189 15.0576 0.272
NP_440346.1_6 Forward -349 -339 16.5767 0.142
NP_441114.1_3 Forward -75 -66 7.66954 0.231
NP_440558.1_2 Forward -233 -214 -1.47551 0.214
NP_440558.1_2 Forward -113 -94 -5.21209 0.254
NP_442789.1_4 Reverse -194 -213 8.16093 0.102
NP_441878.1_6 Reverse -127 -137 0.668351 0.139
NP_441878.1_6 Forward -138 -128 0.57002 0.14
NP_441878.1_6 Reverse -67 -77 -6.8048 0.196
NP_441036.1_8 Reverse -191 -201 10.8948 0.148
NP_441036.1_8 Forward -138 -128 8.92815 0.174
NP_441036.1_8 Reverse -127 -137 6.76487 0.215
NP_441557.1_5 Reverse -128 -137 10.2261 0.0144
NP_441557.1_5 Forward -137 -128 10.1278 0.0188
NP_442267.1_4 Reverse -99 -118 2.94938 0.223
NP_442066.2_9 Forward -141 -128 8.47575 0.185
NP_441433.1_8 Reverse -63 -82 -1.86883 0.263
NP_442579.1_9 Forward -219 -200 3.6377 0.227
NP_442419.1_2 Forward -213 -194 -4.13045 0.281
NP_442183.1_1 Forward -244 -230 7.27608 0.145
NP_442397.1_1 Forward -25 -11 16.327 0.24
NP_440086.1_4 Forward -302 -288 19.586 0.163
NP_442645.1_2 Forward -145 -126 -12.2919 0.144
NP_442645.1_2 Reverse -120 -139 -22.2233 0.29
NP_441037.1_4 Reverse -194 -204 6.34312 0.267
NP_441037.1_4 Forward -139 -129 5.85583 0.296
NP_441633.1_3 Forward -177 -164 -0.0790467 0.138
NP_441633.1_3 Reverse -126 -139 -1.16069 0.153
NP_441633.1_3 Reverse -13 -26 -3.91395 0.177
NP_441633.1_3 Forward -139 -126 -4.11062 0.181
NP_440136.1_2 Reverse -129 -136 6.23397 0.171
NP_440136.1_2 Forward -136 -129 6.13563 0.193
NP_442590.1_10 Reverse -202 -221 3.24438 0.294
NP_442998.1_5 Reverse -308 -318 12.7631 0.159
NP_442998.1_5 Reverse -307 -317 11.8781 0.176
NP_442998.1_5 Reverse -347 -357 9.32148 0.243
NP_442998.1_10 Reverse -130 -137 15.5754 0.0102
NP_442998.1_10 Reverse -389 -396 6.23397 0.157
NP_442998.1_10 Forward -135 -128 5.74231 0.255
NP_440299.1_1 Reverse -124 -137 10.1468 0.0597
NP_441799.1_1 Reverse -124 -138 8.75042 0.106
NP_441799.1_4 Forward -229 -210 -5.11376 0.219
NP_440640.1_8 Reverse -53 -72 13.4708 0.26
NP_442504.1_3 Forward -78 -59 6.09597 0.254
NP_441007.1_10 Forward -142 -129 2.57589 0.183
NP_442334.1_10 Reverse -148 -167 -16.7168 0.257
NP_442201.1_10 Reverse -4 -23 -14.6519 0.285
NP_440709.1_1 Reverse -254 -273 3.83357 0.205
NP_441559.1_8 Forward -29 -15 -6.19526 0.275
NP_441395.1_8 Reverse -291 -310 2.45773 0.296
NP_440915.1_6 Forward -400 -386 3.24451 0.104
NP_442158.1_4 Forward -33 -23 14.828 0.176
NP_442158.1_4 Reverse -371 -381 13.0581 0.239
NP_441464.1_1 Forward -108 -89 7.57094 0.261
NP_441494.1_6 Forward -210 -197 6.4108 0.289
NP_439985.1_7 Reverse -209 -228 5.211 0.224
NP_442993.1_1 Reverse -128 -144 -11.2495 0.24
NP_442386.1_9 Forward -138 -129 5.89917 0.233
NP_441340.1_5 Forward -136 -129 6.13563 0.175
NP_441340.1_5 Reverse -129 -136 5.93897 0.198
NP_441340.1_5 Forward -243 -236 3.97235 0.274
NP_441340.1_9 Reverse -307 -317 8.25522 0.256
NP_441160.1_10 Reverse -22 -40 9.0656 0.296
NP_440586.1_1 Forward -43 -24 1.67108 0.231
NP_440586.1_1 Reverse -82 -101 -5.50708 0.285
NP_440586.1_8 Forward -136 -129 11.4451 0.0645
NP_442251.1_6 Reverse -129 -136 12.0355 0.0627
NP_441262.1_3 Forward -137 -130 14.7888 0.0223
NP_441262.1_3 Forward -396 -389 11.5438 0.0584
NP_440027.1_3 Forward -104 -86 11.5231 0.159
NP_443051.1_1 Forward -138 -129 0.786375 0.125
NP_443051.1_1 Reverse -127 -136 0.688044 0.134
NP_442239.1_8 Reverse -205 -224 9.63589 0.249
NP_441522.1_3 Forward -189 -170 13.5691 0.192
NP_440372.1_2 Forward -136 -129 6.72562 0.0929
NP_440372.1_2 Reverse -129 -136 6.62729 0.151
NP_441789.1_7 Forward -108 -89 -5.60616 0.299
NP_440819.1_5 Reverse -26 -34 7.68924 0.266
NP_440819.1_5 Reverse -307 -315 7.59091 0.272
NP_442384.1_10 Reverse -128 -141 6.50913 0.0995
NP_442384.1_10 Forward -137 -124 6.01747 0.113
NP_442114.1_4 Forward -208 -197 7.72849 0.256
NP_440530.1_6 Reverse -337 -351 14.6205 0.293
NP_442262.1_10 Forward -395 -388 11.1505 0.115
NP_442262.1_10 Reverse -236 -243 9.47889 0.187
NP_440344.1_10 Forward -144 -127 -6.15601 0.112
NP_440282.1_10 Forward -367 -348 -10.3253 0.297
NP_442126.1_10 Forward -66 -47 19.6656 0.148
NP_442750.1_3 Reverse -345 -364 -11.6036 0.256
NP_441896.1_3 Forward -146 -127 -2.75381 0.289
NP_440894.1_10 Forward -210 -191 3.83436 0.263
NP_440999.1_9 Forward -141 -127 8.06273 0.0797
NP_440052.1_5 Forward -148 -129 -4.72043 0.265
NP_439969.1_3 Forward -153 -134 0.294447 0.268
NP_441543.1_2 Reverse -129 -138 8.75118 0.0968
NP_441543.1_2 Forward -136 -127 7.47288 0.117
NP_442845.1_2 Reverse -122 -136 5.30946 0.237
NP_442845.1_2 Forward -250 -236 4.32615 0.261
NP_441834.1_7 Forward -149 -130 15.3391 0.248
NP_441829.1_1 Reverse -361 -380 20.1573 0.0402
NP_441829.1_4 Reverse -194 -208 20.1574 0.0746
NP_441829.1_5 Reverse -336 -354 19.4887 0.169
NP_441469.1_8 Forward -138 -129 6.29291 0.227
NP_442315.1_1 Reverse -81 -99 3.06741 0.294
NP_442315.1_2 Reverse -341 -353 9.77374 0.291
NP_442578.1_7 Forward -136 -129 5.93897 0.183
NP_441462.1_2 Forward -137 -127 2.14332 0.0801
NP_441462.1_2 Reverse -128 -138 1.84832 0.081
NP_441462.1_2 Reverse -196 -206 -0.511621 0.236
NP_441462.1_2 Forward -396 -386 -1.29827 0.299
NP_441621.1_7 Reverse -197 -211 6.09611 0.068
NP_441621.1_7 Reverse -194 -208 -6.19526 0.279
NP_441601.1_4 Forward -102 -83 3.83436 0.203
NP_440519.1_8 Reverse -86 -102 6.84337 0.21
NP_442204.1_1 Forward -69 -58 -0.137991 0.286
NP_441560.1_8 Forward -210 -191 15.1161 0.122
NP_440516.1_8 Forward -137 -128 15.6344 0.00582
NP_440516.1_8 Reverse -128 -137 7.47288 0.0581
NP_440516.1_8 Forward -396 -387 0.688044 0.136
NP_442428.1_5 Reverse -129 -136 6.13563 0.209
NP_442428.1_5 Forward -136 -129 6.0373 0.212
NP_442120.1_10 Forward -42 -23 -16.2252 0.297
NP_442823.1_8 Reverse -74 -93 10.4225 0.297
NP_440673.1_3 Reverse -130 -137 12.4288 0.0426
NP_440673.1_3 Forward -203 -196 7.41394 0.263
NP_440077.1_7 Reverse -221 -240 12.4875 0.268
NP_440865.1_9 Reverse -83 -102 -7.37537 0.244
NP_441052.1_2 Forward -137 -127 10.3048 0.0289
NP_441052.1_2 Reverse -128 -138 0.766681 0.256
NP_441052.1_2 Forward -230 -220 -0.0199663 0.265
NP_442219.1_9 Forward -136 -127 7.96454 0.0696
NP_440436.1_4 Reverse -129 -138 14.9456 0.0103
NP_440436.1_4 Forward -136 -127 13.9623 0.0193
NP_441884.1_8 Reverse -84 -103 -3.83545 0.143
NP_441884.1_9 Reverse -193 -212 -21.83 0.266
NP_441884.1_9 Forward -140 -121 -24.78 0.289
NP_441719.1_4 Forward -136 -129 6.72562 0.093
NP_441719.1_4 Reverse -129 -136 6.62729 0.151
NP_441733.1_10 Forward -399 -386 5.03416 0.231
NP_441004.1_1 Reverse -381 -400 -17.7985 0.294
NP_441004.1_3 Reverse -92 -111 4.916 0.224
NP_440296.1_10 Reverse -65 -84 -8.16202 0.248
NP_441115.1_4 Forward -138 -120 8.6715 0.24
NP_442694.1_4 Reverse -67 -76 12.2911 0.253
NP_441851.1_10 Forward -138 -128 6.27322 0.178
NP_441851.1_10 Reverse -127 -137 6.07655 0.187
NP_441542.1_4 Reverse -71 -85 3.73617 0.264
NP_442515.1_1 Reverse -226 -240 -0.492064 0.224
NP_442515.1_1 Reverse -195 -209 -3.44199 0.29
NP_441396.1_5 Reverse -159 -168 7.27622 0.29
NP_441661.1_3 Reverse -304 -321 1.71047 0.226
NP_440432.1_9 Forward -204 -189 -3.36336 0.179
NP_440432.1_9 Forward -93 -78 -6.41162 0.299
NP_441124.1_5 Reverse -307 -317 12.7217 0.215
NP_442450.1_5 Reverse -385 -395 7.84651 0.13
NP_439950.1_1 Forward -191 -182 14.5527 0.212
NP_439950.1_1 Reverse -164 -173 12.4878 0.279
NP_441570.1_1 Reverse -52 -70 -11.6822 0.201
NP_441078.1_4 Reverse -128 -137 9.93116 0.0203
NP_441078.1_4 Forward -137 -128 9.83282 0.0226
NP_442388.1_3 Forward -242 -223 5.211 0.282
NP_442443.1_1 Forward -398 -379 -5.9004 0.287
NP_441432.1_8 Reverse -127 -136 7.07956 0.105
NP_441432.1_8 Forward -245 -236 3.04799 0.268
NP_442320.1_8 Forward -143 -129 -1.67204 0.0821
NP_442320.1_8 Reverse -122 -136 -4.81863 0.188
NP_441732.1_2 Forward -228 -212 -17.641 0.281
NP_440760.1_1 Reverse -128 -147 -19.6667 0.219
NP_440760.1_1 Forward -137 -118 -22.6167 0.263
NP_442797.1_1 Forward -102 -83 -0.590531 0.231
NP_441057.1_4 Forward -40 -22 0.510803 0.253
NP_442510.1_9 Forward -400 -386 19.3708 0.158
NP_440913.1_1 Reverse -84 -102 12.4089 0.16
NP_442727.1_1 Forward -37 -23 13.9626 0.237
NP_442751.1_2 Forward -102 -83 5.01354 0.261
NP_440280.1_4 Reverse -94 -108 17.7975 0.27
NP_442489.1_7 Reverse -128 -137 10.6195 0.00984
NP_442489.1_7 Forward -137 -128 10.3245 0.0193
NP_442489.1_7 Forward -396 -387 -1.86856 0.259
NP_440559.1_1 Forward -136 -127 7.96454 0.0739
NP_440559.1_1 Reverse -129 -138 5.50626 0.14
NP_441659.2_8 Forward -137 -127 14.828 0.00801
NP_441659.2_8 Reverse -196 -206 3.32329 0.164
NP_441659.2_8 Reverse -128 -138 2.43831 0.2
NP_441022.1_1 Reverse -262 -271 10.7788 0.285
NP_440363.1_9 Reverse -59 -77 15.8504 0.187
NP_442913.1_10 Reverse -187 -206 -4.22878 0.23
NP_440336.1_1 Reverse -285 -304 15.3391 0.263
NP_439956.1_7 Reverse -89 -108 4.42435 0.257
NP_439956.1_8 Reverse -89 -108 9.14423 0.289
NP_440779.1_5 Forward -205 -188 -5.86102 0.152
NP_442346.1_5 Reverse -195 -205 9.41981 0.118
NP_442346.1_5 Forward -138 -128 7.64985 0.162
NP_442346.1_5 Reverse -127 -137 6.96153 0.187
NP_442346.1_5 Reverse -226 -236 4.60159 0.281
NP_440352.1_5 Reverse -299 -318 13.3371 0.193
NP_440545.1_3 Reverse -192 -209 -3.50107 0.206
NP_441856.1_3 Forward -140 -121 -0.885524 0.228
NP_440025.1_3 Forward -80 -66 13.4183 0.24
NP_440831.1_3 Reverse -378 -397 4.73683 0.298
NP_440459.1_2 Forward -139 -122 7.31533 0.296
NP_441833.1_4 Reverse -129 -136 14.1004 0.0258
NP_441833.1_4 Forward -136 -129 6.13563 0.198
NP_441329.1_6 Reverse -298 -317 2.05265 0.231
NP_441329.1_6 Reverse -294 -313 1.76618 0.231
NP_441895.1_10 Forward -266 -247 -18.5851 0.282
NP_441895.1_10 Reverse -70 -89 -27.8282 0.299
NP_442162.1_9 Reverse -129 -136 6.62729 0.142
NP_442162.1_9 Forward -136 -129 6.52896 0.178
NP_440671.1_4 Reverse -199 -213 10.521 0.155
NP_441915.1_9 Reverse -69 -88 11.8975 0.268
NP_442140.1_3 Forward -136 -126 10.7964 0.0902
NP_442140.1_3 Reverse -236 -246 6.37155 0.172
NP_442140.1_3 Forward -207 -197 5.28991 0.216
NP_442140.1_3 Reverse -129 -139 4.79825 0.238
NP_442140.1_3 Forward -238 -228 3.91327 0.271
NP_440875.1_9 Reverse -130 -140 16.6457 0.0145
NP_441813.1_5 Forward -139 -129 9.61647 0.027
NP_440594.1_5 Forward -156 -137 4.52188 0.293
NP_440590.1_4 Reverse -129 -142 9.16406 0.0381
NP_440590.1_4 Forward -136 -123 -1.16069 0.212
NP_440567.1_1 Forward -136 -122 3.34284 0.145
NP_440567.1_1 Reverse -129 -143 0.786239 0.232
NP_442497.1_10 Reverse -129 -138 0.688044 0.141
NP_442497.1_10 Forward -136 -127 0.589713 0.153
NP_440821.1_4 Forward -139 -129 0.373358 0.18
NP_440821.1_4 Reverse -126 -136 -0.314959 0.251
NP_440821.1_4 Forward -398 -388 -0.806614 0.296
NP_441239.1_9 Forward -139 -127 4.36554 0.253
NP_441239.1_9 Forward -210 -198 4.16888 0.26
NP_441239.1_9 Forward -219 -207 3.38223 0.285
NP_440400.1_1 Forward -167 -148 5.40686 0.22
NP_440400.1_1 Forward -107 -88 3.83357 0.22
NP_441892.1_1 Forward -214 -197 -2.41943 0.221
NP_441541.1_1 Forward -298 -280 -3.53122 0.264
NP_440546.1_4 Forward -137 -127 8.00989 0.209
NP_442349.1_6 Reverse -193 -212 1.76941 0.214
NP_441230.1_5 Reverse -376 -395 1.47442 0.24
NP_440462.1_4 Forward -397 -383 5.30946 0.29
NP_440462.1_6 Forward -139 -129 7.64985 0.0705
NP_440462.1_6 Forward -398 -388 4.89658 0.18
NP_440868.1_4 Forward -141 -129 2.98891 0.142
NP_440868.1_4 Reverse -124 -136 -1.14099 0.296
NP_441474.1_1 Forward -102 -83 -2.36125 0.275
NP_440341.1_1 Reverse -91 -110 8.16093 0.192
NP_442402.1_4 Forward -20 -1 -4.22953 0.224
NP_442402.1_4 Forward -73 -54 -5.50783 0.244
NP_442402.1_10 Forward -316 -306 13.4509 0.202
NP_441848.1_4 Reverse -302 -318 8.60108 0.288
NP_440696.1_3 Forward -208 -190 -4.01242 0.294
NP_441843.2_9 Reverse -130 -148 14.6743 0.179
NP_442829.1_2 Reverse -301 -317 8.14109 0.287
NP_442837.1_3 Reverse -129 -136 6.13563 0.25
NP_442837.1_3 Forward -136 -129 5.93897 0.265
NP_439994.1_4 Forward -79 -60 10.7175 0.239
NP_442053.1_1 Reverse -128 -137 9.34117 0.0666
NP_442053.1_1 Forward -137 -128 8.55452 0.0784
NP_442053.1_1 Reverse -387 -396 4.42462 0.249
NP_440505.1_3 Forward -139 -129 14.6313 0.019
NP_441701.1_3 Reverse -91 -108 7.70866 0.257
NP_440914.1_1 Forward -137 -127 7.83437 0.219
NP_440914.1_1 Forward -76 -66 7.5416 0.232
NP_440914.1_1 Reverse -128 -138 7.05364 0.254
NP_440914.1_1 Reverse -230 -240 6.46809 0.279
NP_441011.1_8 Reverse -129 -138 7.17789 0.179
NP_442533.1_1 Reverse -151 -170 -17.2085 0.281
NP_442533.1_6 Reverse -128 -137 7.66954 0.0897
NP_442533.1_6 Forward -137 -128 7.37455 0.0898
NP_441089.1_10 Reverse -197 -216 0.884433 0.294
NP_442232.1_3 Reverse -191 -210 -8.26035 0.219
NP_442229.1_1 Reverse -126 -140 7.07881 0.198
NP_443016.1_1 Forward -115 -96 -1.96717 0.223
NP_439944.1_9 Forward -136 -126 8.53483 0.107
NP_441028.1_6 Forward -315 -305 5.19112 0.265
NP_440116.1_5 Forward -247 -230 4.85706 0.178
NP_441527.1_4 Forward -128 -109 -5.96867 0.212
NP_440115.1_6 Reverse -193 -203 4.60159 0.293
NP_441680.1_4 Reverse -197 -216 -2.55715 0.268
NP_441602.1_3 Reverse -194 -213 0.294447 0.217
NP_442673.1_7 Reverse -270 -289 14.7531 0.192
NP_441972.1_3 Reverse -89 -108 11.1109 0.284
NP_441106.1_1 Forward -138 -129 8.35786 0.0585
NP_441106.1_1 Reverse -127 -136 6.29291 0.0927
NP_440429.1_2 Forward -225 -206 9.93088 0.272
NP_441869.1_2 Reverse -114 -133 10.4225 0.257
NP_442588.1_1 Forward -155 -136 6.4893 0.265
NP_441286.1_1 Forward -138 -126 0.825626 0.107
NP_441286.1_1 Reverse -127 -139 -3.6976 0.146
NP_441286.1_1 Forward -397 -385 -5.86088 0.229
NP_441286.1_1 Reverse -195 -207 -7.04085 0.3
NP_440670.1_8 Reverse -128 -137 16.5193 0.00214
NP_440670.1_8 Forward -137 -128 9.4395 0.0559
NP_440886.1_7 Forward -138 -128 13.8442 0.0642
NP_440886.1_7 Reverse -198 -208 4.30615 0.243
NP_442382.1_9 Forward -28 -9 10.3234 0.281
NP_442963.1_7 Reverse -197 -216 12.5858 0.204
NP_440907.2_8 Forward -243 -233 4.50281 0.261
NP_442264.1_2 Forward -240 -223 9.28195 0.198
NP_441626.1_2 Forward -136 -129 6.0373 0.212
NP_441626.1_2 Reverse -129 -136 6.0373 0.212
NP_442794.1_1 Reverse -124 -136 8.00379 0.123
NP_442615.1_1 Reverse -119 -137 1.78911 0.0793
NP_441962.1_4 Reverse -216 -235 -11.4069 0.241
NP_440387.1_1 Forward -137 -121 -4.85801 0.203
NP_441431.1_2 Forward -140 -126 7.96378 0.23
NP_442647.1_7 Forward -168 -155 13.7856 0.214
NP_441836.1_2 Reverse -215 -234 -2.0655 0.224
NP_441836.1_2 Forward -143 -124 -3.24547 0.236
NP_441993.1_1 Reverse -89 -108 4.48058 0.22
NP_440114.1_10 Reverse -128 -142 14.1593 0.0429
NP_441425.1_3 Reverse -78 -88 18.0729 0.273
NP_442437.1_8 Forward -216 -197 6.39097 0.242
NP_440293.1_3 Reverse -93 -112 3.73603 0.192
NP_440766.1_4 Reverse -383 -397 5.21113 0.113
NP_440766.1_4 Reverse -150 -164 1.57289 0.226
NP_441237.1_9 Forward -136 -126 10.7964 0.218
NP_441979.1_5 Reverse -381 -400 -12.5869 0.228
NP_442930.1_1 Forward -318 -308 10.4026 0.276
NP_439910.1_2 Forward -145 -128 -22.184 0.215
NP_440798.1_6 Forward -243 -230 4.05085 0.147
NP_442680.1_7 Reverse -300 -319 -6.58872 0.265
NP_440473.1_1 Forward -224 -205 11.0646 0.283
NP_440473.1_9 Reverse -219 -238 -6.88371 0.236
NP_442509.1_9 Reverse -128 -138 16.1058 0.00871
NP_442509.1_9 Forward -175 -165 8.23937 0.192
NP_442509.1_9 Forward -205 -195 7.74772 0.205
NP_441159.1_7 Reverse -2 -21 -8.35868 0.264
NP_440554.1_4 Reverse -129 -139 6.96153 0.107
NP_441885.1_5 Forward -137 -127 11.3864 0.00668
NP_441885.1_5 Reverse -128 -138 1.74999 0.0991
NP_442703.1_9 Forward -360 -342 3.26407 0.297
NP_442341.1_7 Reverse -386 -400 9.34103 0.0751
NP_442341.1_7 Forward -138 -124 3.93283 0.208
NP_442341.1_7 Reverse -127 -141 1.96621 0.274
NP_441756.1_5 Reverse -206 -225 3.6377 0.199
NP_441756.1_5 Forward -209 -190 -4.42544 0.294
NP_441173.1_9 Forward -314 -306 10.9338 0.242
NP_440423.1_6 Forward -145 -126 -17.7985 0.233
NP_443000.1_7 Forward -139 -129 1.74999 0.229
NP_443000.1_7 Reverse -126 -136 0.57002 0.294
NP_440275.1_3 Forward -139 -129 5.78156 0.131
NP_440275.1_3 Reverse -126 -136 5.19158 0.161
NP_441307.1_6 Reverse -196 -215 4.42435 0.283
NP_443060.1_3 Reverse -213 -231 13.7855 0.216
NP_443060.1_5 Reverse -98 -117 8.75009 0.198
NP_441902.1_3 Forward -264 -254 11.524 0.298
NP_442451.1_2 Forward -398 -379 -2.16383 0.179
NP_442451.1_2 Forward -165 -146 -9.14533 0.259
NP_442451.1_2 Forward -102 -83 -9.34199 0.259
NP_439962.1_4 Forward -225 -206 1.96607 0.197
NP_439962.1_4 Reverse -379 -398 -5.31042 0.278
NP_440149.1_8 Reverse -148 -167 -2.95047 0.178
NP_440216.1_1 Reverse -128 -142 -1.18038 0.0301
NP_440216.1_1 Forward -137 -123 -10.6202 0.145
NP_440216.1_1 Forward -205 -191 -12.5868 0.288
NP_440216.1_9 Forward -196 -187 8.65285 0.286
NP_440216.1_9 Reverse -23 -32 7.17789 0.286
NP_440172.1_1 Forward -137 -127 5.19158 0.149
NP_440172.1_1 Forward -396 -386 4.50326 0.184
NP_442371.1_1 Reverse -306 -316 15.4175 0.146
NP_442015.1_10 Reverse -11 -24 2.57589 0.19
NP_442015.1_10 Forward -141 -128 0.215946 0.237
NP_441226.1_7 Reverse -86 -93 7.1186 0.218
NP_441226.1_7 Forward -108 -101 5.34865 0.289
NP_440305.1_1 Forward -127 -113 15.7678 0.155
NP_441111.1_7 Reverse -129 -137 8.96754 0.0463
NP_441111.1_7 Forward -136 -128 8.86921 0.0589
NP_441766.1_2 Reverse -128 -137 7.86621 0.0703
NP_441766.1_2 Forward -137 -128 7.66954 0.0723
NP_441766.1_2 Reverse -235 -244 3.34298 0.22
NP_440416.1_1 Reverse -128 -147 -12.1936 0.272
NP_443052.1_8 Forward -147 -128 -10.3253 0.207
NP_443052.1_8 Reverse -186 -205 -10.6203 0.212
NP_443052.1_9 Forward -228 -209 1.47442 0.185
NP_440591.1_9 Reverse -88 -106 6.01734 0.231
NP_442154.1_1 Forward -38 -20 -18.6637 0.284
NP_442154.1_6 Forward -397 -378 9.0459 0.199
NP_440261.1_5 Forward -136 -123 -10.6988 0.203
NP_440261.1_5 Reverse -129 -142 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCGGCGATTGAGCTGGGCCCCTGAAAATTTACGACCCTAAAAATTCTGGCCCCAAAAAATAGGTTAGAATGATAAACGCGAAATTTTTCCCAGTCTATTTTTATTTAGTATGATTAAACTCCGTCTAAAACGCTTTGGTAAGAAACGTGAAGTTAGCTATCGGATCGTTGCCATGCACAGCACCACCCGCCGGGATGGTCGCCCCTTGGAAGAATTAGGATTCTATAATCCCCGCACCGATGAAACTCGCCTTGATGTACCGGCGATCGTCAAAAGATTAAAAGAAGGTGCCCAACCCACCGACACCGTCCGCTCCATTTTGACCAAAGCCCAGGTTTTCGAACAGCTAAAAGCTTAGTGCCGGTTTTTTCCGTGGTGTTTACCAACGTCTGCCCCCT

CDS

GTGACTACCCTAAACTACGTTGAATTGGTCAAGTTTCTTGTCCGTCCCTTTTTGGAAAAGCCCGATGATCTGAAGGTGGACTGTGAGGTGTTTCGACAAAATAGCCGGGTTTGGATTCGGTTAGCCCTAGGGGACGAAGACCGGGAAAGGCTCCTTAGCCGGGGAGGGAGGAGTTTGCAAACCATTCGCACCCTACTTACCACCGCCGCTGACCAGATGGAACAGTCAGCCTTCCTAGAGATATACCTCACCGATTCCGTTGGGAAATCGACCCCCCTACGCCGTCGTCGCTCCTCTGCTGGCCCCGCCCCTGTCCGTCGTTCCCGCAGTCGGGGAGAGTCCGTTAATCGCTACTAG

Protein

MTTLNYVELVKFLVRPFLEKPDDLKVDCEVFRQNSRVWIRLALGDEDRERLLSRGGRSLQTIRTLLTTAADQMEQSAFLEIYLTDSVGKSTPLRRRRSSAGPAPVRRSRSRGESVNRY