Your browser is old and dusty. Try Google Chrome!

Details for slr0269

ORF slr0269
Accession NP_441272.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -253 -239 8.16106 0.0927
NP_441061.1_2 Reverse -246 -260 1.67122 0.183
NP_440795.1_7 Forward -253 -246 14.6904 0.0123
NP_440795.1_7 Reverse -246 -253 14.6904 0.0123
NP_441418.1_6 Forward -254 -235 -9.047 0.0273
NP_441418.1_6 Reverse -217 -236 -28.3199 0.204
NP_442291.1_5 Forward -255 -239 7.72835 0.0609
NP_440897.1_3 Forward -123 -104 26.2538 0.000757
NP_440897.1_6 Reverse -245 -264 -1.57461 0.193
NP_441453.1_4 Reverse -245 -253 16.539 0.00633
NP_441453.1_4 Forward -254 -246 16.539 0.00633
NP_441453.1_7 Reverse -212 -219 12.9205 0.23
NP_441623.1_1 Reverse -126 -144 -3.22577 0.256
NP_442151.1_6 Reverse -245 -259 16.6175 0.0139
NP_441818.1_1 Forward -253 -242 18.446 0.0046
NP_440226.1_1 Forward -254 -235 12.5858 0.0435
NP_441630.1_3 Reverse -125 -144 1.86774 0.236
NP_442655.1_2 Forward -271 -252 2.16274 0.275
NP_442655.1_10 Reverse -310 -329 -19.2734 0.282
NP_442173.1_1 Forward -253 -245 15.4574 0.00633
NP_442173.1_1 Reverse -246 -254 15.4574 0.00633
NP_442752.1_4 Forward -254 -247 13.8055 0.0199
NP_442752.1_4 Reverse -245 -252 13.8055 0.0199
NP_442752.1_4 Reverse -42 -49 5.25066 0.256
NP_443027.1_4 Reverse -243 -253 11.0914 0.107
NP_443027.1_4 Forward -324 -314 6.27322 0.286
NP_442975.1_10 Forward -258 -244 1.37564 0.299
NP_441675.1_1 Reverse -220 -239 1.86774 0.12
NP_441675.1_4 Forward -274 -255 9.83255 0.218
NP_440784.1_7 Forward -253 -246 15.9687 0.0123
NP_440784.1_7 Reverse -246 -253 15.9687 0.0123
NP_440061.1_9 Forward -256 -242 12.487 0.0964
NP_440061.1_9 Reverse -243 -257 10.422 0.124
NP_440110.1_4 Forward -265 -246 10.1275 0.121
NP_440110.1_4 Forward -90 -71 2.94938 0.243
NP_441054.1_2 Reverse -42 -61 9.14423 0.299
NP_441476.1_5 Forward -327 -308 -3.04881 0.231
NP_439979.1_2 Reverse -310 -329 7.7676 0.26
NP_439979.1_9 Reverse -206 -224 7.4923 0.288
NP_442062.1_3 Reverse -11 -30 -1.18052 0.256
NP_442062.1_8 Forward -254 -244 17.3846 0.00193
NP_442062.1_8 Reverse -245 -255 17.3846 0.00193
NP_442062.1_8 Reverse -154 -164 5.28991 0.176
NP_442062.1_8 Forward -79 -69 4.89658 0.193
NP_441859.1_3 Forward -323 -304 6.78348 0.171
NP_441859.1_3 Forward -255 -236 4.22689 0.228
NP_440304.1_4 Reverse -45 -55 4.69992 0.252
NP_440304.1_4 Reverse -131 -141 3.32329 0.299
NP_440304.1_4 Forward -256 -246 1.84832 0.299
NP_440304.1_4 Reverse -243 -253 1.84832 0.299
NP_442242.1_4 Forward -253 -246 14.3954 0.0124
NP_442242.1_4 Reverse -246 -253 14.3954 0.0124
NP_440044.1_8 Forward -253 -234 -1.27885 0.241
NP_439918.1_2 Forward -266 -247 -0.39387 0.231
NP_441619.1_8 Forward -260 -246 9.53707 0.215
NP_441208.1_9 Reverse -298 -312 4.81781 0.285
NP_440132.1_1 Reverse -215 -233 10.9339 0.218
NP_441365.1_5 Reverse -194 -213 -9.047 0.28
NP_441082.1_10 Reverse -212 -225 8.67241 0.264
NP_442367.1_1 Reverse -153 -172 -8.26035 0.26
NP_440273.1_1 Reverse -255 -274 22.2015 0.0842
NP_441083.1_5 Forward -254 -244 20.3345 0.00053
NP_441083.1_5 Reverse -245 -255 20.3345 0.00053
NP_441738.1_2 Forward -252 -245 15.28 0.0102
NP_441738.1_2 Reverse -247 -254 15.28 0.0102
NP_441558.1_5 Reverse -243 -262 11.3075 0.0828
NP_441558.1_5 Forward -136 -117 9.83255 0.112
NP_441955.1_8 Forward -328 -311 9.57695 0.255
NP_441645.1_8 Reverse -323 -342 10.5209 0.298
NP_440209.1_1 Reverse -245 -253 18.1123 0.00295
NP_440209.1_1 Forward -254 -246 18.1123 0.00295
NP_442889.1_8 Reverse -242 -256 14.4536 0.0523
NP_441713.1_1 Forward -85 -66 -16.8151 0.286
NP_441770.1_4 Reverse -126 -145 -6.98204 0.229
NP_441716.1_1 Reverse -133 -147 7.9644 0.153
NP_441716.1_1 Forward -203 -189 5.30946 0.236
NP_442111.1_4 Reverse -244 -258 1.76955 0.294
NP_441163.1_1 Forward -148 -131 9.08455 0.226
NP_441163.1_1 Reverse -62 -79 8.00291 0.233
NP_440343.1_9 Reverse -213 -232 12.8808 0.184
NP_440906.1_5 Forward -253 -246 15.8704 0.0124
NP_440906.1_5 Reverse -246 -253 15.8704 0.0124
NP_440747.1_10 Reverse -242 -254 16.8536 0.00143
NP_440747.1_10 Forward -257 -245 14.887 0.00223
NP_440747.1_10 Forward -82 -70 -12.2524 0.254
NP_441130.1_10 Forward -256 -242 7.9644 0.144
NP_441486.1_1 Reverse -242 -256 15.1426 0.0061
NP_441486.1_1 Forward -257 -243 5.89945 0.0344
NP_440944.1_2 Forward -266 -247 -0.0988766 0.256
NP_440403.1_4 Reverse -236 -255 1.57275 0.136
NP_440057.1_1 Reverse -36 -55 8.06259 0.28
NP_441014.1_10 Forward -255 -236 9.93006 0.123
NP_442848.1_1 Reverse -239 -253 -2.45868 0.263
NP_443018.1_3 Forward -253 -246 14.8871 0.0123
NP_443018.1_3 Reverse -246 -253 14.8871 0.0123
NP_441634.1_8 Reverse -243 -257 -3.147 0.295
NP_441634.1_8 Forward -256 -242 -4.52363 0.295
NP_441182.1_1 Forward -234 -218 7.72835 0.297
NP_440376.1_1 Forward -254 -245 19.4693 0.000692
NP_440376.1_1 Reverse -245 -254 19.4693 0.000692
NP_441002.1_5 Reverse -339 -358 13.0775 0.218
NP_441588.1_4 Reverse -247 -257 15.9097 0.0369
NP_441588.1_4 Forward -252 -242 8.73149 0.14
NP_442687.1_7 Forward -255 -245 8.92815 0.0994
NP_442687.1_7 Reverse -244 -254 8.92815 0.0994
NP_442485.1_3 Reverse -234 -253 8.35759 0.13
NP_442485.1_3 Forward -256 -237 -3.14714 0.272
NP_441846.1_10 Reverse -96 -115 -15.1435 0.245
NP_441682.1_2 Forward -253 -234 4.03102 0.241
NP_440571.1_7 Forward -270 -252 17.0789 0.267
NP_441422.1_7 Forward -58 -41 5.84037 0.0992
NP_441422.1_7 Forward -347 -330 -9.3026 0.297
NP_440550.1_9 Forward -323 -304 12.6841 0.292
NP_442720.1_8 Reverse -304 -322 8.08229 0.297
NP_442658.1_1 Reverse -68 -78 10.1076 0.132
NP_442658.1_1 Reverse -243 -253 7.94438 0.199
NP_442658.1_1 Forward -256 -246 6.76441 0.214
NP_442782.1_2 Reverse -47 -61 9.2427 0.198
NP_442782.1_2 Forward -277 -263 0.392915 0.29
NP_441414.1_9 Reverse -245 -264 26.7455 0.00146
NP_441487.1_9 Forward -255 -236 -2.95047 0.298
NP_442937.1_5 Reverse -224 -243 11.0125 0.148
NP_441958.1_5 Forward -255 -245 12.2714 0.00183
NP_441958.1_5 Reverse -244 -254 12.2714 0.00183
NP_442836.1_5 Forward -260 -241 8.25926 0.145
NP_440203.1_5 Reverse -316 -326 9.51767 0.254
NP_439905.1_1 Reverse -246 -259 7.29578 0.263
NP_440995.1_8 Forward -264 -245 1.57275 0.264
NP_440984.1_7 Forward -259 -245 10.9143 0.122
NP_440984.1_7 Reverse -240 -254 9.04604 0.131
NP_441097.1_2 Reverse -213 -230 4.16874 0.283
NP_439990.1_5 Forward -259 -246 17.1289 0.0266
NP_439990.1_5 Reverse -240 -253 9.2624 0.147
NP_439990.1_5 Forward -84 -71 6.90245 0.22
NP_442911.1_2 Forward -264 -245 4.71934 0.0369
NP_442064.1_1 Forward -259 -240 -6.98204 0.228
NP_443055.1_3 Reverse -236 -255 15.8016 0.0868
NP_443055.1_6 Reverse -237 -255 6.50823 0.167
NP_443055.1_6 Forward -336 -318 1.39504 0.231
NP_441099.1_5 Reverse -235 -254 3.04771 0.0526
NP_441099.1_5 Forward -264 -245 -10.3253 0.25
NP_441294.1_7 Reverse -241 -255 9.92255 0.219
NP_440411.1_4 Reverse -176 -195 10.7175 0.181
NP_441646.1_1 Reverse -108 -127 3.04771 0.21
NP_441646.1_1 Reverse -148 -167 2.45773 0.218
NP_441646.1_1 Forward -261 -242 0.58944 0.247
NP_441292.1_2 Reverse -210 -229 -6.39206 0.241
NP_441292.1_2 Reverse -211 -230 -7.57203 0.263
NP_441000.1_6 Forward -255 -241 -3.34366 0.221
NP_442771.1_1 Reverse -131 -149 -7.25734 0.17
NP_440484.1_3 Reverse -243 -257 11.2093 0.242
NP_440147.1_4 Forward -256 -243 18.9972 0.00328
NP_440147.1_4 Reverse -243 -256 8.77074 0.0465
NP_440147.1_4 Reverse -68 -81 0.0192843 0.268
NP_441550.1_8 Reverse -243 -253 15.1225 0.0132
NP_441550.1_8 Forward -256 -246 14.6309 0.0132
NP_441916.1_7 Forward -254 -244 10.3048 0.0261
NP_441916.1_7 Reverse -245 -255 10.3048 0.0261
NP_441916.1_7 Reverse -47 -57 2.63497 0.246
NP_441041.1_4 Reverse -211 -230 -1.96717 0.106
NP_441041.1_4 Reverse -217 -236 -9.047 0.211
NP_441041.1_4 Reverse -245 -264 -11.2103 0.242
NP_441041.1_7 Reverse -242 -254 10.8188 0.0864
NP_442396.1_5 Forward -258 -245 21.1604 0.00421
NP_441725.1_5 Forward -253 -243 2.04498 0.115
NP_441725.1_5 Reverse -246 -256 2.04498 0.115
NP_441725.1_5 Reverse -134 -144 0.0783647 0.215
NP_441725.1_5 Forward -215 -205 -1.00328 0.279
NP_439966.1_7 Reverse -243 -253 15.3192 0.0152
NP_439966.1_7 Forward -256 -246 7.25606 0.15
NP_440202.1_8 Reverse -237 -256 15.1558 0.23
NP_442941.1_3 Forward -253 -243 19.2529 0.00262
NP_442941.1_3 Reverse -246 -256 11.0914 0.0116
NP_440289.1_2 Reverse -242 -255 12.6056 0.0139
NP_440289.1_2 Forward -257 -244 -4.9956 0.294
NP_440983.1_5 Forward -238 -219 -6.58872 0.278
NP_440983.1_5 Reverse -173 -192 -7.76869 0.291
NP_441514.1_6 Forward -144 -137 12.7238 0.29
NP_442281.1_1 Reverse -240 -254 16.5185 0.00772
NP_442256.1_2 Reverse -243 -261 -8.14232 0.217
NP_442256.1_2 Forward -256 -238 -9.91228 0.299
NP_442012.1_1 Forward -85 -66 4.81767 0.16
NP_440375.1_8 Reverse -321 -340 -0.4922 0.266
NP_443030.1_4 Reverse -63 -82 -7.37537 0.294
NP_441644.1_6 Forward -254 -244 17.3841 0.00127
NP_441644.1_6 Reverse -245 -255 17.3841 0.00127
NP_443049.1_6 Forward -323 -313 13.2024 0.194
NP_442215.1_2 Forward -256 -240 4.28677 0.0853
NP_442215.1_2 Reverse -243 -259 -4.85801 0.24
NP_442215.1_2 Reverse -311 -327 -6.82463 0.28
NP_440253.1_2 Forward -254 -236 9.16393 0.0507
NP_440929.1_8 Forward -254 -245 19.2726 0.000701
NP_440929.1_8 Reverse -245 -254 19.2726 0.000701
NP_442933.1_10 Forward -254 -245 17.601 0.00325
NP_442933.1_10 Reverse -245 -254 17.601 0.00325
NP_441751.2_8 Forward -253 -239 11.5043 0.0235
NP_441751.2_8 Reverse -246 -260 5.1128 0.0448
NP_442554.1_8 Forward -253 -243 16.2046 0.0065
NP_442554.1_8 Reverse -246 -256 15.3197 0.00882
NP_442554.1_8 Reverse -116 -126 3.22496 0.235
NP_441762.1_7 Reverse -244 -256 0.432302 0.0747
NP_441762.1_7 Forward -323 -311 -5.56589 0.217
NP_441762.1_7 Forward -255 -243 -6.74586 0.284
NP_442142.1_4 Reverse -242 -255 12.2117 0.0464
NP_442142.1_4 Forward -325 -312 7.09854 0.148
NP_442142.1_4 Forward -257 -244 2.96866 0.269
NP_442142.1_4 Forward -82 -69 2.57534 0.286
NP_442292.1_1 Forward -253 -244 18.486 0.00229
NP_442292.1_1 Reverse -246 -255 18.486 0.00229
NP_442292.1_5 Reverse -219 -238 6.19431 0.197
NP_442476.1_6 Forward -253 -239 1.86788 0.202
NP_440895.1_6 Forward -260 -247 12.0157 0.202
NP_443009.1_5 Reverse -244 -255 8.90795 0.0965
NP_443009.1_5 Forward -255 -244 8.90795 0.0965
NP_443009.1_5 Reverse -326 -337 3.99143 0.268
NP_441715.1_4 Forward -253 -243 17.3846 0.0106
NP_441715.1_4 Reverse -246 -256 7.94484 0.107
NP_440357.1_3 Forward -256 -237 1.67108 0.272
NP_440183.1_9 Forward -252 -233 -18.5851 0.276
NP_440183.1_9 Reverse -127 -146 -20.1584 0.282
NP_440379.1_5 Forward -254 -235 -4.32711 0.214
NP_440464.1_10 Reverse -246 -256 13.0082 0.169
NP_441468.1_1 Forward -253 -246 15.8704 0.0124
NP_441468.1_1 Reverse -246 -253 15.8704 0.0124
NP_441020.2_6 Forward -256 -239 5.9387 0.284
NP_441015.1_10 Reverse -308 -327 -5.80207 0.232
NP_441015.1_10 Reverse -95 -114 -11.6036 0.298
NP_441673.1_1 Forward -254 -245 20.8459 0.000698
NP_441673.1_1 Reverse -245 -254 20.8459 0.000698
NP_441673.1_1 Forward -142 -133 -8.06341 0.254
NP_442490.1_9 Forward -254 -235 -8.65367 0.293
NP_442868.1_6 Reverse -243 -253 19.2529 0.00563
NP_442868.1_6 Forward -256 -246 9.81313 0.038
NP_441056.1_1 Forward -254 -235 -1.7705 0.19
NP_441612.1_2 Reverse -245 -255 8.54929 0.21
NP_441612.1_2 Forward -254 -244 8.54929 0.21
NP_442427.1_8 Forward -263 -244 6.68596 0.232
NP_442808.1_1 Reverse -244 -254 8.63269 0.0481
NP_442808.1_1 Forward -255 -245 8.63269 0.0481
NP_442808.1_1 Reverse -312 -322 5.38779 0.155
NP_442050.1_5 Reverse -243 -253 14.3359 0.0206
NP_442050.1_5 Forward -256 -246 7.64939 0.243
NP_442739.1_2 Forward -270 -251 13.1525 0.246
NP_440558.1_2 Forward -235 -216 4.12936 0.152
NP_440558.1_2 Reverse -66 -85 -3.14714 0.234
NP_440558.1_2 Reverse -236 -255 -3.3438 0.234
NP_441518.1_3 Reverse -235 -254 -3.73712 0.114
NP_441878.1_6 Forward -255 -245 10.4031 0.0176
NP_441878.1_6 Reverse -244 -254 10.4031 0.0176
NP_441878.1_6 Reverse -132 -142 1.455 0.0979
NP_441878.1_6 Reverse -69 -79 -7.49312 0.231
NP_441036.1_8 Forward -255 -245 8.33817 0.174
NP_441036.1_8 Reverse -244 -254 8.33817 0.174
NP_441557.1_5 Forward -254 -245 19.9609 0.000699
NP_441557.1_5 Reverse -245 -254 19.9609 0.000699
NP_441445.1_1 Reverse -236 -255 4.42435 0.195
NP_441445.1_1 Reverse -220 -239 3.34271 0.215
NP_441445.1_8 Reverse -141 -160 -11.6036 0.277
NP_441590.1_4 Forward -114 -95 3.53858 0.29
NP_442066.2_9 Reverse -241 -254 17.9155 0.0209
NP_442066.2_9 Forward -258 -245 11.1307 0.154
NP_442419.1_2 Reverse -308 -327 2.94938 0.217
NP_441458.1_10 Forward -115 -96 4.03102 0.236
NP_441458.1_10 Reverse -236 -255 1.86774 0.279
NP_442183.1_1 Forward -254 -240 11.0127 0.0775
NP_442183.1_1 Forward -216 -202 5.01447 0.234
NP_442183.1_9 Reverse -214 -224 9.02648 0.296
NP_441574.1_1 Forward -266 -247 -7.27704 0.286
NP_441574.1_1 Reverse -217 -236 -7.86702 0.297
NP_442347.1_2 Forward -253 -244 12.4878 0.056
NP_442347.1_2 Reverse -246 -255 12.4878 0.056
NP_442347.1_2 Reverse -314 -323 3.34298 0.284
NP_442645.1_2 Reverse -237 -256 -12.1936 0.144
NP_442645.1_2 Forward -262 -243 -15.2418 0.194
NP_441037.1_4 Forward -256 -246 7.9999 0.237
NP_442594.1_9 Reverse -260 -279 8.16011 0.232
NP_440151.1_5 Reverse -211 -230 11.5042 0.16
NP_440690.1_6 Forward -136 -117 18.6823 0.132
NP_441633.1_3 Reverse -243 -256 3.46087 0.0699
NP_441633.1_3 Forward -256 -243 1.19926 0.109
NP_441633.1_3 Forward -144 -131 -6.56889 0.259
NP_441633.1_3 Reverse -171 -184 -6.86388 0.277
NP_441633.1_3 Reverse -68 -81 -7.15888 0.294
NP_440136.1_2 Forward -253 -246 15.9687 0.0123
NP_440136.1_2 Reverse -246 -253 15.9687 0.0123
NP_442998.1_5 Reverse -334 -344 9.7148 0.236
NP_442998.1_10 Forward -252 -245 15.5754 0.0102
NP_442998.1_10 Reverse -247 -254 15.5754 0.0102
NP_440899.1_1 Reverse -41 -60 7.04116 0.267
NP_440299.1_1 Forward -258 -245 12.9984 0.0319
NP_440299.1_1 Forward -83 -70 3.36198 0.247
NP_440299.1_1 Reverse -241 -254 2.28034 0.292
NP_440299.1_1 Forward -18 -5 2.18201 0.294
NP_441799.1_1 Forward -258 -244 15.8302 0.0163
NP_441799.1_1 Reverse -241 -255 13.5686 0.0311
NP_441007.1_10 Reverse -240 -253 9.85238 0.083
NP_441007.1_10 Forward -259 -246 1.29759 0.203
NP_441435.1_5 Reverse -201 -220 11.5042 0.134
NP_440256.1_1 Forward -257 -238 -2.0655 0.112
NP_440087.1_1 Reverse -236 -255 1.17943 0.167
NP_441229.1_10 Forward -88 -69 -3.73712 0.288
NP_441559.1_8 Forward -220 -206 2.2612 0.147
NP_441559.1_8 Forward -249 -235 -6.68692 0.279
NP_441559.1_8 Forward -350 -336 -7.2769 0.289
NP_440915.1_6 Reverse -241 -255 1.67122 0.132
NP_442452.1_3 Reverse -272 -291 2.55606 0.277
NP_442866.1_1 Reverse -308 -327 -7.27704 0.266
NP_441464.1_1 Forward -230 -211 7.27595 0.262
NP_441464.1_8 Reverse -245 -259 3.63784 0.291
NP_440702.1_1 Reverse -272 -291 10.6192 0.218
NP_440702.1_1 Forward -256 -237 10.5209 0.218
NP_440306.1_5 Reverse -3 -22 -0.197208 0.265
NP_440306.1_9 Reverse -237 -256 13.6675 0.184
NP_442993.1_1 Reverse -245 -261 -9.28291 0.181
NP_442386.1_9 Reverse -244 -253 13.8639 0.0289
NP_442386.1_9 Forward -255 -246 13.8639 0.0289
NP_441340.1_5 Forward -253 -246 15.6737 0.0124
NP_441340.1_5 Reverse -246 -253 15.6737 0.0124
NP_442484.1_2 Reverse -234 -253 7.86593 0.147
NP_440168.1_9 Forward -256 -237 -3.93378 0.296
NP_441254.1_3 Forward -187 -168 16.8141 0.156
NP_442506.1_2 Reverse -308 -327 3.34271 0.278
NP_442240.1_2 Reverse -314 -333 -10.227 0.137
NP_442240.1_2 Reverse -208 -227 -20.3551 0.295
NP_440586.1_8 Forward -253 -246 13.2151 0.026
NP_440586.1_8 Reverse -246 -253 13.2151 0.026
NP_440586.1_8 Forward -321 -314 8.88855 0.205
NP_442251.1_6 Forward -253 -246 15.2804 0.0124
NP_442251.1_6 Reverse -246 -253 15.2804 0.0124
NP_440684.1_9 Forward -260 -246 12.9793 0.168
NP_441262.1_3 Reverse -245 -252 14.7888 0.0223
NP_441262.1_3 Forward -254 -247 14.7888 0.0223
NP_443051.1_1 Reverse -244 -253 10.4228 0.00754
NP_443051.1_1 Forward -255 -246 10.4228 0.00754
NP_439984.1_3 Forward -261 -247 18.4851 0.0684
NP_439937.1_8 Forward -324 -305 22.6156 0.0156
NP_439937.1_9 Reverse -132 -149 -16.973 0.291
NP_439937.1_9 Reverse -69 -86 -17.1697 0.294
NP_443039.1_7 Forward -231 -217 8.55376 0.188
NP_439943.1_4 Reverse -91 -110 3.83436 0.287
NP_440372.1_2 Forward -253 -246 16.3621 0.0124
NP_440372.1_2 Reverse -246 -253 16.3621 0.0124
NP_441789.1_7 Forward -236 -217 1.17865 0.245
NP_441789.1_7 Forward -224 -205 -3.54122 0.274
NP_442285.1_7 Forward -199 -180 7.47261 0.275
NP_441803.1_2 Forward -327 -308 2.65439 0.206
NP_439977.1_5 Reverse -307 -326 -0.885524 0.236
NP_442384.1_10 Reverse -245 -258 15.8506 0.00946
NP_442384.1_10 Forward -254 -241 11.6223 0.0341
NP_440693.1_6 Reverse -109 -128 19.764 0.129
NP_440364.1_6 Forward -329 -316 13.5883 0.275
NP_441877.1_7 Reverse -240 -259 -0.39464 0.284
NP_442790.1_4 Reverse -236 -255 -8.45701 0.17
NP_442262.1_10 Forward -253 -246 14.1988 0.0123
NP_442262.1_10 Reverse -246 -253 14.1988 0.0123
NP_441689.1_5 Forward -256 -246 5.78111 0.197
NP_441689.1_5 Reverse -243 -253 5.78111 0.197
NP_440163.1_10 Forward -325 -315 14.4347 0.102
NP_440344.1_10 Reverse -238 -255 -1.53445 0.0547
NP_440344.1_10 Reverse -306 -323 -9.79426 0.156
NP_440282.1_2 Forward -124 -105 6.29264 0.295
NP_440531.1_6 Reverse -237 -256 14.2574 0.0397
NP_440189.1_10 Forward -265 -246 5.211 0.279
NP_441965.1_10 Reverse -242 -258 9.10498 0.123
NP_441965.1_10 Forward -257 -241 3.89344 0.253
NP_440297.1_9 Forward -253 -243 -0.118297 0.282
NP_440297.1_9 Reverse -246 -256 -0.118297 0.282
NP_441592.1_4 Reverse -245 -264 6.78429 0.124
NP_441896.1_3 Reverse -106 -125 3.6377 0.165
NP_440700.1_8 Forward -277 -263 15.7325 0.223
NP_440894.1_10 Reverse -308 -327 2.16274 0.294
NP_442129.1_1 Forward -239 -220 2.0644 0.121
NP_440999.1_9 Reverse -241 -255 8.06273 0.0797
NP_440999.1_9 Reverse -309 -323 2.85119 0.142
NP_440999.1_9 Forward -296 -282 -2.45868 0.27
NP_440888.1_2 Forward -254 -240 13.7653 0.0246
NP_440888.1_2 Reverse -245 -259 8.06211 0.172
NP_440792.1_5 Forward -253 -234 6.68596 0.237
NP_440600.1_4 Reverse -237 -255 -4.30741 0.257
NP_440060.1_1 Reverse -130 -149 10.7175 0.278
NP_440491.1_1 Reverse -91 -110 6.42973 0.296
NP_439969.1_1 Reverse -139 -158 -2.85214 0.288
NP_442948.1_2 Reverse -216 -235 6.19431 0.244
NP_442948.1_2 Forward -323 -304 3.73603 0.283
NP_441949.1_4 Forward -92 -73 4.62101 0.281
NP_441949.1_5 Reverse -9 -28 12.4153 0.23
NP_442807.1_10 Reverse -218 -232 15.7325 0.223
NP_441543.1_2 Forward -253 -244 16.9127 0.00359
NP_441543.1_2 Reverse -246 -255 16.9127 0.00359
NP_441543.1_3 Reverse -375 -389 5.80051 0.288
NP_442845.1_2 Forward -260 -246 15.3392 0.0729
NP_440771.1_2 Forward -254 -235 13.6675 0.293
NP_441469.1_8 Forward -255 -246 6.48957 0.227
NP_441469.1_8 Reverse -244 -253 6.48957 0.227
NP_442315.1_2 Forward -259 -247 9.28209 0.291
NP_443064.1_6 Forward -254 -244 12.5669 0.0796
NP_443064.1_6 Reverse -245 -255 12.5669 0.0796
NP_442578.1_7 Forward -253 -246 14.5921 0.026
NP_442578.1_7 Reverse -246 -253 14.5921 0.026
NP_441462.1_2 Forward -254 -244 11.5831 0.00406
NP_441462.1_2 Reverse -245 -255 11.5831 0.00406
NP_441462.1_5 Reverse -57 -76 2.26107 0.291
NP_441621.1_7 Reverse -311 -325 -5.40861 0.252
NP_441621.1_7 Reverse -234 -248 -5.70361 0.26
NP_443062.1_1 Reverse -245 -263 9.13097 0.14
NP_443062.1_1 Forward -254 -236 6.59578 0.195
NP_440939.1_4 Forward -303 -284 17.2074 0.238
NP_440519.1_8 Reverse -217 -233 6.25339 0.21
NP_440519.1_8 Reverse -233 -249 1.73016 0.279
NP_442204.1_1 Forward -326 -315 0.94365 0.281
NP_442204.1_6 Reverse -310 -329 7.57094 0.235
NP_441560.1_8 Forward -259 -240 14.2396 0.172
NP_442487.1_2 Reverse -62 -81 3.24359 0.232
NP_442780.1_1 Reverse -13 -32 7.57094 0.279
NP_440516.1_2 Forward -260 -242 -1.84914 0.292
NP_440516.1_8 Forward -254 -245 16.9127 0.00442
NP_440516.1_8 Reverse -245 -254 16.9127 0.00442
NP_442428.1_5 Forward -253 -246 15.8704 0.0124
NP_442428.1_5 Reverse -246 -253 15.8704 0.0124
NP_442428.1_8 Reverse -309 -328 2.94938 0.224
NP_440618.1_1 Reverse -41 -60 -11.8986 0.297
NP_442120.1_10 Forward -298 -279 -16.2252 0.297
NP_440673.1_3 Forward -252 -245 12.4288 0.0426
NP_440673.1_3 Reverse -247 -254 12.4288 0.0426
NP_440673.1_3 Reverse -315 -322 9.38056 0.192
NP_440673.1_7 Forward -252 -233 2.0644 0.234
NP_441052.1_2 Forward -254 -244 19.9412 0.00106
NP_441052.1_2 Reverse -245 -255 19.9412 0.00106
NP_442219.1_9 Forward -253 -244 17.7976 0.00718
NP_442219.1_9 Reverse -246 -255 17.7976 0.00718
NP_440436.1_4 Forward -253 -244 17.2072 0.00233
NP_440436.1_4 Reverse -246 -255 17.2072 0.00233
NP_440436.1_4 Forward -78 -69 8.75075 0.0995
NP_441884.1_9 Forward -257 -238 -15.5368 0.138
NP_441893.1_10 Forward -400 -381 12.8808 0.207
NP_440314.1_9 Reverse -246 -265 7.27595 0.0486
NP_440314.1_9 Forward -253 -234 -4.72043 0.213
NP_440648.1_1 Reverse -245 -264 8.75091 0.189
NP_442907.1_9 Forward -247 -228 -4.72043 0.28
NP_441719.1_4 Forward -253 -246 16.3621 0.0124
NP_441719.1_4 Reverse -246 -253 16.3621 0.0124
NP_441004.1_1 Reverse -54 -73 -9.047 0.206
NP_441004.1_2 Reverse -49 -68 -3.24547 0.274
NP_441004.1_5 Reverse -56 -70 14.4542 0.22
NP_442366.1_3 Reverse -244 -262 -3.22577 0.244
NP_442366.1_5 Forward -257 -247 15.4175 0.0374
NP_442139.1_7 Reverse -92 -111 12.1925 0.174
NP_440129.1_4 Reverse -248 -266 20.4712 0.0701
NP_442873.1_9 Reverse -235 -254 14.1583 0.105
NP_440296.1_10 Reverse -103 -122 -14.3569 0.269
NP_442206.1_10 Forward -254 -239 6.07642 0.178
NP_443054.1_2 Forward -144 -130 1.47456 0.245
NP_443054.1_2 Forward -165 -151 -0.295402 0.293
NP_443054.1_2 Reverse -243 -257 -0.393733 0.294
NP_442430.1_2 Forward -204 -185 7.17762 0.268
NP_441851.1_10 Forward -255 -245 15.8113 0.00552
NP_441851.1_10 Reverse -244 -254 15.8113 0.00552
NP_442856.1_7 Reverse -236 -255 9.83255 0.0924
NP_442856.1_7 Forward -112 -93 -2.65548 0.236
NP_441668.1_4 Forward -264 -245 5.80098 0.164
NP_442515.1_1 Reverse -244 -258 13.3726 0.0278
NP_442515.1_1 Forward -143 -129 11.8976 0.0376
NP_442515.1_1 Forward -255 -241 11.0127 0.0431
NP_440593.1_3 Forward -199 -180 -6.78538 0.28
NP_441982.1_6 Reverse -250 -259 12.5809 0.274
NP_440165.1_5 Forward -255 -236 -5.11376 0.22
NP_441046.1_2 Forward -265 -246 0.196116 0.271
NP_441349.1_10 Forward -264 -245 -9.24366 0.287
NP_441409.1_6 Forward -260 -241 -8.45701 0.168
NP_440432.1_9 Forward -253 -238 7.45305 0.0427
NP_440432.1_9 Forward -141 -126 -1.00341 0.167
NP_442843.1_1 Forward -253 -234 -5.01543 0.239
NP_442843.1_1 Reverse -275 -294 -5.9004 0.244
NP_439960.1_10 Forward -329 -311 -2.14413 0.25
NP_442450.1_5 Forward -256 -246 7.55152 0.13
NP_440588.1_2 Forward -263 -244 -1.08219 0.155
NP_440588.1_2 Reverse -304 -323 -1.86883 0.157
NP_440588.1_2 Forward -151 -132 -5.60541 0.256
NP_440588.1_2 Forward -88 -69 -6.58872 0.285
NP_440588.1_3 Reverse -228 -247 13.0775 0.248
NP_441570.1_1 Forward -254 -236 -0.275845 0.0447
NP_440078.1_10 Reverse -245 -264 9.73422 0.195
NP_440078.1_10 Forward -226 -207 2.85105 0.269
NP_441078.1_4 Forward -254 -245 19.6659 0.0007
NP_441078.1_4 Reverse -245 -254 19.6659 0.0007
NP_441078.1_4 Reverse -70 -79 -1.57357 0.266
NP_442729.1_8 Forward -258 -245 10.639 0.125
NP_440707.1_9 Reverse -320 -339 5.70265 0.235
NP_442443.1_1 Reverse -320 -339 -5.9004 0.287
NP_442443.1_4 Forward -280 -270 13.7459 0.229
NP_440526.1_3 Forward -253 -242 10.2846 0.0646
NP_440526.1_3 Reverse -71 -82 3.30311 0.267
NP_440526.1_3 Reverse -246 -257 1.04151 0.267
NP_441432.1_8 Reverse -244 -253 16.8143 0.00595
NP_441432.1_8 Forward -255 -246 16.8143 0.00595
NP_443024.1_3 Reverse -220 -230 16.4996 0.255
NP_442320.1_8 Reverse -239 -253 -4.91696 0.192
NP_441732.1_2 Forward -258 -242 -16.7561 0.195
NP_440497.1_2 Forward -253 -234 5.01433 0.287
NP_440760.1_1 Reverse -245 -264 12.6841 0.00983
NP_440760.1_1 Forward -254 -235 -14.4552 0.131
NP_442797.1_2 Reverse -240 -258 17.6198 0.113
NP_440199.1_10 Reverse -242 -252 7.25653 0.231
NP_442353.1_4 Forward -260 -241 5.70185 0.183
NP_442353.1_4 Reverse -239 -258 2.06362 0.238
NP_440913.1_1 Forward -256 -238 7.88563 0.195
NP_442489.1_7 Forward -254 -245 20.1576 0.000695
NP_442489.1_7 Reverse -245 -254 20.1576 0.000695
NP_442489.1_7 Reverse -70 -79 -1.37691 0.195
NP_442489.1_7 Reverse -133 -142 -1.77023 0.247
NP_442489.1_7 Forward -79 -70 -2.06522 0.288
NP_440559.1_1 Forward -253 -244 17.4043 0.00658
NP_440559.1_1 Reverse -246 -255 17.4043 0.00658
NP_441659.2_8 Forward -254 -244 18.1713 0.00133
NP_441659.2_8 Reverse -245 -255 18.1713 0.00133
NP_441022.1_1 Forward -275 -266 10.8747 0.284
NP_441092.1_3 Reverse -190 -209 3.53937 0.183
NP_441092.1_3 Reverse -247 -266 2.26107 0.19
NP_442913.1_10 Reverse -236 -255 5.80098 0.0678
NP_442913.1_10 Forward -263 -244 -1.47551 0.171
NP_442849.1_1 Reverse -95 -109 7.86607 0.282
NP_439956.1_7 Reverse -211 -230 3.93269 0.257
NP_440779.1_5 Forward -142 -125 -13.9242 0.234
NP_442346.1_2 Forward -265 -246 11.0125 0.216
NP_442346.1_5 Forward -255 -245 16.6963 0.00248
NP_442346.1_5 Reverse -244 -254 16.6963 0.00248
NP_442346.1_5 Forward -183 -173 5.48657 0.243
NP_442346.1_5 Forward -80 -70 4.99491 0.267
NP_442346.1_10 Forward -256 -237 -2.45882 0.294
NP_440352.1_5 Reverse -315 -334 9.93029 0.289
NP_440545.1_3 Reverse -43 -60 2.89044 0.0923
NP_440545.1_3 Forward -128 -111 -2.71443 0.191
NP_441856.1_3 Reverse -242 -261 -2.95047 0.272
NP_440459.1_2 Reverse -311 -328 8.10198 0.27
NP_441653.1_2 Reverse -234 -253 3.72288 0.264
NP_442551.1_4 Forward -81 -66 -0.905081 0.245
NP_442603.1_7 Reverse -245 -259 9.43874 0.146
NP_442603.1_7 Forward -254 -240 6.58715 0.236
NP_442603.1_9 Forward -113 -95 -0.472507 0.3
NP_441585.1_5 Reverse -340 -359 5.80018 0.211
NP_441585.1_5 Reverse -257 -276 -0.29631 0.291
NP_441888.1_7 Reverse -240 -254 2.16287 0.225
NP_441047.1_2 Reverse -208 -227 -2.26216 0.273
NP_441833.1_4 Forward -253 -246 15.9687 0.0124
NP_441833.1_4 Reverse -246 -253 15.9687 0.0124
NP_442162.1_9 Forward -253 -246 16.2637 0.0124
NP_442162.1_9 Reverse -246 -253 16.2637 0.0124
NP_440788.1_1 Reverse -220 -239 1.37609 0.121
NP_440671.1_4 Forward -328 -314 5.50613 0.281
NP_442073.1_6 Reverse -304 -323 5.11266 0.25
NP_442140.1_3 Reverse -246 -256 12.2714 0.0632
NP_442140.1_3 Forward -253 -243 10.3048 0.0902
NP_441609.1_1 Forward -272 -253 -0.0988766 0.226
NP_441609.1_1 Reverse -257 -276 -1.27885 0.265
NP_441609.1_1 Reverse -200 -219 -2.0655 0.278
NP_440875.1_9 Forward -252 -242 7.69067 0.255
NP_441813.1_5 Reverse -243 -253 18.1713 0.00743
NP_441813.1_5 Forward -256 -246 8.63316 0.0367
NP_440590.1_4 Reverse -246 -259 9.85238 0.0331
NP_440590.1_4 Forward -253 -240 4.24752 0.0627
NP_440567.1_1 Forward -253 -239 4.62115 0.116
NP_440567.1_1 Reverse -246 -260 2.65453 0.167
NP_442497.1_10 Forward -253 -244 10.4228 0.0087
NP_442497.1_10 Reverse -246 -255 10.4228 0.0087
NP_440821.1_4 Reverse -243 -253 9.41981 0.0286
NP_440821.1_4 Forward -256 -246 9.41981 0.0286
NP_441239.1_9 Reverse -243 -255 5.25052 0.223
NP_441239.1_9 Forward -256 -244 3.38223 0.285
NP_442568.1_8 Reverse -15 -29 8.35772 0.287
NP_440833.1_6 Reverse -254 -268 12.3887 0.194
NP_440876.1_5 Forward -252 -233 9.0459 0.277
NP_440876.1_5 Reverse -247 -266 6.29264 0.283
NP_442138.1_10 Forward -254 -235 4.12936 0.113
NP_440546.1_4 Forward -254 -244 10.046 0.109
NP_440546.1_4 Reverse -245 -255 10.046 0.109
NP_440462.1_6 Reverse -243 -253 9.61647 0.0429
NP_440462.1_6 Forward -256 -246 1.35667 0.294
NP_442340.1_3 Forward -132 -113 -7.08038 0.23
NP_440868.1_4 Reverse -241 -253 10.0687 0.0405
NP_440868.1_4 Forward -258 -246 8.10212 0.0602
NP_441204.1_1 Reverse -236 -255 7.27595 0.25
NP_442812.1_9 Reverse -129 -148 16.5191 0.182
NP_441582.1_5 Forward -81 -62 8.94676 0.164
NP_441474.1_1 Forward -237 -218 -2.55791 0.28
NP_442402.1_4 Forward -75 -56 -7.57277 0.276
NP_441848.1_4 Reverse -329 -345 10.0335 0.265
NP_440696.1_6 Forward -266 -247 6.29264 0.266
NP_440696.1_6 Forward -199 -180 4.12936 0.288
NP_442039.1_4 Forward -253 -246 15.1821 0.0124
NP_442039.1_4 Reverse -246 -253 15.1821 0.0124
NP_442039.1_7 Forward -132 -122 10.6981 0.257
NP_441811.1_8 Forward -260 -246 13.5693 0.178
NP_442829.1_2 Reverse -255 -271 14.1324 0.287
NP_440825.1_7 Reverse -246 -256 12.9096 0.152
NP_442696.1_2 Forward -255 -237 17.4237 0.0872
NP_442837.1_3 Forward -253 -246 15.7721 0.0124
NP_442837.1_3 Reverse -246 -253 15.7721 0.0124
NP_440160.1_9 Reverse -69 -88 11.0125 0.23
NP_442053.1_1 Forward -254 -245 18.3876 0.0007
NP_442053.1_1 Reverse -245 -254 18.3876 0.0007
NP_440505.1_3 Reverse -243 -253 18.3679 0.00213
NP_440505.1_3 Forward -256 -246 9.22315 0.122
NP_442360.1_5 Reverse -36 -46 14.3364 0.233
NP_441701.1_3 Reverse -213 -230 8.7903 0.247
NP_440914.1_1 Forward -254 -244 17.5935 0.000537
NP_440914.1_1 Reverse -245 -255 17.5935 0.000537
NP_440914.1_1 Reverse -70 -80 12.9091 0.0435
NP_441011.1_8 Forward -253 -244 8.25953 0.144
NP_441011.1_8 Reverse -246 -255 8.25953 0.144
NP_442533.1_6 Forward -254 -245 17.2076 0.00137
NP_442533.1_6 Reverse -245 -254 17.2076 0.00137
NP_442533.1_6 Forward -142 -133 3.44131 0.212
NP_442541.1_10 Forward -232 -218 17.8952 0.182
NP_440854.1_2 Reverse -245 -264 16.5191 0.26
NP_441482.1_7 Reverse -239 -253 -12.2918 0.292
NP_439944.1_9 Forward -253 -243 10.5014 0.0887
NP_439944.1_9 Reverse -246 -256 10.5014 0.0887
NP_440116.1_8 Forward -253 -234 -8.94866 0.264
NP_440115.1_6 Reverse -242 -252 6.8632 0.167
NP_440007.1_9 Reverse -241 -255 5.30946 0.26
NP_439965.1_1 Forward -331 -312 -8.65367 0.275
NP_441059.1_2 Forward -277 -258 -6.39206 0.265
NP_441961.1_4 Reverse -293 -312 2.55606 0.291
NP_440608.1_6 Reverse -246 -265 5.2102 0.255
NP_441602.1_6 Reverse -281 -300 13.7658 0.277
NP_441972.1_5 Forward -141 -122 4.916 0.0969
NP_441106.1_1 Forward -255 -246 9.63616 0.0311
NP_441106.1_1 Reverse -244 -253 9.63616 0.0311
NP_441869.1_9 Forward -155 -136 12.2908 0.293
NP_441286.1_1 Forward -255 -243 12.9203 0.00815
NP_441286.1_1 Reverse -244 -256 12.9203 0.00815
NP_440670.1_8 Forward -254 -245 18.3876 0.000699
NP_440670.1_8 Reverse -245 -254 18.3876 0.000699
NP_440886.1_7 Forward -255 -245 7.94438 0.0805
NP_440886.1_7 Reverse -244 -254 7.94438 0.0805
NP_440886.1_7 Reverse -309 -319 3.42118 0.282
NP_442614.1_2 Reverse -245 -259 8.16106 0.255
NP_442614.1_2 Forward -254 -240 6.58777 0.291
NP_439995.1_5 Forward -264 -245 5.70265 0.276
NP_440907.2_8 Reverse -246 -256 7.64939 0.117
NP_441021.1_1 Forward -253 -234 -8.85033 0.201
NP_441021.1_1 Reverse -246 -265 -9.83364 0.223
NP_441463.1_3 Reverse -235 -254 -10.1286 0.289
NP_441626.1_2 Forward -253 -246 15.7721 0.0124
NP_441626.1_2 Reverse -246 -253 15.7721 0.0124
NP_442365.1_7 Forward -258 -239 -5.01543 0.256
NP_442794.1_1 Forward -258 -246 9.28209 0.0795
NP_442615.1_1 Forward -263 -245 4.54237 0.0452
NP_442615.1_1 Reverse -38 -56 -7.25734 0.283
NP_441962.1_4 Forward -259 -240 -11.7019 0.244
NP_441962.1_5 Forward -333 -314 5.01433 0.291
NP_440387.1_1 Reverse -245 -261 13.4315 0.00865
NP_440387.1_1 Forward -254 -238 -3.28472 0.157
NP_440855.1_5 Forward -114 -95 6.39016 0.285
NP_440855.1_5 Forward -324 -305 2.85027 0.288
NP_441431.1_2 Reverse -242 -256 8.16044 0.222
NP_441836.1_1 Reverse -234 -253 14.8109 0.178
NP_441836.1_2 Forward -260 -241 1.76941 0.187
NP_441836.1_2 Reverse -239 -258 -3.83545 0.244
NP_440814.1_4 Forward -263 -244 -11.8003 0.228
NP_440114.1_10 Forward -254 -240 9.5377 0.169
NP_441720.1_2 Reverse -150 -169 9.43841 0.213
NP_441272.1_7 Forward -260 -250 15.418 0.2
NP_440766.1_5 Forward -280 -268 7.65579 0.288
NP_441237.1_9 Reverse -246 -256 14.828 0.0242
NP_442743.1_4 Reverse -314 -333 -0.0988766 0.174
NP_440457.1_1 Reverse -213 -225 -0.0593532 0.25
NP_440457.1_1 Reverse -241 -253 -0.74767 0.273
NP_440801.1_10 Forward -326 -307 10.0292 0.272
NP_440142.1_9 Reverse -263 -277 12.9786 0.284
NP_442509.1_9 Forward -254 -244 8.14104 0.192
NP_442509.1_9 Reverse -245 -255 8.14104 0.192
NP_440524.1_2 Reverse -315 -334 -0.787193 0.27
NP_440554.1_4 Forward -253 -243 8.92815 0.0646
NP_441845.1_6 Forward -154 -136 1.49411 0.274
NP_441885.1_1 Reverse -41 -55 18.3941 0.282
NP_441885.1_5 Forward -254 -244 20.9245 0.000538
NP_441885.1_5 Reverse -245 -255 20.9245 0.000538
NP_440478.1_9 Reverse -137 -156 10.3242 0.255
NP_442341.1_7 Reverse -244 -258 13.6676 0.0334
NP_442341.1_7 Forward -255 -241 7.47274 0.105
NP_440423.1_6 Reverse -237 -256 -7.76869 0.138
NP_443000.1_7 Reverse -243 -253 19.9412 0.00223
NP_443000.1_7 Forward -256 -246 10.3048 0.0345
NP_441832.1_1 Forward -267 -248 15.8299 0.278
NP_440275.1_3 Reverse -243 -253 15.123 0.0182
NP_440275.1_3 Forward -256 -246 8.04317 0.0602
NP_440091.1_1 Reverse -241 -253 1.31728 0.198
NP_442354.1_7 Reverse -242 -261 6.88262 0.216
NP_440679.1_10 Forward -326 -307 -4.91709 0.161
NP_442451.1_2 Reverse -237 -256 -8.65367 0.252
NP_442451.1_2 Forward -126 -107 -10.817 0.28
NP_441122.1_1 Forward -83 -68 14.6312 0.126
NP_441389.1_5 Forward -398 -379 11.7992 0.251
NP_439962.1_4 Forward -142 -123 -8.35868 0.293
NP_442373.1_10 Reverse -307 -326 5.11266 0.288
NP_440216.1_1 Forward -254 -240 0.0979218 0.0284
NP_440216.1_1 Reverse -245 -259 -10.5218 0.145
NP_440172.1_1 Forward -254 -244 15.0247 0.00945
NP_440172.1_1 Reverse -245 -255 15.0247 0.00945
NP_442015.1_10 Forward -110 -97 6.31247 0.119
NP_442015.1_10 Reverse -241 -254 2.77255 0.187
NP_442015.1_10 Forward -258 -245 1.39592 0.204
NP_441226.1_7 Forward -253 -246 14.4934 0.0123
NP_441226.1_7 Reverse -246 -253 14.4934 0.0123
NP_441111.1_7 Forward -253 -245 18.7023 0.00294
NP_441111.1_7 Reverse -246 -254 18.7023 0.00294
NP_441766.1_2 Forward -254 -245 17.5026 0.00297
NP_441766.1_2 Reverse -245 -254 17.5026 0.00297
NP_443052.1_9 Forward -221 -202 -6.98204 0.291
NP_440261.1_5 Forward -253 -240 -2.63565 0.0924
NP_440261.1_5 Reverse -246 -259 -2.73398 0.0924
NP_440988.1_2 Forward -230 -212 6.214 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATGGCTTCCAGGAGGGTGAGAGTACCCACTACGTTGTTTTGGTAATAAATGTCCGGCTTTTGCACCGATTCTCCCACGGCGATGAAGGCGGCAAAATGCATGACAGCAGCAATATTCCTAGTGGCAAAAAGTTGGTCTAGTTTTTGGCGATCGCCAGTATGGCCGACTACCAATTCCACCCCCAGGGGTTGCACTAGTTCCTTGTGACCGTAGCTGAGGTTATCGTAGATAAGGACGTCAAAGCCCGCCTGTTGTAGGGCAAGCACCCCATGGGAGCCGATGTAACCCGCCCCTCCGGTGACCAAAATTGTTTGTTGCGTGGCCATTGTCGACTATTAACCCAAGCTGTTGCCTCGCCTAGAGCATACCATTCTTAACCTTGCTTGACCTTAGCTTTTT

CDS

ATGCCATCTACTTTTTCCCAACCATCCCCCTCTAATGCCCTTGTTAATGACCGCCGGGACGTATTTCCCCTTTCTCCCCTGATTAAAATCACCCTGGTCAATCTCTACCTAGCTCTGACAGTTCCCCTGCCCATTTTGGCCCAACTCACCCAAGGAAATGCATTACTTACCCTATTGTTAACCGTTGGACTGATGGGAGGCTTAGTTGCTTTAGTAGCTGCCTTGGCGGAACAGGTGGTGCTGAATGGAGAGGGAATTGCGGTGCGTTATCCCCGCTGGGTACCCAAATTTTTTCGGTCCGGTTGGCAATTATCTTGGGCAGATGTCACCGCATTGAAATGTCGCACCACAGGCCAGGGGGGCTTGGTTTACTATTTCCTCACAGAGTCGAAAGATAGGGCCTATCTGCTACCCATGCGGGTGGCGGGCTTTAATCGGCTAACTCAACTGGTGAGCGACCATACGGGCATTGACACCCAGGATGTGCGCCCCCTTTCCCAACCCTGGATGTATTTATTACTACTCCTATTTACCTTCTTACTTTGGGGCAGTCAGTTGGCGATCGTCCTATTGCTTTGGAGTAGCCCTCCCCTGGCATAA

Protein

MPSTFSQPSPSNALVNDRRDVFPLSPLIKITLVNLYLALTVPLPILAQLTQGNALLTLLLTVGLMGGLVALVAALAEQVVLNGEGIAVRYPRWVPKFFRSGWQLSWADVTALKCRTTGQGGLVYYFLTESKDRAYLLPMRVAGFNRLTQLVSDHTGIDTQDVRPLSQPWMYLLLLLFTFLLWGSQLAIVLLLWSSPPLA