Your browser is old and dusty. Try Google Chrome!

Details for slr0270

ORF slr0270
Accession NP_441273.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -359 -366 9.77388 0.169
NP_441418.1_6 Forward -133 -114 -13.2752 0.0751
NP_442291.1_5 Reverse -123 -139 -4.66135 0.281
NP_441453.1_4 Reverse -124 -132 7.19758 0.0757
NP_441453.1_4 Forward -133 -125 6.70593 0.121
NP_442151.1_6 Reverse -358 -372 8.94771 0.162
NP_442151.1_6 Reverse -124 -138 6.88276 0.217
NP_441818.1_9 Reverse -214 -233 -4.42544 0.236
NP_440226.1_1 Forward -133 -114 9.63589 0.0703
NP_441098.1_3 Reverse -24 -43 -0.0896902 0.25
NP_440150.1_2 Reverse -360 -379 6.88182 0.256
NP_440996.1_3 Forward -146 -128 12.3105 0.221
NP_442173.1_1 Reverse -125 -133 5.82095 0.2
NP_442173.1_1 Forward -132 -124 5.72262 0.203
NP_001035873.1_1 Forward -157 -138 14.9039 0.295
NP_442752.1_4 Forward -133 -126 13.8055 0.0199
NP_442752.1_4 Forward -241 -234 10.8555 0.0846
NP_442752.1_4 Reverse -99 -106 9.47889 0.109
NP_442975.1_10 Reverse -120 -134 10.422 0.0553
NP_442975.1_10 Forward -258 -244 4.42388 0.245
NP_440784.1_7 Reverse -125 -132 6.23397 0.241
NP_440784.1_7 Forward -132 -125 6.13563 0.241
NP_441054.1_4 Forward -143 -125 0.904127 0.173
NP_442062.1_3 Forward -69 -50 4.12936 0.198
NP_442062.1_8 Forward -133 -123 8.1415 0.0801
NP_442062.1_8 Reverse -124 -134 7.64985 0.0911
NP_442062.1_8 Forward -226 -216 6.56821 0.123
NP_440304.1_4 Reverse -122 -132 9.22315 0.06
NP_442242.1_4 Forward -132 -125 12.4288 0.0393
NP_440044.1_8 Reverse -125 -144 3.14605 0.138
NP_441035.1_4 Reverse -359 -378 19.174 0.193
NP_441492.1_5 Forward -72 -53 8.07696 0.237
NP_441594.1_6 Reverse -368 -387 1.57275 0.266
NP_440273.1_1 Reverse -281 -300 15.2305 0.243
NP_441083.1_3 Forward -115 -105 11.8776 0.297
NP_441083.1_5 Reverse -124 -134 11.0914 0.0166
NP_441083.1_5 Forward -133 -123 9.7148 0.0231
NP_441083.1_5 Reverse -282 -292 2.92996 0.187
NP_441083.1_5 Reverse -232 -242 -1.10161 0.295
NP_441434.1_3 Reverse -191 -210 -2.45882 0.262
NP_441738.1_2 Reverse -126 -133 15.28 0.0102
NP_441558.1_5 Reverse -122 -141 12.4875 0.0677
NP_440209.1_1 Forward -133 -125 14.8674 0.012
NP_440209.1_1 Reverse -124 -132 8.57422 0.0425
NP_442889.1_8 Reverse -121 -135 9.53707 0.097
NP_442889.1_10 Forward -74 -55 14.9399 0.149
NP_440808.1_4 Forward -282 -263 20.059 0.034
NP_440407.1_5 Forward -257 -238 15.4366 0.264
NP_440178.1_7 Reverse -123 -142 -12.4886 0.121
NP_442570.1_3 Reverse -184 -203 3.53937 0.166
NP_441716.1_1 Forward -133 -119 6.48943 0.198
NP_441327.1_1 Forward -53 -34 4.59781 0.264
NP_440343.1_9 Reverse -272 -291 7.07928 0.291
NP_440906.1_5 Forward -132 -125 12.0355 0.0724
NP_440906.1_5 Reverse -125 -132 12.0355 0.0724
NP_440747.1_10 Forward -136 -124 5.15219 0.0179
NP_440747.1_10 Reverse -121 -133 -11.7607 0.142
NP_440747.1_10 Forward -244 -232 -12.1541 0.227
NP_442973.1_5 Reverse -368 -387 11.9958 0.218
NP_441486.1_1 Forward -136 -122 11.701 0.0149
NP_441486.1_1 Reverse -121 -135 -3.93365 0.184
NP_440470.1_5 Forward -42 -23 18.6683 0.135
NP_440403.1_10 Forward -241 -222 1.96607 0.282
NP_440842.1_4 Reverse -52 -71 1.61679 0.247
NP_441014.1_10 Reverse -216 -235 -2.8529 0.289
NP_443018.1_3 Forward -132 -125 5.34899 0.212
NP_443018.1_3 Reverse -125 -132 5.34899 0.212
NP_441634.1_8 Forward -276 -262 -0.295402 0.252
NP_441634.1_8 Forward -341 -327 -4.7203 0.295
NP_440376.1_1 Forward -133 -124 9.73449 0.0365
NP_440376.1_1 Reverse -124 -133 9.73449 0.0365
NP_441857.1_5 Forward -140 -122 3.3624 0.244
NP_441002.1_3 Forward -329 -310 12.88 0.25
NP_441588.1_4 Reverse -126 -136 8.92815 0.14
NP_442687.1_7 Reverse -123 -133 8.82982 0.1
NP_442687.1_7 Forward -134 -124 7.35486 0.134
NP_442191.1_4 Forward -107 -93 12.8353 0.187
NP_441077.1_6 Forward -65 -49 12.0569 0.136
NP_441077.1_6 Reverse -20 -36 7.14018 0.233
NP_442485.1_3 Forward -236 -217 -1.86883 0.261
NP_441013.1_2 Forward -350 -332 -4.11075 0.297
NP_441029.1_7 Reverse -128 -147 12.4875 0.216
NP_440533.1_6 Forward -150 -131 7.96426 0.29
NP_442296.1_5 Reverse -338 -357 1.57275 0.281
NP_440360.1_9 Forward -71 -52 12.5858 0.243
NP_442658.1_1 Reverse -122 -132 11.4843 0.082
NP_439968.1_8 Forward -284 -268 13.0382 0.285
NP_441487.1_9 Reverse -123 -142 0.294447 0.235
NP_441487.1_9 Forward -211 -192 -3.3438 0.299
NP_441958.1_5 Reverse -123 -133 10.7964 0.0099
NP_441958.1_5 Forward -134 -124 2.7333 0.0378
NP_439905.1_3 Reverse -207 -226 15.5357 0.199
NP_440984.1_7 Forward -138 -124 7.76774 0.163
NP_441162.1_3 Reverse -324 -343 10.3242 0.214
NP_442690.1_1 Forward -42 -23 -3.44213 0.142
NP_442690.1_1 Reverse -53 -72 -8.06369 0.183
NP_442690.1_1 Reverse -32 -51 -10.0303 0.209
NP_442911.1_2 Reverse -114 -133 -4.6221 0.138
NP_441580.1_6 Reverse -264 -283 -2.95047 0.235
NP_443055.1_6 Reverse -116 -134 9.26148 0.137
NP_443055.1_6 Reverse -322 -340 1.78836 0.224
NP_440496.1_9 Forward -109 -90 -2.95047 0.247
NP_442002.1_1 Reverse -184 -202 9.95058 0.0696
NP_440411.1_10 Forward -334 -315 12.4087 0.26
NP_441424.1_2 Forward -69 -50 10.6469 0.219
NP_441646.1_1 Forward -120 -101 0.884433 0.242
NP_442438.1_10 Forward -138 -124 1.86788 0.188
NP_441000.1_6 Reverse -123 -137 -5.50694 0.279
NP_442771.1_1 Forward -135 -117 -7.35568 0.17
NP_440147.1_4 Forward -135 -122 2.18257 0.209
NP_441295.1_4 Forward -279 -260 0.687771 0.29
NP_441550.1_8 Reverse -122 -132 6.27276 0.214
NP_441550.1_8 Forward -135 -125 5.28945 0.255
NP_441916.1_7 Forward -133 -123 7.05986 0.0779
NP_441916.1_10 Reverse -116 -135 2.55606 0.244
NP_441041.1_7 Forward -89 -77 5.27969 0.265
NP_441725.1_5 Forward -132 -122 11.1898 0.0247
NP_442941.1_3 Forward -132 -122 1.55333 0.15
NP_442941.1_3 Reverse -125 -135 1.35667 0.15
NP_440289.1_2 Reverse -121 -134 3.36254 0.0799
NP_440983.1_9 Reverse -332 -351 6.78429 0.257
NP_442281.1_1 Reverse -119 -133 3.34225 0.235
NP_440018.1_3 Forward -351 -332 0.982764 0.296
NP_441058.2_6 Reverse -334 -353 14.0608 0.253
NP_440437.1_1 Forward -216 -197 -4.91709 0.271
NP_440498.1_1 Forward -142 -124 8.57394 0.0786
NP_441644.1_6 Forward -133 -123 11.3859 0.0502
NP_441644.1_6 Reverse -124 -134 8.53436 0.0982
NP_441644.1_6 Reverse -330 -340 3.32285 0.288
NP_442215.1_2 Reverse -199 -215 -3.48138 0.216
NP_442215.1_2 Forward -388 -372 -7.21796 0.289
NP_440253.1_2 Forward -133 -115 1.39578 0.161
NP_440929.1_8 Reverse -124 -133 9.73449 0.0257
NP_440929.1_8 Forward -133 -124 9.4395 0.0326
NP_440780.1_1 Forward -66 -47 6.54077 0.299
NP_442933.1_1 Reverse -53 -72 8.73709 0.253
NP_442933.1_10 Forward -133 -124 13.9627 0.0192
NP_442933.1_10 Reverse -124 -133 8.1612 0.0885
NP_440891.1_8 Forward -89 -70 19.3514 0.0906
NP_442554.1_8 Reverse -125 -135 5.5849 0.145
NP_442554.1_8 Forward -132 -122 5.28991 0.153
NP_441762.1_7 Reverse -123 -135 -0.74767 0.0785
NP_442142.1_4 Reverse -121 -134 6.21356 0.17
NP_442292.1_1 Reverse -125 -134 8.75118 0.0306
NP_442292.1_1 Forward -132 -123 -0.295266 0.24
NP_442292.1_2 Reverse -57 -71 16.325 0.269
NP_442292.1_2 Reverse -47 -61 15.7433 0.279
NP_442381.1_8 Forward -136 -117 -14.7502 0.284
NP_443009.1_5 Reverse -123 -134 8.21964 0.114
NP_443009.1_5 Forward -134 -123 5.95804 0.18
NP_442408.2_1 Forward -133 -114 -5.01543 0.267
NP_440357.1_1 Reverse -199 -218 7.07928 0.296
NP_440881.1_7 Reverse -213 -232 16.1257 0.185
NP_440158.1_1 Reverse -54 -73 9.11906 0.293
NP_441758.1_10 Reverse -23 -42 14.3549 0.0678
NP_441468.1_1 Reverse -125 -132 6.13563 0.209
NP_441468.1_1 Forward -132 -125 6.0373 0.223
NP_441020.2_6 Forward -135 -118 7.11867 0.241
NP_441673.1_1 Reverse -124 -133 11.1111 0.0121
NP_441673.1_1 Forward -133 -124 11.0128 0.018
NP_441764.1_4 Forward -71 -54 16.3796 0.0852
NP_441764.1_4 Reverse -24 -41 9.98168 0.271
NP_442868.1_6 Forward -135 -125 -0.0199663 0.255
NP_442719.1_2 Forward -379 -361 -6.4714 0.225
NP_441056.1_4 Forward -107 -88 16.3224 0.271
NP_440789.1_1 Reverse -52 -71 15.4366 0.219
NP_442808.1_1 Reverse -123 -133 7.45273 0.0783
NP_440385.1_6 Forward -42 -23 11.7928 0.296
NP_440558.1_2 Forward -204 -185 -5.50708 0.26
NP_440558.1_2 Forward -284 -265 -5.9004 0.267
NP_440923.1_1 Reverse -51 -69 18.0129 0.0525
NP_440923.1_4 Reverse -323 -342 3.34271 0.197
NP_441878.1_6 Reverse -123 -133 10.5014 0.0176
NP_441878.1_6 Forward -134 -124 0.57002 0.14
NP_441878.1_6 Reverse -231 -241 -0.0199663 0.163
NP_441036.1_8 Reverse -123 -133 6.8632 0.213
NP_441557.1_5 Reverse -124 -133 10.2261 0.0144
NP_441557.1_5 Forward -133 -124 10.1278 0.0188
NP_441445.1_8 Forward -344 -325 -9.24366 0.277
NP_442267.1_4 Reverse -334 -353 6.4893 0.17
NP_442066.2_4 Forward -386 -367 -8.65367 0.294
NP_442183.1_1 Forward -133 -119 9.2427 0.0999
NP_442135.1_3 Forward -344 -325 10.0292 0.16
NP_441574.1_5 Forward -86 -67 16.4207 0.156
NP_442347.1_2 Reverse -125 -134 3.93297 0.284
NP_442888.1_6 Reverse -319 -338 5.30933 0.228
NP_441037.1_4 Forward -135 -125 6.92787 0.237
NP_441633.1_3 Forward -135 -122 0.707601 0.117
NP_440136.1_2 Reverse -125 -132 6.23397 0.171
NP_440136.1_2 Forward -132 -125 6.13563 0.193
NP_442998.1_5 Forward -375 -365 11.4848 0.184
NP_442998.1_10 Reverse -126 -133 15.5754 0.0102
NP_442998.1_10 Forward -131 -124 5.74231 0.255
NP_440299.1_1 Reverse -120 -133 7.00021 0.124
NP_440299.1_1 Forward -137 -124 6.50855 0.139
NP_442201.1_10 Forward -265 -246 -13.1769 0.27
NP_440709.1_1 Reverse -50 -69 12.29 0.0464
NP_441559.1_8 Reverse -94 -108 -3.24533 0.199
NP_442756.1_1 Forward -124 -105 6.4893 0.194
NP_442785.1_7 Reverse -122 -136 14.6509 0.228
NP_440306.1_8 Reverse -28 -47 -3.44288 0.282
NP_441199.1_7 Forward -72 -53 19.3707 0.0864
NP_442993.1_1 Forward -271 -255 -6.62797 0.146
NP_441340.1_5 Forward -132 -125 6.13563 0.175
NP_441340.1_5 Reverse -125 -132 5.93897 0.198
NP_442327.1_3 Forward -69 -50 7.4002 0.254
NP_441947.1_4 Reverse -221 -240 12.3892 0.234
NP_440327.1_6 Forward -144 -125 6.98095 0.228
NP_440586.1_1 Forward -377 -358 4.52268 0.202
NP_440586.1_8 Forward -132 -125 11.4451 0.0645
NP_442251.1_6 Reverse -125 -132 12.0355 0.0627
NP_441262.1_3 Forward -133 -126 14.7888 0.0223
NP_440027.1_3 Reverse -252 -270 1.88669 0.295
NP_440027.1_8 Reverse -262 -281 9.83173 0.243
NP_443051.1_1 Reverse -123 -132 8.35786 0.0371
NP_443051.1_1 Forward -134 -125 0.786375 0.125
NP_439937.1_9 Forward -227 -210 -11.5649 0.257
NP_439937.1_9 Reverse -123 -140 -15.7931 0.287
NP_441595.1_2 Forward -48 -35 8.46506 0.29
NP_440926.1_8 Reverse -188 -207 12.8808 0.222
NP_441167.1_1 Forward -72 -53 8.65258 0.213
NP_440439.1_1 Reverse -96 -109 2.18257 0.138
NP_440372.1_2 Forward -132 -125 6.72562 0.0929
NP_440372.1_2 Reverse -125 -132 6.62729 0.151
NP_440316.1_10 Forward -340 -330 6.96153 0.251
NP_440210.1_2 Reverse -103 -122 17.6007 0.15
NP_441572.1_7 Reverse -371 -390 -3.3438 0.209
NP_442384.1_10 Reverse -124 -137 6.60746 0.0987
NP_442790.1_4 Forward -280 -261 -14.2585 0.274
NP_441689.1_5 Reverse -114 -124 4.99446 0.285
NP_442244.1_6 Reverse -358 -377 6.09597 0.275
NP_440163.1_10 Forward -229 -219 11.1898 0.171
NP_440344.1_10 Reverse -117 -134 -11.7609 0.227
NP_440189.1_8 Forward -399 -380 17.699 0.212
NP_441965.1_3 Forward -143 -124 2.0644 0.215
NP_441965.1_10 Forward -111 -95 2.32015 0.288
NP_441640.1_8 Forward -124 -105 -5.31042 0.281
NP_440297.1_9 Forward -132 -122 9.22315 0.0917
NP_442280.1_10 Forward -205 -187 5.25962 0.289
NP_441103.1_9 Forward -106 -96 12.6848 0.29
NP_440999.1_2 Reverse -266 -285 11.1109 0.223
NP_440999.1_9 Forward -371 -357 -0.295402 0.203
NP_442277.1_7 Forward -74 -58 -0.852625 0.231
NP_441949.1_5 Forward -71 -52 13.9578 0.188
NP_441543.1_2 Reverse -125 -134 7.17789 0.131
NP_442845.1_2 Forward -114 -100 8.55439 0.193
NP_442845.1_2 Forward -139 -125 3.63784 0.282
NP_441319.1_3 Reverse -358 -377 18.6823 0.151
NP_442710.1_7 Forward -66 -47 -4.91611 0.274
NP_442710.1_7 Reverse -24 -43 -5.30055 0.288
NP_442710.1_7 Forward -76 -57 -7.89551 0.299
NP_441548.1_2 Reverse -332 -351 14.0608 0.212
NP_443064.1_6 Reverse -232 -242 14.2152 0.0796
NP_443064.1_6 Reverse -124 -134 11.5004 0.13
NP_442578.1_7 Forward -132 -125 5.93897 0.183
NP_441462.1_2 Forward -133 -123 10.6981 0.00625
NP_441462.1_2 Reverse -124 -134 1.84832 0.081
NP_441601.1_4 Reverse -264 -283 -5.99873 0.295
NP_441410.1_3 Reverse -115 -134 6.19431 0.23
NP_442204.1_1 Reverse -95 -106 0.550326 0.281
NP_442204.1_1 Forward -343 -332 0.255333 0.282
NP_442780.1_1 Forward -67 -48 7.07928 0.291
NP_440454.1_2 Forward -72 -58 14.3354 0.227
NP_440454.1_2 Reverse -23 -37 10.1338 0.291
NP_440516.1_8 Forward -133 -124 15.6344 0.00582
NP_440516.1_8 Reverse -124 -133 7.47288 0.0581
NP_442428.1_5 Reverse -125 -132 6.13563 0.209
NP_442428.1_5 Forward -132 -125 6.0373 0.212
NP_441267.1_3 Forward -329 -311 8.08151 0.283
NP_441867.1_2 Reverse -184 -203 -13.1769 0.277
NP_440673.1_3 Reverse -126 -133 12.4288 0.0426
NP_440673.1_3 Reverse -230 -237 8.98723 0.203
NP_440673.1_7 Forward -343 -324 2.16274 0.232
NP_441052.1_2 Reverse -124 -134 10.2065 0.0295
NP_441052.1_2 Forward -133 -123 0.766681 0.256
NP_442219.1_9 Reverse -125 -134 8.06287 0.0696
NP_440436.1_4 Reverse -125 -134 13.9623 0.0193
NP_440436.1_4 Forward -132 -123 12.684 0.034
NP_441884.1_9 Forward -257 -238 -21.0434 0.225
NP_441884.1_9 Reverse -196 -215 -28.5165 0.296
NP_440041.1_6 Reverse -284 -303 8.65176 0.285
NP_441719.1_4 Forward -132 -125 6.72562 0.093
NP_441719.1_4 Reverse -125 -132 6.62729 0.151
NP_442813.1_4 Forward -161 -142 -6.39206 0.299
NP_442813.1_4 Forward -162 -143 -6.98204 0.299
NP_442366.1_3 Forward -126 -108 -5.88071 0.298
NP_442366.1_5 Forward -136 -126 17.2858 0.0141
NP_442366.1_5 Forward -240 -230 11.1893 0.207
NP_440328.1_8 Reverse -128 -147 14.9579 0.294
NP_443054.1_2 Reverse -321 -335 5.50613 0.231
NP_441851.1_10 Reverse -123 -133 7.74818 0.132
NP_441851.1_10 Forward -134 -124 6.07655 0.187
NP_441273.1_7 Forward -274 -255 21.2389 0.137
NP_441273.1_9 Forward -73 -54 15.7972 0.24
NP_442515.1_1 Forward -134 -120 11.7993 0.0388
NP_442515.1_1 Reverse -123 -137 -0.000409212 0.206
NP_442515.1_1 Forward -226 -212 -0.492064 0.224
NP_441540.1_4 Reverse -54 -73 14.6558 0.252
NP_442689.1_8 Reverse -57 -74 5.34871 0.155
NP_442689.1_8 Forward -38 -21 0.825489 0.191
NP_441349.1_10 Forward -143 -124 9.0459 0.0251
NP_440432.1_9 Forward -132 -117 -0.315096 0.164
NP_439960.1_10 Forward -282 -264 -4.40575 0.293
NP_440474.1_8 Reverse -359 -373 8.06211 0.193
NP_440396.1_1 Forward -222 -203 -4.52377 0.272
NP_442450.1_5 Reverse -122 -132 9.81313 0.115
NP_440588.1_2 Forward -142 -123 -2.36049 0.164
NP_441031.1_1 Reverse -48 -67 9.4257 0.212
NP_440943.1_1 Reverse -36 -55 8.84924 0.29
NP_442006.1_3 Reverse -187 -205 -1.06249 0.238
NP_440483.1_1 Forward -344 -325 -7.86702 0.272
NP_441078.1_4 Reverse -124 -133 9.93116 0.0203
NP_441078.1_4 Forward -133 -124 9.83282 0.0226
NP_442348.1_2 Forward -332 -323 12.8811 0.218
NP_442348.1_2 Reverse -77 -86 10.7178 0.259
NP_441432.1_8 Forward -134 -125 7.17789 0.102
NP_442320.1_8 Forward -139 -125 -4.81863 0.188
NP_442320.1_8 Reverse -118 -132 -5.9986 0.261
NP_441732.1_2 Reverse -373 -389 -15.8711 0.163
NP_441732.1_2 Reverse -120 -136 -16.4611 0.167
NP_440629.1_1 Forward -68 -50 12.0155 0.0706
NP_442797.1_7 Forward -214 -196 -1.25915 0.294
NP_441131.1_5 Reverse -94 -113 1.96607 0.261
NP_441945.1_6 Reverse -53 -72 14.4541 0.138
NP_440280.1_4 Forward -338 -324 18.3875 0.27
NP_440713.1_4 Forward -284 -265 1.57275 0.284
NP_442489.1_7 Reverse -124 -133 10.6195 0.00984
NP_442489.1_7 Forward -133 -124 10.3245 0.0193
NP_442489.1_7 Reverse -232 -241 -1.96689 0.28
NP_440757.1_4 Reverse -193 -212 1.57275 0.288
NP_441452.1_1 Reverse -325 -344 12.4875 0.292
NP_440559.1_1 Reverse -125 -134 14.1594 0.0317
NP_440559.1_1 Forward -132 -123 7.86621 0.0856
NP_441659.2_8 Forward -133 -123 16.008 0.0042
NP_441659.2_8 Reverse -124 -134 8.63316 0.0405
NP_442346.1_5 Forward -134 -124 15.3197 0.00738
NP_442346.1_5 Reverse -123 -133 8.23984 0.143
NP_442346.1_5 Forward -238 -228 5.97822 0.219
NP_440545.1_3 Forward -371 -354 -3.00942 0.197
NP_440545.1_5 Reverse -188 -205 6.43035 0.219
NP_441856.1_7 Reverse -331 -350 11.5042 0.246
NP_440459.1_2 Forward -142 -125 8.59364 0.254
NP_442603.1_7 Reverse -265 -279 10.5204 0.125
NP_442603.1_9 Reverse -129 -147 -0.374176 0.3
NP_441833.1_4 Reverse -125 -132 14.1004 0.0258
NP_441833.1_4 Forward -132 -125 6.13563 0.198
NP_443040.1_1 Forward -43 -29 11.8267 0.276
NP_441329.1_1 Reverse -50 -69 5.29938 0.265
NP_441329.1_6 Reverse -157 -176 1.67069 0.232
NP_442162.1_9 Reverse -125 -132 6.62729 0.142
NP_442162.1_9 Forward -132 -125 6.52896 0.178
NP_442045.1_5 Forward -204 -185 -0.0988766 0.266
NP_442140.1_3 Forward -132 -122 4.20827 0.254
NP_441813.1_5 Reverse -122 -132 6.56821 0.0875
NP_440590.1_4 Reverse -125 -138 6.80412 0.0565
NP_440567.1_1 Reverse -125 -139 -0.0987402 0.264
NP_442497.1_10 Forward -132 -123 10.0295 0.0222
NP_442497.1_10 Reverse -125 -134 0.688044 0.141
NP_440821.1_4 Reverse -122 -132 10.1081 0.0188
NP_440821.1_4 Forward -135 -125 -0.41329 0.257
NP_441239.1_9 Reverse -328 -340 13.6087 0.037
NP_441239.1_9 Forward -105 -93 7.90546 0.147
NP_440796.1_3 Reverse -117 -135 6.90155 0.295
NP_441541.1_1 Forward -70 -52 3.3442 0.185
NP_440546.1_4 Forward -133 -123 10.8217 0.104
NP_440868.1_4 Forward -137 -125 5.84051 0.0879
NP_442479.1_9 Reverse -86 -105 -11.6036 0.275
NP_440270.1_6 Forward -206 -187 7.47261 0.282
NP_442402.1_4 Reverse -128 -147 -9.14605 0.285
NP_441084.1_6 Reverse -122 -136 10.3137 0.248
NP_441084.1_6 Forward -341 -327 9.15021 0.292
NP_442039.1_3 Reverse -366 -385 16.0274 0.211
NP_442696.1_6 Reverse -318 -337 -11.1119 0.235
NP_442837.1_3 Reverse -125 -132 6.13563 0.25
NP_442837.1_3 Forward -132 -125 5.93897 0.265
NP_441760.1_7 Forward -123 -105 9.0656 0.248
NP_440160.1_1 Forward -73 -54 23.4535 0.00966
NP_440160.1_2 Forward -293 -274 -9.14533 0.293
NP_442053.1_1 Reverse -124 -133 9.34117 0.0666
NP_442053.1_1 Forward -133 -124 8.55452 0.0784
NP_440505.1_3 Forward -135 -125 7.94484 0.147
NP_442360.1_5 Forward -151 -141 14.6313 0.201
NP_441408.2_7 Forward -306 -287 -3.44213 0.272
NP_440914.1_1 Reverse -124 -134 16.032 0.00231
NP_442101.1_10 Forward -141 -122 5.211 0.0529
NP_440068.1_7 Reverse -159 -177 16.8337 0.159
NP_442533.1_1 Reverse -185 -204 -14.4552 0.243
NP_442533.1_6 Reverse -124 -133 7.66954 0.0897
NP_442533.1_6 Forward -133 -124 7.37455 0.0898
NP_442533.1_6 Reverse -99 -108 1.76968 0.289
NP_442322.1_4 Reverse -253 -270 -9.49991 0.295
NP_441482.1_7 Reverse -118 -132 -3.34366 0.118
NP_439944.1_9 Forward -132 -122 15.418 0.0198
NP_441697.1_5 Forward -64 -45 -10.7433 0.284
NP_441028.1_6 Forward -221 -211 3.51951 0.292
NP_440116.1_5 Forward -136 -119 11.4452 0.117
NP_441527.1_4 Reverse -161 -180 -5.77769 0.208
NP_441527.1_4 Reverse -151 -170 -7.49654 0.235
NP_440115.1_6 Forward -136 -126 8.33817 0.13
NP_439965.1_5 Forward -116 -97 8.94676 0.299
NP_440608.1_6 Reverse -125 -144 3.83357 0.282
NP_441972.1_5 Reverse -125 -144 -4.52377 0.211
NP_441106.1_1 Reverse -123 -132 6.39124 0.0899
NP_441106.1_1 Reverse -98 -107 2.85133 0.255
NP_441106.1_3 Reverse -50 -69 10.1275 0.288
NP_441420.1_1 Forward -134 -115 2.94938 0.166
NP_440429.1_9 Forward -255 -236 -0.295539 0.297
NP_441286.1_1 Forward -134 -122 21.3768 0.00196
NP_441286.1_1 Reverse -123 -135 -6.2542 0.254
NP_440670.1_8 Reverse -124 -133 16.5193 0.00214
NP_440670.1_8 Forward -133 -124 9.4395 0.0559
NP_441930.1_2 Forward -226 -216 11.2881 0.298
NP_440886.1_7 Reverse -264 -274 4.20782 0.249
NP_440886.1_7 Forward -134 -124 4.01116 0.255
NP_442614.1_2 Reverse -384 -398 6.3911 0.291
NP_442072.1_9 Reverse -281 -299 -23.482 0.297
NP_439899.1_1 Forward -72 -54 6.71808 0.205
NP_441753.1_10 Reverse -115 -134 5.99764 0.186
NP_441021.1_1 Reverse -217 -236 -11.7019 0.272
NP_441021.1_8 Reverse -119 -137 4.34571 0.223
NP_441626.1_2 Forward -132 -125 6.0373 0.212
NP_441626.1_2 Reverse -125 -132 6.0373 0.212
NP_442615.1_1 Forward -142 -124 -5.97904 0.231
NP_441962.1_5 Reverse -325 -344 11.1109 0.186
NP_440387.1_1 Forward -133 -117 -0.826444 0.142
NP_441193.1_6 Reverse -21 -40 1.27776 0.285
NP_440358.1_8 Reverse -341 -360 0.196116 0.263
NP_440287.1_6 Reverse -122 -141 -0.0988766 0.298
NP_441237.1_9 Reverse -125 -135 10.5014 0.228
NP_442867.1_8 Reverse -264 -283 5.70265 0.276
NP_440457.1_1 Reverse -120 -132 0.137309 0.25
NP_440798.1_6 Reverse -125 -138 5.91914 0.14
NP_441984.1_3 Forward -114 -96 7.29564 0.253
NP_442509.1_9 Reverse -124 -134 8.04271 0.192
NP_442509.1_9 Forward -133 -123 7.74772 0.205
NP_442936.1_5 Reverse -48 -67 14.4541 0.0782
NP_441885.1_5 Reverse -124 -134 11.1898 0.00775
NP_441885.1_5 Forward -133 -123 1.84832 0.0957
NP_441275.1_1 Reverse -51 -69 3.16574 0.189
NP_443000.1_7 Forward -135 -125 0.471689 0.298
NP_440507.2_3 Reverse -115 -134 9.24175 0.227
NP_441842.1_1 Reverse -126 -139 10.4418 0.3
NP_441842.1_10 Forward -140 -126 11.2093 0.138
NP_440275.1_3 Reverse -122 -132 7.15819 0.0872
NP_442275.1_1 Forward -107 -88 -0.295539 0.295
NP_442214.1_6 Forward -392 -374 18.6037 0.189
NP_440216.1_1 Reverse -124 -138 -1.08205 0.0293
NP_440216.1_1 Forward -133 -119 -4.52363 0.111
NP_440216.1_1 Reverse -232 -246 -11.0135 0.159
NP_440172.1_1 Forward -133 -123 6.46988 0.103
NP_440172.1_1 Reverse -124 -134 5.48657 0.143
NP_442015.1_10 Forward -137 -124 7.6891 0.08
NP_441226.1_7 Reverse -384 -391 6.52862 0.253
NP_441226.1_7 Forward -194 -187 5.34865 0.289
NP_441757.1_3 Forward -134 -115 14.2574 0.08
NP_441757.1_6 Reverse -183 -202 5.89931 0.279
NP_441111.1_7 Reverse -125 -133 8.96754 0.0463
NP_441111.1_7 Forward -132 -124 8.86921 0.0589
NP_441766.1_2 Reverse -124 -133 7.86621 0.0703
NP_441766.1_2 Forward -133 -124 7.66954 0.0723
NP_440416.1_9 Forward -202 -183 -12.6852 0.159
NP_443052.1_8 Reverse -191 -210 -12.0953 0.248
NP_443052.1_9 Reverse -264 -283 2.3594 0.172
NP_442116.1_6 Forward -51 -34 8.45543 0.25
NP_442116.1_6 Reverse -48 -65 6.54559 0.276
NP_440261.1_5 Reverse -125 -138 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTCGGTCCGGTTGGCAATTATCTTGGGCAGATGTCACCGCATTGAAATGTCGCACCACAGGCCAGGGGGGCTTGGTTTACTATTTCCTCACAGAGTCGAAAGATAGGGCCTATCTGCTACCCATGCGGGTGGCGGGCTTTAATCGGCTAACTCAACTGGTGAGCGACCATACGGGCATTGACACCCAGGATGTGCGCCCCCTTTCCCAACCCTGGATGTATTTATTACTACTCCTATTTACCTTCTTACTTTGGGGCAGTCAGTTGGCGATCGTCCTATTGCTTTGGAGTAGCCCTCCCCTGGCATAATCTGAACAATTCCGGTTAAAATATAAACAAATGTAAAGAATATTCTCAGAAAACTTTATTTAACATTTGACTAAGACTAGTTTCACTACC

CDS

ATGATCAATCCCCAACCAGACGAAAAAGAACTGCTCAAAACTATCTTAGAGCCCCTGTTGGGAGATTTTGAGCACTGGTTTAGCCGCTCCTGCCAGCTACTAGAAAGCCAGCGTTTAGTCTTTTTCACCCCAGAGCAACAACAAGAGTTACTGGACCGGGTACGACAGGCACGGGATGAAGTAAAGTGTACTAAATTAATGTTCCAAGCCACCGGGGAACAGGTGGGGGTTGAGTTTAGTGTCCTGGTCCCCTGGCACAATTTGGTGACGGAATGTTGGCAGGTAGCCCAGCGCCATCGCCAGATGCAGGCTGCCCGCTAG

Protein

MINPQPDEKELLKTILEPLLGDFEHWFSRSCQLLESQRLVFFTPEQQQELLDRVRQARDEVKCTKLMFQATGEQVGVEFSVLVPWHNLVTECWQVAQRHRQMQAAR