Your browser is old and dusty. Try Google Chrome!

Details for slr0284

ORF slr0284
Accession NP_441826.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -113 -99 12.3893 0.0468
NP_441061.1_2 Forward -400 -386 5.40779 0.137
NP_441061.1_2 Reverse -380 -394 -0.885388 0.242
NP_441061.1_2 Reverse -106 -120 -1.5737 0.265
NP_440795.1_7 Forward -113 -106 14.6904 0.0123
NP_440795.1_7 Reverse -106 -113 14.6904 0.0123
NP_441418.1_6 Reverse -105 -124 -10.1286 0.0319
NP_441418.1_6 Forward -114 -95 -20.5517 0.117
NP_441453.1_4 Reverse -105 -113 16.539 0.00633
NP_441453.1_4 Forward -114 -106 16.539 0.00633
NP_441453.1_4 Reverse -392 -400 6.11594 0.121
NP_442151.1_6 Forward -114 -100 14.6509 0.0321
NP_442151.1_6 Forward -22 -8 5.1128 0.294
NP_441818.1_1 Forward -113 -102 14.2178 0.0541
NP_441818.1_9 Reverse -137 -156 -8.16202 0.274
NP_441818.1_9 Reverse -91 -110 -10.1286 0.292
NP_440226.1_1 Reverse -105 -124 3.83436 0.212
NP_440226.1_1 Reverse -338 -357 2.85105 0.249
NP_440150.1_2 Forward -399 -380 5.99684 0.261
NP_442173.1_1 Forward -113 -105 15.4574 0.00633
NP_442173.1_1 Reverse -106 -114 15.4574 0.00633
NP_442173.1_1 Forward -400 -392 10.7375 0.0611
NP_442752.1_4 Forward -114 -107 13.8055 0.0199
NP_442752.1_4 Reverse -105 -112 13.8055 0.0199
NP_443027.1_4 Reverse -103 -113 7.35486 0.24
NP_443027.1_4 Forward -116 -106 5.87989 0.294
NP_442975.1_10 Reverse -101 -115 4.12889 0.249
NP_442975.1_10 Forward -118 -104 2.94893 0.266
NP_441225.1_4 Forward -201 -182 -4.6221 0.27
NP_440784.1_7 Forward -113 -106 15.9687 0.0123
NP_440784.1_7 Reverse -106 -113 15.9687 0.0123
NP_440784.1_7 Forward -400 -393 6.23397 0.241
NP_440784.1_7 Reverse -393 -400 6.13563 0.241
NP_442909.1_7 Forward -400 -386 11.5037 0.131
NP_442909.1_7 Forward -113 -99 11.4053 0.131
NP_442909.1_7 Reverse -100 -114 8.55376 0.172
NP_440061.1_9 Forward -116 -102 9.53707 0.143
NP_442062.1_8 Reverse -105 -115 19.4496 0.000558
NP_442062.1_8 Forward -114 -104 17.6796 0.00193
NP_441859.1_3 Forward -75 -56 8.25844 0.142
NP_440304.1_4 Reverse -103 -113 18.9579 0.00406
NP_440304.1_4 Forward -116 -106 1.84832 0.299
NP_442242.1_4 Forward -113 -106 14.3954 0.0124
NP_442242.1_4 Reverse -106 -113 14.3954 0.0124
NP_440044.1_8 Reverse -106 -125 -1.57384 0.248
NP_441594.1_6 Reverse -96 -115 12.4875 0.109
NP_440132.1_1 Reverse -336 -354 9.65558 0.234
NP_442110.1_7 Reverse -386 -400 3.53951 0.21
NP_442110.1_7 Forward -114 -100 3.44117 0.21
NP_441082.1_10 Reverse -92 -105 11.0324 0.236
NP_442726.1_7 Reverse -98 -116 -0.374176 0.258
NP_441925.1_4 Forward -339 -320 -17.2092 0.29
NP_440856.1_1 Reverse -95 -114 -5.9004 0.297
NP_440856.1_4 Forward -121 -102 7.96426 0.06
NP_441083.1_5 Forward -114 -104 19.3512 0.000718
NP_441083.1_5 Reverse -105 -115 11.3864 0.0159
NP_442827.1_8 Forward -396 -377 -1.47628 0.247
NP_441738.1_2 Forward -112 -105 15.28 0.0102
NP_441738.1_2 Reverse -107 -114 15.28 0.0102
NP_440209.1_1 Reverse -105 -113 18.1123 0.00295
NP_440209.1_1 Forward -114 -106 18.1123 0.00295
NP_442889.1_8 Reverse -102 -116 9.73373 0.0945
NP_442675.1_4 Forward -73 -55 -5.38906 0.274
NP_441770.1_10 Forward -243 -224 8.25926 0.284
NP_441716.1_1 Forward -114 -100 3.63784 0.259
NP_442111.1_4 Forward -115 -101 10.1277 0.0562
NP_442111.1_4 Reverse -104 -118 7.76774 0.0867
NP_440906.1_5 Forward -113 -106 15.8704 0.0124
NP_440906.1_5 Reverse -106 -113 15.8704 0.0124
NP_440906.1_5 Forward -400 -393 6.23397 0.234
NP_440906.1_5 Reverse -393 -400 6.13563 0.241
NP_440747.1_10 Forward -117 -105 15.1819 0.00196
NP_440747.1_10 Reverse -102 -114 -2.02597 0.0196
NP_441486.1_1 Forward -117 -103 11.8976 0.0137
NP_441486.1_1 Reverse -102 -116 4.52282 0.0432
NP_442634.1_4 Reverse -103 -117 -2.75368 0.156
NP_442634.1_4 Forward -190 -176 -4.22864 0.19
NP_440403.1_10 Reverse -96 -115 0.58944 0.3
NP_440842.1_10 Reverse -96 -110 4.52282 0.254
NP_441014.1_8 Forward -202 -183 -1.7705 0.224
NP_441014.1_10 Forward -379 -360 -0.39464 0.25
NP_442848.1_1 Reverse -99 -113 -2.06536 0.263
NP_442848.1_5 Forward -333 -315 -2.83245 0.286
NP_443018.1_3 Forward -113 -106 14.8871 0.0123
NP_443018.1_3 Reverse -106 -113 14.8871 0.0123
NP_443018.1_3 Reverse -393 -400 11.7405 0.0655
NP_443018.1_3 Forward -400 -393 5.44732 0.193
NP_441316.1_7 Reverse -103 -118 4.60145 0.124
NP_440376.1_1 Forward -114 -105 19.4693 0.000692
NP_440376.1_1 Reverse -105 -114 19.4693 0.000692
NP_441588.1_4 Reverse -107 -117 7.35486 0.178
NP_443065.1_6 Forward -118 -99 5.89931 0.21
NP_442687.1_7 Reverse -104 -114 18.5646 0.0028
NP_442687.1_7 Forward -115 -105 15.8113 0.0125
NP_442687.1_7 Forward -63 -53 9.12481 0.0994
NP_442687.1_7 Reverse -136 -146 6.96153 0.147
NP_442687.1_7 Reverse -329 -339 4.79825 0.234
NP_442485.1_3 Reverse -94 -113 2.94938 0.207
NP_442485.1_3 Forward -199 -180 -3.44213 0.274
NP_442485.1_3 Forward -125 -106 -5.70374 0.295
NP_442530.1_2 Forward -75 -65 13.7464 0.226
NP_441013.1_2 Reverse -42 -60 -3.32411 0.29
NP_440042.1_2 Reverse -320 -339 -3.04881 0.274
NP_441422.1_7 Forward -190 -173 -3.00942 0.226
NP_440887.1_5 Forward -152 -133 18.3851 0.121
NP_442658.1_1 Forward -116 -106 15.9091 0.00966
NP_442658.1_1 Reverse -103 -113 14.8275 0.0188
NP_441855.2_4 Reverse -97 -116 10.7764 0.243
NP_442782.1_2 Reverse -137 -151 1.27789 0.281
NP_441414.1_9 Reverse -105 -124 -5.80207 0.18
NP_440800.1_2 Forward -128 -109 15.9968 0.155
NP_441487.1_6 Forward -122 -103 1.96607 0.254
NP_442937.1_5 Forward -119 -100 13.5691 0.0903
NP_442937.1_5 Forward -79 -60 7.17762 0.26
NP_441958.1_5 Reverse -104 -114 20.5312 0.000966
NP_441958.1_5 Forward -115 -105 12.2714 0.00183
NP_440203.1_5 Reverse -37 -47 9.12434 0.271
NP_439905.1_2 Forward -113 -99 11.0127 0.208
NP_440984.1_7 Forward -119 -105 5.89945 0.235
NP_442911.1_2 Reverse -95 -114 -5.40875 0.158
NP_441580.1_6 Reverse -94 -113 -5.60541 0.235
NP_442064.1_4 Forward -124 -105 4.62021 0.286
NP_443055.1_6 Forward -114 -96 4.63995 0.181
NP_440827.1_3 Reverse -94 -113 10.6192 0.298
NP_440138.1_6 Forward -400 -381 1.76863 0.277
NP_441099.1_5 Reverse -95 -114 8.55425 0.0372
NP_442002.1_9 Reverse -104 -111 14.1004 0.074
NP_442002.1_9 Reverse -329 -336 12.2322 0.185
NP_442002.1_9 Forward -115 -108 10.7572 0.185
NP_442598.1_2 Reverse -283 -292 14.2577 0.252
NP_442438.1_10 Reverse -100 -114 1.76955 0.188
NP_441000.1_6 Reverse -104 -118 5.50613 0.0933
NP_442771.1_1 Forward -116 -98 10.6389 0.0206
NP_442771.1_1 Reverse -103 -121 -5.97904 0.166
NP_440147.1_4 Forward -116 -103 12.9006 0.0326
NP_440147.1_4 Reverse -103 -116 2.77255 0.202
NP_441175.1_2 Forward -203 -184 11.1109 0.175
NP_441295.1_4 Reverse -100 -119 -2.45882 0.29
NP_441550.1_8 Reverse -103 -113 15.4175 0.0132
NP_441550.1_8 Reverse -390 -400 10.4026 0.0684
NP_441550.1_8 Forward -116 -106 8.3377 0.124
NP_441916.1_7 Reverse -105 -115 18.4663 0.00144
NP_441916.1_7 Forward -114 -104 16.893 0.00407
NP_441041.1_4 Reverse -105 -124 -2.36049 0.111
NP_441041.1_7 Forward -117 -105 15.6777 0.0222
NP_440016.1_9 Reverse -219 -238 11.9958 0.259
NP_442004.1_6 Forward -114 -100 11.996 0.115
NP_440703.1_9 Reverse -99 -112 7.59019 0.254
NP_441725.1_4 Reverse -100 -114 8.3571 0.201
NP_441725.1_5 Forward -113 -103 21.0229 0.00533
NP_441725.1_5 Reverse -106 -116 2.04498 0.115
NP_439966.1_7 Forward -116 -106 9.91099 0.0968
NP_439966.1_7 Reverse -103 -113 9.12434 0.119
NP_439966.1_7 Forward -380 -370 5.78111 0.209
NP_439966.1_7 Forward -390 -380 4.10949 0.289
NP_439966.1_9 Forward -116 -107 0.884706 0.253
NP_440736.1_3 Reverse -103 -122 -0.787193 0.282
NP_442941.1_3 Forward -113 -103 11.3864 0.0116
NP_442941.1_3 Reverse -106 -116 2.63497 0.14
NP_440289.1_2 Reverse -102 -115 6.4108 0.0596
NP_440289.1_2 Forward -117 -104 5.91914 0.0605
NP_440260.1_8 Reverse -96 -114 -2.0458 0.243
NP_441514.1_6 Forward -284 -277 12.8221 0.252
NP_441678.1_9 Reverse -238 -257 6.88262 0.17
NP_441678.1_9 Reverse -86 -105 -4.03212 0.288
NP_442281.1_1 Forward -119 -105 21.5334 0.00192
NP_442281.1_1 Reverse -100 -114 10.3237 0.0595
NP_442256.1_2 Reverse -103 -121 -7.15901 0.214
NP_441164.1_4 Forward -182 -163 13.8633 0.208
NP_442012.1_1 Forward -120 -101 3.83436 0.179
NP_441860.1_1 Forward -218 -204 16.6159 0.276
NP_442982.1_5 Reverse -169 -188 -2.55715 0.286
NP_440375.1_8 Reverse -106 -125 3.14605 0.22
NP_442068.1_4 Forward -338 -319 4.42355 0.296
NP_441644.1_6 Forward -114 -104 15.7125 0.0048
NP_441644.1_6 Reverse -105 -115 10.1076 0.0628
NP_440867.1_10 Reverse -90 -109 1.47442 0.295
NP_442215.1_2 Forward -116 -100 8.31834 0.066
NP_442247.1_8 Forward -116 -102 11.2093 0.247
NP_440929.1_8 Forward -114 -105 19.2726 0.000701
NP_440929.1_8 Reverse -105 -114 19.2726 0.000701
NP_442933.1_10 Forward -114 -105 17.601 0.00325
NP_442933.1_10 Reverse -105 -114 17.601 0.00325
NP_441751.2_8 Forward -113 -99 6.09611 0.0396
NP_442926.1_3 Reverse -94 -113 3.04771 0.293
NP_442926.1_9 Reverse -356 -375 21.6323 0.125
NP_442554.1_8 Forward -113 -103 14.828 0.0108
NP_442554.1_8 Reverse -106 -116 13.2547 0.0187
NP_442554.1_8 Forward -400 -390 9.61647 0.0576
NP_441762.1_7 Reverse -104 -116 18.7219 0.00342
NP_441762.1_7 Forward -115 -103 2.20226 0.0676
NP_442142.1_4 Reverse -102 -115 8.47516 0.113
NP_442142.1_4 Forward -117 -104 7.19687 0.144
NP_442292.1_1 Reverse -106 -115 9.63616 0.0183
NP_442292.1_1 Forward -113 -104 9.53783 0.0183
NP_442292.1_1 Forward -400 -391 8.1612 0.0478
NP_441024.1_7 Reverse -277 -295 8.47483 0.3
NP_442381.1_8 Forward -117 -98 -14.1602 0.28
NP_442381.1_8 Reverse -102 -121 -15.1435 0.298
NP_443009.1_5 Reverse -104 -115 20.6093 0.001
NP_443009.1_5 Forward -115 -104 9.10461 0.0965
NP_441715.1_4 Reverse -106 -116 9.41981 0.097
NP_441715.1_4 Forward -113 -103 7.25653 0.108
NP_440279.1_9 Forward -370 -351 19.7262 0.155
NP_440015.1_9 Forward -114 -96 0.609134 0.248
NP_440183.1_9 Forward -201 -182 -20.65 0.29
NP_440183.1_9 Reverse -181 -200 -21.1417 0.296
NP_441198.1_8 Reverse -103 -113 13.076 0.108
NP_440379.1_5 Reverse -96 -115 -3.93378 0.207
NP_440379.1_5 Reverse -170 -189 -9.53865 0.264
NP_441468.1_1 Forward -113 -106 15.8704 0.0124
NP_441468.1_1 Reverse -106 -113 15.8704 0.0124
NP_441468.1_1 Forward -400 -393 6.13563 0.209
NP_441468.1_1 Reverse -393 -400 6.0373 0.223
NP_441020.2_6 Reverse -103 -120 20.295 0.00617
NP_441020.2_6 Forward -116 -99 10.6586 0.139
NP_441015.1_10 Reverse -94 -113 -10.817 0.288
NP_441673.1_1 Forward -114 -105 20.8459 0.000698
NP_441673.1_1 Reverse -105 -114 20.8459 0.000698
NP_441826.1_2 Reverse -99 -113 5.99778 0.0946
NP_441826.1_4 Forward -73 -54 22.9106 0.0251
NP_441826.1_5 Forward -240 -221 19.6656 0.0501
NP_441826.1_5 Reverse -220 -239 7.86593 0.221
NP_441330.1_1 Forward -119 -100 -13.0786 0.183
NP_442490.1_9 Reverse -93 -112 15.5357 0.0517
NP_442868.1_6 Reverse -103 -113 9.22315 0.0527
NP_442868.1_6 Forward -116 -106 0.865012 0.205
NP_441056.1_1 Forward -114 -95 5.70265 0.113
NP_442808.1_1 Forward -115 -105 18.4657 0.00201
NP_442808.1_1 Reverse -104 -114 8.73102 0.0481
NP_440145.1_3 Forward -124 -105 0.392778 0.136
NP_440145.1_3 Reverse -369 -388 -1.37718 0.151
NP_442542.1_2 Forward -116 -103 11.1307 0.114
NP_442542.1_2 Reverse -97 -110 8.47575 0.154
NP_442050.1_5 Reverse -103 -113 15.8108 0.0091
NP_442342.1_9 Forward -116 -100 8.515 0.194
NP_440558.1_2 Reverse -96 -115 5.89931 0.137
NP_441518.1_3 Forward -357 -338 -12.6852 0.263
NP_441878.1_6 Reverse -104 -114 20.2362 0.0046
NP_441878.1_6 Forward -115 -105 10.4031 0.0176
NP_441878.1_6 Reverse -98 -108 -7.19813 0.21
NP_441878.1_10 Forward -63 -49 11.0127 0.289
NP_441036.1_8 Forward -115 -105 17.7779 0.000554
NP_441036.1_8 Reverse -104 -114 8.4365 0.174
NP_441557.1_5 Forward -114 -105 19.9609 0.000699
NP_441557.1_5 Reverse -105 -114 19.9609 0.000699
NP_441557.1_8 Forward -105 -95 16.1058 0.18
NP_441445.1_1 Forward -123 -104 15.2408 0.0453
NP_441590.1_4 Forward -112 -93 6.09517 0.26
NP_442830.1_5 Forward -108 -94 12.6836 0.168
NP_442183.1_1 Forward -114 -100 18.3875 0.00758
NP_442183.1_1 Reverse -105 -119 8.55439 0.113
NP_442183.1_3 Forward -130 -111 14.3549 0.243
NP_441819.1_5 Forward -134 -115 11.4109 0.261
NP_440861.1_3 Reverse -94 -112 12.2122 0.245
NP_442347.1_2 Reverse -106 -115 11.1111 0.056
NP_442347.1_2 Forward -113 -104 3.34298 0.284
NP_442645.1_2 Reverse -97 -116 3.14605 0.0333
NP_442645.1_2 Reverse -377 -396 -17.8968 0.266
NP_441037.1_4 Forward -116 -106 14.7245 0.028
NP_441037.1_4 Reverse -103 -113 9.65667 0.21
NP_441037.1_4 Reverse -237 -247 6.53804 0.255
NP_441633.1_3 Forward -116 -103 12.8023 0.0192
NP_441633.1_3 Reverse -103 -116 -5.78224 0.236
NP_440136.1_2 Forward -113 -106 15.9687 0.0123
NP_440136.1_2 Reverse -106 -113 15.9687 0.0123
NP_440136.1_2 Forward -400 -393 6.23397 0.171
NP_440136.1_2 Reverse -393 -400 6.13563 0.193
NP_442998.1_10 Forward -112 -105 15.5754 0.0102
NP_442998.1_10 Reverse -107 -114 15.5754 0.0102
NP_440299.1_1 Reverse -101 -114 19.4882 0.00234
NP_440299.1_1 Forward -118 -105 10.5401 0.0569
NP_441799.1_1 Forward -118 -104 7.57046 0.138
NP_441799.1_1 Reverse -101 -115 6.98048 0.155
NP_441007.1_10 Reverse -100 -113 1.39592 0.203
NP_442334.1_2 Reverse -328 -345 -5.46769 0.205
NP_442201.1_10 Forward -125 -106 -4.91709 0.152
NP_442201.1_10 Reverse -94 -113 -14.7502 0.288
NP_441449.1_8 Forward -296 -277 13.5013 0.286
NP_442333.2_5 Reverse -94 -113 -12.9802 0.249
NP_440256.1_1 Forward -206 -187 -8.55534 0.263
NP_440256.1_1 Forward -117 -98 -8.94866 0.27
NP_440087.1_1 Reverse -88 -107 -4.22878 0.246
NP_441559.1_8 Forward -119 -105 -6.98191 0.281
NP_440915.1_6 Reverse -101 -115 5.40779 0.0903
NP_440915.1_6 Forward -118 -104 3.8345 0.1
NP_440717.1_3 Forward -111 -97 12.8803 0.227
NP_441704.1_8 Reverse -2 -21 6.98015 0.253
NP_441464.1_10 Reverse -319 -333 14.9459 0.166
NP_441199.1_6 Forward -118 -99 20.354 0.0212
NP_441494.1_6 Reverse -374 -387 8.77074 0.227
NP_442957.1_9 Reverse -365 -384 10.8159 0.189
NP_442993.1_1 Forward -114 -98 1.14018 0.0569
NP_442993.1_1 Reverse -379 -395 -11.2495 0.24
NP_442386.1_9 Forward -115 -106 15.7322 0.0144
NP_442386.1_9 Reverse -391 -400 8.75075 0.184
NP_442386.1_9 Forward -396 -387 8.45576 0.197
NP_442386.1_9 Reverse -104 -113 6.39082 0.219
NP_441340.1_5 Forward -113 -106 15.6737 0.0124
NP_441340.1_5 Reverse -106 -113 15.6737 0.0124
NP_441340.1_5 Forward -400 -393 13.5105 0.0314
NP_441340.1_5 Reverse -393 -400 5.84064 0.208
NP_440251.1_8 Reverse -99 -113 16.4209 0.142
NP_440161.1_3 Reverse -103 -122 17.994 0.0611
NP_440586.1_8 Forward -113 -106 13.2151 0.026
NP_440586.1_8 Reverse -106 -113 13.2151 0.026
NP_440586.1_8 Reverse -393 -400 9.47853 0.146
NP_440586.1_8 Forward -61 -54 5.93863 0.283
NP_440586.1_8 Forward -400 -393 5.74197 0.283
NP_442251.1_6 Forward -113 -106 15.2804 0.0124
NP_442251.1_6 Reverse -106 -113 15.2804 0.0124
NP_440684.1_9 Reverse -99 -113 12.7826 0.168
NP_440684.1_9 Forward -120 -106 9.2427 0.221
NP_441262.1_3 Reverse -105 -112 14.7888 0.0223
NP_441262.1_3 Forward -114 -107 14.7888 0.0223
NP_443051.1_1 Reverse -104 -113 18.0926 0.00402
NP_443051.1_1 Forward -115 -106 10.4228 0.00754
NP_441232.1_10 Reverse -94 -113 6.4893 0.161
NP_439937.1_9 Reverse -104 -121 -16.4814 0.287
NP_442294.1_3 Reverse -257 -271 13.9619 0.252
NP_442294.1_3 Reverse -342 -356 12.2903 0.29
NP_441595.1_5 Reverse -98 -116 9.65558 0.217
NP_440439.1_1 Forward -117 -104 10.5407 0.0365
NP_440439.1_1 Reverse -102 -115 0.117615 0.202
NP_440372.1_2 Forward -113 -106 16.3621 0.0124
NP_440372.1_2 Reverse -106 -113 16.3621 0.0124
NP_440372.1_2 Forward -400 -393 13.8055 0.0214
NP_440372.1_2 Reverse -393 -400 6.52896 0.188
NP_440316.1_10 Reverse -98 -108 8.23984 0.24
NP_440316.1_10 Reverse -231 -241 5.97822 0.275
NP_441803.1_2 Forward -119 -100 1.57275 0.229
NP_439977.1_5 Forward -120 -101 0.294447 0.211
NP_440139.1_1 Reverse -99 -118 5.99684 0.148
NP_440139.1_1 Forward -120 -101 2.16195 0.237
NP_441572.1_7 Reverse -99 -118 -2.16383 0.192
NP_440267.1_2 Forward -352 -338 6.78381 0.221
NP_440267.1_2 Forward -267 -253 4.52221 0.3
NP_442384.1_10 Forward -114 -101 18.3088 0.00492
NP_442384.1_10 Reverse -105 -118 6.80412 0.0939
NP_442572.1_6 Forward -246 -227 11.3075 0.229
NP_442790.1_4 Reverse -321 -340 3.14605 0.0729
NP_442790.1_4 Reverse -96 -115 -14.1602 0.272
NP_442262.1_10 Forward -113 -106 14.1988 0.0123
NP_442262.1_10 Reverse -106 -113 14.1988 0.0123
NP_442262.1_10 Reverse -393 -400 13.2155 0.0213
NP_441689.1_5 Reverse -103 -113 8.63269 0.132
NP_440344.1_10 Reverse -98 -115 -0.157821 0.0391
NP_440344.1_10 Forward -121 -104 -1.63279 0.0557
NP_442910.1_1 Forward -121 -102 -5.40875 0.254
NP_441335.1_8 Reverse -319 -338 8.55425 0.253
NP_441965.1_10 Reverse -102 -118 11.2683 0.107
NP_442065.1_2 Forward -201 -188 18.7015 0.188
NP_442529.1_4 Forward -123 -104 10.3242 0.227
NP_440297.1_9 Forward -113 -103 19.0562 0.0359
NP_440297.1_9 Reverse -106 -116 -0.118297 0.282
NP_441592.1_4 Forward -114 -95 6.78429 0.124
NP_441896.1_3 Reverse -96 -115 9.0459 0.0872
NP_441896.1_5 Reverse -322 -329 15.3787 0.268
NP_440937.1_4 Forward -235 -216 8.94757 0.227
NP_440999.1_9 Forward -118 -104 1.27789 0.168
NP_440888.1_2 Forward -114 -100 10.6187 0.0893
NP_440888.1_2 Forward -203 -189 6.88214 0.217
NP_440600.1_4 Forward -122 -104 -7.15901 0.291
NP_440052.1_5 Reverse -94 -113 -4.91709 0.268
NP_441543.1_2 Reverse -106 -115 18.486 0.00236
NP_441543.1_2 Forward -113 -104 9.34117 0.0818
NP_442845.1_2 Reverse -99 -113 9.73436 0.168
NP_442845.1_2 Forward -114 -100 4.22782 0.264
NP_441918.1_7 Reverse -249 -268 -3.3438 0.297
NP_441469.1_4 Reverse -25 -44 6.88262 0.282
NP_441469.1_8 Forward -115 -106 16.126 0.00797
NP_441469.1_8 Reverse -104 -113 13.3727 0.073
NP_443064.1_6 Forward -114 -104 13.8273 0.0796
NP_442578.1_7 Forward -113 -106 14.5921 0.026
NP_442578.1_7 Reverse -106 -113 14.5921 0.026
NP_442578.1_7 Forward -400 -393 6.0373 0.18
NP_440710.1_1 Forward -256 -238 -9.12563 0.294
NP_441462.1_2 Forward -114 -104 20.1379 0.000967
NP_441462.1_2 Reverse -105 -115 11.5831 0.00406
NP_441621.1_7 Reverse -103 -117 4.62115 0.0934
NP_443062.1_1 Reverse -105 -123 18.2967 0.0227
NP_443062.1_6 Forward -122 -103 0.392778 0.295
NP_442204.1_1 Reverse -101 -112 0.353664 0.281
NP_442204.1_5 Reverse -246 -265 0.392778 0.264
NP_440516.1_8 Forward -114 -105 16.9127 0.00442
NP_440516.1_8 Reverse -105 -114 16.9127 0.00442
NP_440516.1_8 Reverse -330 -339 -0.196935 0.185
NP_442080.1_7 Reverse -100 -119 -2.75381 0.287
NP_441033.1_2 Forward -124 -105 -5.80207 0.293
NP_442428.1_4 Forward -115 -96 3.44104 0.242
NP_442428.1_5 Forward -113 -106 15.8704 0.0124
NP_442428.1_5 Reverse -106 -113 15.8704 0.0124
NP_442428.1_5 Forward -400 -393 6.13563 0.209
NP_442428.1_5 Reverse -393 -400 6.0373 0.212
NP_442120.1_10 Forward -394 -375 -15.2418 0.292
NP_441867.1_2 Forward -238 -219 -13.9635 0.277
NP_441867.1_2 Reverse -90 -109 -20.3551 0.291
NP_440673.1_2 Reverse -95 -114 8.92631 0.26
NP_440673.1_3 Forward -112 -105 12.4288 0.0426
NP_440673.1_3 Reverse -107 -114 12.4288 0.0426
NP_440673.1_3 Forward -69 -62 7.41394 0.263
NP_440865.1_9 Reverse -99 -118 -7.27704 0.244
NP_441052.1_2 Reverse -105 -115 10.5014 0.0285
NP_441052.1_2 Forward -114 -104 10.4031 0.0285
NP_442219.1_9 Reverse -106 -115 8.35786 0.0681
NP_442219.1_9 Forward -113 -104 8.25953 0.0681
NP_442219.1_9 Reverse -387 -396 2.65466 0.241
NP_440436.1_4 Reverse -106 -115 18.1905 0.00233
NP_440436.1_4 Forward -113 -104 15.9289 0.00508
NP_441884.1_8 Reverse -104 -123 0.687771 0.138
NP_440314.1_9 Forward -113 -94 4.916 0.0752
NP_441719.1_4 Forward -113 -106 16.3621 0.0124
NP_441719.1_4 Reverse -106 -113 16.3621 0.0124
NP_441719.1_4 Forward -400 -393 6.82395 0.0855
NP_441719.1_4 Reverse -393 -400 6.52896 0.188
NP_441733.1_10 Reverse -102 -115 6.90245 0.166
NP_441733.1_10 Forward -117 -104 5.91914 0.203
NP_441004.1_1 Reverse -99 -118 1.37609 0.111
NP_441004.1_1 Reverse -93 -112 -14.0619 0.263
NP_441004.1_2 Reverse -229 -248 -2.65548 0.264
NP_442366.1_3 Reverse -104 -122 12.6055 0.0275
NP_442366.1_3 Forward -115 -97 -2.24246 0.224
NP_442366.1_3 Forward -45 -27 -2.73412 0.232
NP_442366.1_3 Reverse -378 -396 -5.58572 0.289
NP_442366.1_3 Reverse -5 -23 -5.78238 0.296
NP_442366.1_5 Forward -117 -107 11.9759 0.148
NP_442139.1_9 Forward -41 -22 9.73422 0.264
NP_440129.1_10 Forward -121 -107 6.58777 0.177
NP_442206.1_10 Reverse -105 -120 4.99478 0.178
NP_443054.1_2 Reverse -103 -117 12.8809 0.0722
NP_441851.1_10 Reverse -104 -114 17.4829 0.0027
NP_441851.1_10 Forward -115 -105 16.008 0.00552
NP_442011.1_1 Reverse -104 -123 -2.75381 0.282
NP_442515.1_1 Forward -115 -101 5.21113 0.107
NP_442515.1_1 Reverse -104 -118 -3.93365 0.298
NP_441683.1_7 Forward -283 -264 -4.42544 0.244
NP_440593.1_3 Forward -113 -94 6.58763 0.112
NP_440593.1_3 Reverse -221 -240 -5.01543 0.256
NP_441540.1_8 Reverse -116 -135 21.2389 0.0423
NP_440165.1_5 Reverse -104 -123 -5.01543 0.22
NP_441349.1_10 Forward -124 -105 1.57275 0.0827
NP_441409.1_6 Reverse -99 -118 -15.1435 0.28
NP_441394.1_4 Forward -274 -255 11.0125 0.2
NP_440389.1_5 Forward -164 -145 14.5362 0.221
NP_440431.1_4 Forward -273 -254 -3.67686 0.224
NP_442450.1_5 Reverse -103 -113 19.1546 0.0103
NP_442450.1_5 Forward -116 -106 7.55152 0.13
NP_440588.1_2 Reverse -96 -115 8.65258 0.0455
NP_440588.1_2 Forward -117 -98 2.26107 0.122
NP_441570.1_1 Reverse -105 -123 -0.865831 0.0517
NP_441570.1_1 Reverse -56 -74 -10.4039 0.17
NP_441570.1_1 Reverse -338 -356 -12.8622 0.219
NP_441570.1_1 Reverse -13 -31 -14.1405 0.225
NP_441570.1_1 Reverse -99 -117 -16.6971 0.252
NP_441078.1_4 Forward -114 -105 19.6659 0.0007
NP_441078.1_4 Reverse -105 -114 19.6659 0.0007
NP_442729.1_8 Reverse -101 -114 18.2105 0.0325
NP_441663.1_8 Forward -120 -101 -2.75381 0.272
NP_442348.1_2 Forward -44 -35 14.7494 0.146
NP_440526.1_3 Forward -113 -102 1.6315 0.267
NP_441432.1_8 Reverse -104 -113 8.35786 0.0755
NP_441432.1_8 Forward -115 -106 8.25953 0.0755
NP_442320.1_8 Reverse -99 -113 6.3911 0.029
NP_442320.1_8 Forward -120 -106 -3.63866 0.126
NP_442344.1_7 Reverse -106 -125 10.9142 0.0298
NP_441732.1_2 Reverse -101 -117 -16.1661 0.165
NP_441732.1_2 Forward -118 -102 -17.346 0.253
NP_440497.1_2 Forward -113 -94 5.211 0.287
NP_440760.1_1 Forward -114 -95 -0.590531 0.0279
NP_440760.1_1 Forward -108 -89 -11.8003 0.0882
NP_442797.1_7 Forward -115 -97 14.0805 0.11
NP_442751.1_4 Reverse -53 -72 13.7658 0.193
NP_441072.1_2 Forward -125 -106 8.35759 0.24
NP_442400.1_1 Reverse -376 -395 -6.1954 0.299
NP_442489.1_7 Forward -114 -105 20.1576 0.000695
NP_442489.1_7 Reverse -105 -114 20.1576 0.000695
NP_440565.1_7 Reverse -55 -74 -0.983855 0.282
NP_442079.1_7 Reverse -106 -125 -0.295539 0.29
NP_440559.1_1 Forward -113 -104 17.306 0.00658
NP_440559.1_1 Forward -400 -391 13.7661 0.0357
NP_440559.1_1 Reverse -106 -115 8.75118 0.0586
NP_441659.2_8 Forward -114 -104 19.3512 0.000966
NP_441659.2_8 Reverse -105 -115 11.9764 0.0147
NP_442913.1_9 Reverse -99 -118 6.19431 0.296
NP_441040.1_2 Forward -116 -97 -14.5535 0.286
NP_442008.1_2 Reverse -102 -121 3.53937 0.253
NP_440335.1_9 Forward -161 -143 15.0638 0.193
NP_442346.1_5 Reverse -104 -114 17.9746 0.00128
NP_442346.1_5 Forward -115 -105 9.02648 0.118
NP_440545.1_3 Forward -118 -101 4.26707 0.073
NP_440831.1_3 Forward -123 -104 9.88192 0.188
NP_440831.1_3 Reverse -96 -115 9.78484 0.188
NP_440486.1_6 Reverse -104 -123 5.30933 0.298
NP_440250.1_1 Reverse -95 -113 10.6389 0.273
NP_440250.1_4 Reverse -279 -298 3.83357 0.264
NP_440010.1_3 Reverse -221 -240 -4.22878 0.25
NP_440010.1_4 Forward -118 -99 3.53858 0.22
NP_440010.1_10 Forward -246 -227 3.73603 0.25
NP_442137.1_6 Reverse -119 -138 6.4893 0.213
NP_440847.1_3 Forward -210 -196 13.2736 0.217
NP_442603.1_7 Forward -114 -100 11.012 0.125
NP_441888.1_7 Forward -119 -105 3.53951 0.225
NP_441888.1_7 Forward -193 -179 2.35953 0.225
NP_441948.1_4 Forward -121 -103 -3.02911 0.181
NP_440170.1_5 Forward -124 -105 7.86593 0.142
NP_441833.1_4 Forward -113 -106 15.9687 0.0124
NP_441833.1_4 Reverse -106 -113 15.9687 0.0124
NP_441833.1_4 Reverse -393 -400 6.52896 0.0924
NP_441833.1_4 Forward -400 -393 6.23397 0.163
NP_442162.1_9 Forward -113 -106 16.2637 0.0124
NP_442162.1_9 Reverse -106 -113 16.2637 0.0124
NP_442162.1_9 Forward -400 -393 12.9205 0.0282
NP_442162.1_9 Reverse -393 -400 12.9205 0.0282
NP_440671.1_4 Reverse -99 -113 11.8976 0.123
NP_441044.1_4 Reverse -32 -50 9.65558 0.223
NP_440772.1_6 Reverse -106 -125 6.78429 0.292
NP_442199.1_5 Forward -82 -63 -5.70374 0.253
NP_442140.1_3 Reverse -106 -116 16.2046 0.0255
NP_442140.1_3 Forward -113 -103 5.68323 0.198
NP_442140.1_3 Forward -400 -390 4.0116 0.265
NP_441671.1_6 Forward -113 -94 9.53756 0.179
NP_440875.1_9 Forward -239 -229 12.4602 0.117
NP_440875.1_9 Reverse -107 -117 9.15072 0.233
NP_441813.1_5 Reverse -103 -113 16.1063 0.01
NP_441813.1_5 Forward -116 -106 9.91146 0.021
NP_441813.1_5 Reverse -390 -400 4.69992 0.148
NP_440590.1_4 Forward -400 -387 9.36073 0.0365
NP_440590.1_4 Forward -113 -100 2.47756 0.0879
NP_440590.1_4 Reverse -370 -383 2.18257 0.0972
NP_440590.1_4 Reverse -106 -119 -5.29059 0.277
NP_440567.1_1 Forward -113 -99 12.0943 0.0254
NP_440567.1_1 Reverse -106 -120 5.99778 0.0918
NP_442839.1_7 Reverse -260 -277 23.8349 0.0249
NP_442497.1_10 Forward -113 -104 19.8626 0.00532
NP_442497.1_10 Reverse -106 -115 10.4228 0.0087
NP_442497.1_10 Forward -400 -391 -1.18024 0.256
NP_440821.1_4 Reverse -103 -113 19.8429 0.00399
NP_440821.1_4 Forward -116 -106 10.2065 0.0163
NP_441239.1_9 Forward -116 -104 15.8703 0.0178
NP_441239.1_9 Reverse -103 -115 14.297 0.0288
NP_441239.1_9 Reverse -177 -189 8.20045 0.141
NP_441239.1_9 Forward -243 -231 3.08724 0.296
NP_441951.1_9 Forward -116 -97 3.14605 0.254
NP_440400.1_1 Forward -219 -200 -3.04956 0.29
NP_440400.1_1 Forward -158 -139 -3.14789 0.291
NP_441892.1_1 Forward -123 -106 7.61033 0.088
NP_441017.1_6 Reverse -101 -115 13.077 0.208
NP_440354.1_7 Reverse -99 -117 6.60732 0.278
NP_442138.1_10 Reverse -105 -124 0.687771 0.139
NP_442138.1_10 Reverse -338 -357 -7.27704 0.286
NP_440546.1_4 Forward -114 -104 12.8578 0.0572
NP_440546.1_4 Reverse -105 -115 11.8882 0.0679
NP_441656.1_6 Reverse -219 -238 6.4893 0.255
NP_440462.1_6 Forward -116 -106 9.02648 0.0498
NP_440462.1_6 Reverse -103 -113 7.84651 0.0699
NP_442611.1_5 Forward -43 -29 19.2725 0.182
NP_442592.1_7 Forward -113 -94 20.059 0.0999
NP_440868.1_4 Forward -118 -106 15.4769 0.0164
NP_442499.1_1 Forward -107 -88 4.71934 0.226
NP_442499.1_3 Forward -115 -97 12.3105 0.199
NP_442479.1_9 Reverse -140 -159 -7.4737 0.266
NP_442882.1_7 Forward -121 -107 11.1104 0.265
NP_442039.1_4 Forward -113 -106 15.1821 0.0124
NP_442039.1_4 Reverse -106 -113 15.1821 0.0124
NP_442039.1_4 Forward -400 -393 11.6422 0.0747
NP_442039.1_7 Reverse -55 -65 7.55152 0.275
NP_441811.1_8 Reverse -99 -113 16.2242 0.129
NP_441811.1_8 Reverse -386 -400 5.50613 0.299
NP_442679.1_1 Forward -284 -265 -3.44213 0.255
NP_442679.1_1 Forward -297 -278 -5.21209 0.29
NP_441926.1_3 Forward -114 -98 4.97508 0.175
NP_440825.1_7 Reverse -106 -116 12.4217 0.155
NP_440825.1_7 Forward -400 -390 11.9337 0.2
NP_442837.1_3 Forward -113 -106 15.7721 0.0124
NP_442837.1_3 Reverse -106 -113 15.7721 0.0124
NP_442837.1_3 Forward -400 -393 6.0373 0.25
NP_442837.1_3 Reverse -393 -400 6.0373 0.25
NP_442053.1_1 Forward -114 -105 18.3876 0.0007
NP_442053.1_1 Reverse -105 -114 18.3876 0.0007
NP_440505.1_3 Reverse -103 -113 7.55152 0.151
NP_440505.1_3 Forward -116 -106 6.76487 0.169
NP_440505.1_3 Reverse -95 -105 5.09324 0.246
NP_441102.1_2 Reverse -202 -221 6.78429 0.298
NP_440520.1_10 Forward -233 -214 17.1082 0.115
NP_441252.1_6 Reverse -327 -334 11.9372 0.25
NP_441203.1_1 Forward -113 -94 -2.95047 0.0655
NP_442532.1_4 Forward -52 -34 13.2976 0.215
NP_440914.1_1 Reverse -105 -115 8.6151 0.186
NP_440914.1_1 Forward -114 -104 8.51751 0.186
NP_441011.1_8 Reverse -106 -115 16.9127 0.00602
NP_441011.1_8 Forward -113 -104 14.356 0.0249
NP_442101.1_10 Forward -122 -103 3.83436 0.0668
NP_442533.1_6 Forward -114 -105 17.2076 0.00137
NP_442533.1_6 Reverse -105 -114 17.2076 0.00137
NP_442541.1_10 Forward -203 -189 2.8506 0.254
NP_441219.1_8 Forward -241 -222 14.8466 0.229
NP_441482.1_7 Reverse -99 -113 17.6992 0.00499
NP_441482.1_7 Forward -120 -106 -10.7185 0.213
NP_439944.1_9 Forward -113 -103 17.3846 0.00516
NP_442269.1_10 Reverse -86 -105 6.39097 0.227
NP_440816.1_7 Reverse -101 -120 13.3725 0.201
NP_441028.1_6 Reverse -1 -11 12.9592 0.166
NP_441028.1_6 Reverse -266 -276 4.7978 0.277
NP_442664.1_4 Forward -294 -280 18.5841 0.174
NP_440116.1_5 Forward -117 -100 11.6419 0.113
NP_441527.1_4 Forward -288 -269 0.620274 0.135
NP_441527.1_4 Reverse -363 -382 -12.7486 0.293
NP_442716.1_6 Reverse -97 -115 18.6037 0.204
NP_442673.1_5 Forward -127 -109 12.9988 0.272
NP_441972.1_5 Forward -125 -106 -5.99873 0.227
NP_441106.1_1 Forward -115 -106 18.191 0.0028
NP_441106.1_1 Reverse -104 -113 9.73449 0.0311
NP_441420.1_1 Forward -115 -96 -5.99873 0.297
NP_439903.1_6 Forward -117 -98 8.06178 0.144
NP_442588.1_6 Reverse -191 -210 0.196116 0.252
NP_441286.1_1 Forward -115 -103 14.3953 0.00424
NP_441286.1_1 Reverse -104 -116 -3.40261 0.145
NP_442674.1_2 Reverse -207 -226 7.47261 0.278
NP_440670.1_8 Forward -114 -105 18.3876 0.000699
NP_440670.1_8 Reverse -105 -114 18.3876 0.000699
NP_440886.1_7 Forward -115 -105 17.7774 0.0011
NP_440886.1_7 Reverse -104 -114 8.04271 0.0805
NP_440886.1_7 Forward -389 -379 4.01116 0.255
NP_442401.1_2 Forward -389 -370 20.2548 0.0594
NP_442401.1_2 Forward -115 -96 7.66846 0.255
NP_441427.1_2 Reverse -305 -324 5.89931 0.291
NP_440907.2_8 Reverse -106 -116 14.2375 0.0312
NP_440907.2_8 Forward -113 -103 9.81266 0.103
NP_440907.2_9 Reverse -30 -49 3.73524 0.242
NP_442264.1_2 Reverse -95 -112 4.75873 0.293
NP_441021.1_1 Forward -113 -94 13.9625 0.0264
NP_441021.1_8 Reverse -100 -118 2.96908 0.237
NP_440841.1_4 Reverse -328 -347 -7.37537 0.229
NP_440841.1_4 Reverse -103 -122 -9.63698 0.26
NP_441463.1_3 Forward -124 -105 17.404 0.0126
NP_441463.1_3 Forward -399 -380 -10.0303 0.288
NP_441626.1_2 Forward -113 -106 15.7721 0.0124
NP_441626.1_2 Reverse -106 -113 15.7721 0.0124
NP_441626.1_2 Forward -400 -393 12.2322 0.0511
NP_441626.1_2 Reverse -393 -400 5.93897 0.231
NP_442365.1_5 Reverse -106 -125 18.4857 0.0531
NP_442794.1_1 Reverse -388 -400 9.18376 0.0821
NP_442794.1_1 Reverse -101 -113 7.4138 0.138
NP_442794.1_1 Forward -118 -106 2.69391 0.286
NP_442615.1_1 Forward -123 -105 10.5406 0.0204
NP_442615.1_1 Reverse -96 -114 -3.32411 0.159
NP_441962.1_4 Reverse -100 -119 -1.57384 0.124
NP_440387.1_1 Forward -114 -98 17.1681 0.0044
NP_440387.1_1 Reverse -105 -121 5.95839 0.0297
NP_441963.1_2 Reverse -22 -41 5.211 0.215
NP_441431.1_2 Forward -117 -103 8.55376 0.211
NP_441431.1_2 Reverse -229 -243 6.68548 0.263
NP_441993.1_1 Reverse -99 -118 12.5695 0.0981
NP_441993.1_1 Forward -114 -95 2.62889 0.256
NP_440467.1_3 Reverse -94 -113 12.9165 0.214
NP_440114.1_10 Forward -114 -100 7.66941 0.229
NP_440114.1_10 Reverse -105 -119 6.09611 0.285
NP_442698.1_10 Reverse -181 -200 2.16274 0.284
NP_440766.1_4 Reverse -101 -115 9.73436 0.0871
NP_441237.1_9 Forward -400 -390 11.5831 0.17
NP_440457.1_1 Reverse -101 -113 16.8536 0.0455
NP_440798.1_6 Reverse -106 -119 11.7207 0.0564
NP_441984.1_1 Reverse -99 -117 12.1139 0.19
NP_440473.1_9 Forward -125 -106 -7.57203 0.238
NP_442509.1_9 Forward -114 -104 17.3841 0.00128
NP_442509.1_9 Reverse -105 -115 16.2041 0.00739
NP_442514.1_5 Forward -114 -95 -9.53937 0.296
NP_440554.1_4 Reverse -106 -116 7.35486 0.103
NP_440554.1_4 Forward -113 -103 6.96153 0.107
NP_441845.1_6 Reverse -93 -111 3.85406 0.217
NP_441885.1_5 Reverse -105 -115 11.4848 0.00668
NP_441885.1_5 Forward -114 -104 11.3864 0.00668
NP_440478.1_10 Forward -116 -102 6.19444 0.294
NP_442128.1_6 Forward -229 -215 15.6342 0.29
NP_442341.1_7 Forward -115 -101 16.1259 0.0186
NP_442341.1_7 Reverse -104 -118 5.80112 0.145
NP_442341.1_9 Forward -116 -102 9.24208 0.155
NP_442395.2_4 Forward -115 -96 4.32522 0.184
NP_440423.1_6 Reverse -97 -116 -14.2585 0.224
NP_443000.1_7 Reverse -103 -113 8.82982 0.0437
NP_443000.1_7 Forward -116 -106 1.94665 0.226
NP_440507.2_3 Reverse -96 -115 21.5331 0.0116
NP_441842.1_10 Forward -121 -107 7.9644 0.238
NP_440275.1_3 Reverse -103 -113 10.0098 0.0454
NP_440275.1_3 Forward -116 -106 8.33817 0.0602
NP_442932.1_9 Reverse -108 -127 5.99764 0.252
NP_440091.1_1 Forward -118 -106 1.41561 0.197
NP_442275.1_1 Reverse -184 -203 0.58944 0.285
NP_442451.1_2 Forward -116 -97 -10.9153 0.28
NP_440149.1_8 Forward -114 -95 -0.983855 0.154
NP_441105.1_3 Reverse -381 -400 3.14605 0.0936
NP_441105.1_3 Forward -119 -100 -9.34199 0.288
NP_442373.1_1 Forward -261 -242 -3.93378 0.249
NP_442127.1_5 Forward -238 -219 13.8641 0.273
NP_440216.1_1 Reverse -105 -119 5.70279 0.0186
NP_440216.1_1 Forward -114 -100 -2.55701 0.0521
NP_440172.1_1 Forward -114 -104 16.303 0.00854
NP_440172.1_1 Forward -388 -378 10.7964 0.0454
NP_440172.1_1 Reverse -105 -115 8.73149 0.0586
NP_442371.1_1 Reverse -160 -170 14.1392 0.191
NP_442015.1_10 Reverse -101 -114 11.1307 0.0375
NP_442015.1_10 Forward -118 -105 10.4424 0.0391
NP_441226.1_7 Forward -113 -106 14.4934 0.0123
NP_441226.1_7 Reverse -106 -113 14.4934 0.0123
NP_441226.1_7 Forward -400 -393 12.7234 0.0312
NP_441226.1_7 Reverse -393 -400 11.5435 0.0757
NP_441111.1_7 Forward -113 -105 18.7023 0.00294
NP_441111.1_7 Reverse -106 -114 18.7023 0.00294
NP_441766.1_2 Forward -114 -105 17.5026 0.00297
NP_441766.1_2 Reverse -105 -114 17.5026 0.00297
NP_442417.1_5 Reverse -105 -119 9.5377 0.13
NP_440416.1_1 Reverse -97 -116 -13.3736 0.281
NP_440416.1_9 Forward -121 -102 -3.63879 0.0748
NP_440416.1_9 Reverse -98 -117 -16.0285 0.206
NP_440416.1_9 Forward -204 -185 -18.8801 0.266
NP_443052.1_8 Forward -124 -105 2.55606 0.0545
NP_443052.1_9 Reverse -215 -234 -6.49039 0.283
NP_442403.1_8 Forward -314 -295 -2.75381 0.282
NP_440591.1_9 Reverse -98 -116 14.9655 0.0839
NP_442154.1_1 Reverse -89 -107 -15.8121 0.225
NP_440261.1_5 Forward -113 -100 -10.1088 0.201
NP_440261.1_5 Reverse -106 -119 -10.5021 0.201
NP_440261.1_5 Forward -338 -325 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGATCGGAAACGCCAATCACTTCCGCTCCCTGTTGTTTAAGCAGGCTAAAAATTCGATAACCCGTTTGCCCCAAACCACAAACGATGATGTGCGGTTTCATAACGTCCTAAAAAAAGGGGAATCTGAAGGAAAAAAATGTCACCGACGGTAAGCCTTATCCCAGGGCCGCTGGAACTGGTTAAAACTCACCAAACTGCCCTTTGCTAGCCCGGCCATTTCATTGTCTCCATTCTCTCCAGACAACGCTAGCAAAACTGTCACCGTTCAATCATTTTGCTCAACTCGGCGATCGCCCTAGCCCCAGCATCGTACTGAAATTGATCTGCCAATCATTGCGGCCAACGTTTAAGATGGGGGCATTGTTTTAGTCCACCATTGTAATTACCAACGGAGGGAAA

CDS

ATGTTACAACTACTTATCGTCTGGATTGTCACCTCAGTCAGCCTGCTGATCATTGCCCAACTGCCCACAGGGGTAGAAATCTCCAGCTTTAAAAAAGCCCTCATTTCTGCCGTCGTTATCGGTTTACTCAACGCCCTAGTGCGTCCAGTACTGACGTTTTTCACTTTTCCCCTAATTTTTCTGACCTTTGGCCTGTTTTACACCGTAGTCAACGCCATCATCTTTGCCCTTGCTGCCGCTTTTGTAGATGGTTTTAGCCTCCGCTGGGGCTTTTGGAGCGCTCTCATTGGCGCCATTCTGCTGGGATTTATCAACTCTCTCCTCTTCCAATTACTACCCATCAGCAGCTAG

Protein

MLQLLIVWIVTSVSLLIIAQLPTGVEISSFKKALISAVVIGLLNALVRPVLTFFTFPLIFLTFGLFYTVVNAIIFALAAAFVDGFSLRWGFWSALIGAILLGFINSLLFQLLPISS