Your browser is old and dusty. Try Google Chrome!

Details for slr0263

ORF slr0263
Accession NP_441261.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -318 -299 -29.5982 0.23
NP_441418.1_6 Reverse -105 -124 -29.5982 0.23
NP_441418.1_6 Forward -324 -305 -30.0898 0.256
NP_442291.1_3 Reverse -310 -329 11.0117 0.281
NP_440897.1_6 Forward -254 -235 -3.14789 0.233
NP_441453.1_7 Reverse -96 -103 11.9372 0.298
NP_441453.1_7 Reverse -127 -134 11.6422 0.298
NP_441623.1_1 Reverse -222 -240 -2.43913 0.241
NP_441623.1_1 Reverse -306 -324 -4.50408 0.274
NP_441818.1_9 Forward -323 -304 -1.47551 0.2
NP_440150.1_6 Forward -372 -353 0.884433 0.295
NP_442744.1_8 Forward -104 -85 5.80098 0.152
NP_442287.1_1 Reverse -295 -305 13.3526 0.277
NP_442173.1_1 Reverse -290 -298 8.47588 0.0947
NP_442752.1_4 Forward -323 -316 9.18389 0.116
NP_440074.1_6 Reverse -150 -169 12.88 0.268
NP_441934.1_9 Forward -81 -62 11.7992 0.299
NP_440061.1_9 Reverse -17 -31 7.86545 0.189
NP_441054.1_2 Forward -315 -296 12.8808 0.217
NP_442062.1_8 Reverse -289 -299 5.97822 0.143
NP_442062.1_8 Reverse -31 -41 4.3066 0.221
NP_441802.1_1 Forward -179 -160 7.17762 0.254
NP_440304.1_4 Reverse -29 -39 4.40493 0.266
NP_440304.1_4 Forward -353 -343 3.81494 0.292
NP_439918.1_2 Forward -321 -302 6.39097 0.154
NP_441208.1_9 Reverse -9 -23 9.93102 0.197
NP_441208.1_9 Forward -354 -340 5.01447 0.282
NP_441594.1_6 Forward -116 -97 7.66927 0.17
NP_441594.1_6 Forward -180 -161 2.94938 0.239
NP_440132.1_1 Forward -323 -305 13.0972 0.178
NP_441925.1_4 Reverse -343 -362 -7.47443 0.195
NP_441925.1_4 Reverse -296 -315 -14.8492 0.263
NP_441925.1_4 Reverse -353 -372 -16.2258 0.281
NP_441955.1_8 Forward -375 -358 7.217 0.281
NP_440447.1_1 Reverse -381 -399 1.49411 0.3
NP_441713.1_8 Reverse -192 -210 7.00065 0.3
NP_440178.1_7 Reverse -167 -186 -14.4552 0.153
NP_442570.1_3 Reverse -97 -116 -8.752 0.292
NP_442570.1_3 Reverse -117 -136 -9.53865 0.299
NP_441624.1_7 Forward -389 -375 9.63603 0.218
NP_440481.1_6 Reverse -367 -385 16.2438 0.124
NP_441533.1_7 Reverse -302 -320 18.7995 0.179
NP_440343.1_3 Reverse -290 -308 6.01657 0.242
NP_440343.1_3 Reverse -308 -326 4.04996 0.266
NP_441209.1_4 Forward -390 -371 10.6184 0.281
NP_440747.1_10 Forward -257 -245 -12.3507 0.27
NP_440842.1_10 Forward -301 -287 2.5562 0.274
NP_441014.1_5 Reverse -240 -258 21.1603 0.0815
NP_442848.1_4 Reverse -123 -137 5.30946 0.299
NP_443018.1_3 Forward -281 -274 7.11894 0.16
NP_443018.1_3 Reverse -106 -113 4.26735 0.267
NP_443018.1_3 Forward -113 -106 4.16902 0.278
NP_441634.1_8 Forward -374 -360 -4.52363 0.295
NP_440376.1_1 Forward -351 -342 4.12963 0.173
NP_440376.1_1 Forward -254 -245 0.196389 0.283
NP_440266.1_3 Forward -241 -225 14.8847 0.266
NP_442687.1_7 Forward -299 -289 6.76487 0.154
NP_440066.1_5 Reverse -344 -363 12.3883 0.251
NP_441846.1_10 Forward -321 -302 -20.8467 0.256
NP_441846.1_10 Forward -322 -303 -22.715 0.264
NP_441846.1_10 Forward -370 -351 -22.8133 0.266
NP_441846.1_10 Forward -84 -65 -23.1083 0.277
NP_441846.1_10 Forward -315 -296 -23.7966 0.298
NP_442958.1_3 Forward -362 -343 -2.85214 0.299
NP_440642.1_10 Reverse -236 -250 13.1753 0.133
NP_441013.1_3 Forward -371 -352 9.53756 0.23
NP_441013.1_3 Reverse -195 -214 5.89931 0.281
NP_441950.1_7 Forward -327 -308 -7.57203 0.279
NP_440141.1_8 Reverse -273 -292 5.80098 0.271
NP_441487.1_9 Forward -299 -280 3.73603 0.154
NP_442321.1_4 Reverse -303 -322 -4.6221 0.284
NP_440203.1_5 Reverse -299 -309 9.81266 0.245
NP_441162.1_3 Reverse -362 -381 8.35759 0.265
NP_441338.2_4 Reverse -270 -289 13.1758 0.213
NP_441338.2_5 Forward -219 -200 4.03102 0.299
NP_442911.1_2 Forward -308 -289 -10.817 0.289
NP_441591.1_10 Forward -116 -97 4.12936 0.297
NP_443055.1_6 Reverse -343 -361 8.86816 0.141
NP_443055.1_6 Forward -323 -305 1.39504 0.231
NP_440993.1_4 Reverse -245 -262 6.23369 0.248
NP_440993.1_4 Reverse -244 -261 2.30045 0.3
NP_441099.1_5 Reverse -334 -353 -9.93197 0.237
NP_441294.1_7 Reverse -311 -325 9.34661 0.249
NP_442771.1_1 Reverse -287 -305 -7.55234 0.171
NP_440147.1_4 Reverse -358 -371 1.29759 0.233
NP_441916.1_7 Forward -351 -341 4.89658 0.154
NP_441916.1_10 Forward -248 -229 6.09597 0.208
NP_441041.1_7 Reverse -286 -298 4.79381 0.295
NP_441725.1_5 Reverse -290 -300 -0.511621 0.26
NP_439966.1_7 Forward -42 -32 5.09279 0.243
NP_440202.1_8 Reverse -352 -371 10.9735 0.284
NP_440289.1_1 Forward -119 -102 17.0922 0.229
NP_441554.1_4 Forward -101 -87 15.3667 0.22
NP_440260.1_8 Forward -385 -367 -5.38906 0.273
NP_440260.1_8 Reverse -229 -247 -5.38906 0.273
NP_440260.1_8 Reverse -228 -246 -6.66736 0.294
NP_441678.1_9 Reverse -195 -214 0.0977854 0.225
NP_442281.1_1 Reverse -240 -254 3.44058 0.231
NP_441079.1_7 Forward -64 -45 -1.27961 0.201
NP_441079.1_7 Forward -63 -44 -6.19614 0.273
NP_001035871.2_7 Reverse -377 -387 12.0747 0.272
NP_439983.1_7 Forward -324 -306 11.3272 0.271
NP_440098.1_1 Forward -259 -240 20.4523 0.0724
NP_441644.1_6 Reverse -289 -299 6.66608 0.152
NP_442215.1_2 Forward -203 -187 -6.82463 0.28
NP_442177.1_5 Forward -362 -348 11.6026 0.22
NP_442029.1_1 Forward -317 -298 -19.9617 0.297
NP_442029.1_6 Forward -369 -350 7.07928 0.23
NP_442029.1_6 Forward -259 -240 2.85105 0.286
NP_440929.1_8 Forward -114 -105 2.94966 0.246
NP_442926.1_1 Forward -321 -302 -6.49039 0.29
NP_439922.1_3 Reverse -49 -68 11.4109 0.197
NP_441762.1_7 Reverse -359 -371 -5.66422 0.228
NP_442142.1_4 Reverse -303 -316 9.16348 0.101
NP_443009.1_5 Reverse -30 -41 4.08976 0.263
NP_443009.1_5 Reverse -288 -299 3.49977 0.292
NP_442301.1_2 Reverse -341 -360 3.44025 0.294
NP_440357.1_3 Forward -362 -343 4.52268 0.242
NP_440881.1_4 Forward -140 -121 1.76941 0.226
NP_440881.1_4 Forward -252 -233 0.491109 0.226
NP_440183.1_9 Reverse -308 -327 -13.8652 0.26
NP_440379.1_5 Forward -324 -305 1.0811 0.164
NP_441468.1_1 Reverse -106 -113 4.36568 0.237
NP_441015.1_10 Forward -371 -352 -4.72043 0.211
NP_441015.1_10 Forward -314 -295 -7.37537 0.266
NP_441015.1_10 Forward -83 -64 -9.83364 0.282
NP_441612.1_2 Forward -242 -232 8.83972 0.21
NP_441612.1_2 Forward -129 -119 7.29072 0.256
NP_442559.1_3 Reverse -364 -383 6.88262 0.297
NP_442808.1_1 Reverse -313 -323 2.04455 0.279
NP_442808.1_1 Forward -289 -279 1.5529 0.282
NP_441101.1_10 Reverse -307 -326 -2.85214 0.242
NP_442342.1_9 Reverse -342 -358 3.79511 0.258
NP_441518.1_3 Reverse -158 -177 -15.3402 0.291
NP_441518.1_3 Forward -124 -105 -15.8318 0.299
NP_441878.1_6 Forward -352 -342 2.43831 0.0379
NP_441878.1_6 Reverse -288 -298 -6.60814 0.193
NP_441878.1_6 Reverse -341 -351 -7.49312 0.231
NP_441520.1_9 Forward -126 -107 15.3391 0.161
NP_441590.1_4 Reverse -302 -321 3.04693 0.29
NP_442419.1_2 Reverse -301 -320 7.96426 0.144
NP_442192.1_7 Forward -324 -306 15.9488 0.229
NP_442183.1_1 Reverse -31 -45 5.21113 0.226
NP_442183.1_3 Reverse -353 -372 14.7483 0.243
NP_441407.1_4 Reverse -76 -95 7.07928 0.24
NP_442397.1_9 Reverse -289 -308 2.26107 0.28
NP_440356.1_1 Reverse -367 -386 12.585 0.25
NP_441574.1_1 Forward -327 -308 1.76941 0.172
NP_441574.1_1 Reverse -114 -133 -2.85214 0.233
NP_442347.1_2 Reverse -246 -255 5.99792 0.201
NP_442965.1_2 Forward -258 -239 -2.85214 0.255
NP_441037.1_4 Forward -353 -343 11.3134 0.156
NP_441633.1_3 Forward -300 -287 -5.19226 0.229
NP_441633.1_3 Reverse -358 -371 -5.38892 0.236
NP_440136.1_2 Reverse -290 -297 3.97235 0.288
NP_442590.1_9 Forward -361 -342 9.24257 0.23
NP_442590.1_9 Reverse -272 -291 4.71934 0.273
NP_442998.1_5 Forward -242 -232 14.1397 0.151
NP_442998.1_10 Reverse -170 -177 3.97235 0.297
NP_440899.1_1 Reverse -195 -214 5.87005 0.293
NP_440899.1_8 Reverse -234 -253 -10.522 0.28
NP_441799.1_1 Reverse -356 -370 4.32555 0.255
NP_442756.1_2 Reverse -265 -284 5.211 0.272
NP_440915.1_6 Forward -258 -244 2.65453 0.113
NP_440733.1_2 Forward -62 -44 11.843 0.275
NP_441464.1_8 Reverse -342 -356 15.8309 0.0995
NP_441464.1_8 Reverse -312 -326 14.6509 0.115
NP_441464.1_8 Reverse -289 -303 5.50613 0.253
NP_441199.1_6 Reverse -305 -324 -1.7705 0.298
NP_439985.1_7 Forward -311 -292 5.01433 0.224
NP_441417.1_5 Forward -242 -223 9.3409 0.293
NP_442993.1_1 Reverse -225 -241 -13.5111 0.292
NP_442993.1_1 Forward -351 -335 -14.4944 0.3
NP_442386.1_5 Forward -146 -127 7.96345 0.184
NP_442386.1_9 Forward -115 -106 10.914 0.111
NP_442386.1_9 Reverse -350 -359 7.57079 0.219
NP_441404.1_7 Forward -177 -158 11.2092 0.197
NP_441750.1_1 Forward -84 -65 -12.9802 0.3
NP_441340.1_5 Forward -113 -106 4.07068 0.239
NP_440168.1_9 Forward -371 -352 -4.42544 0.296
NP_440327.1_6 Reverse -195 -214 2.94938 0.285
NP_440586.1_1 Forward -325 -306 -4.22878 0.278
NP_440586.1_8 Forward -113 -106 7.70858 0.227
NP_440586.1_8 Reverse -361 -368 5.64364 0.297
NP_440027.1_3 Reverse -350 -368 9.45814 0.184
NP_443051.1_1 Reverse -288 -297 -1.18024 0.297
NP_439996.1_9 Reverse -129 -148 12.0933 0.19
NP_440408.1_7 Reverse -374 -393 9.0459 0.265
NP_439943.1_1 Reverse -120 -139 -10.9153 0.29
NP_441789.1_7 Reverse -304 -323 -4.32786 0.28
NP_440819.1_5 Forward -242 -234 7.68924 0.266
NP_440819.1_5 Forward -67 -59 7.68924 0.266
NP_440316.1_10 Forward -316 -306 6.8632 0.251
NP_442488.1_4 Reverse -195 -214 12.7825 0.236
NP_439977.1_5 Forward -46 -27 0.294447 0.211
NP_440210.1_10 Reverse -59 -78 6.58682 0.296
NP_442384.1_10 Reverse -245 -258 3.85419 0.176
NP_440364.1_10 Forward -377 -358 20.8456 0.155
NP_441018.1_7 Forward -367 -348 12.3892 0.161
NP_442262.1_10 Forward -281 -274 8.20058 0.25
NP_440531.1_6 Reverse -97 -116 -1.18052 0.229
NP_441060.1_3 Forward -312 -293 13.1758 0.184
NP_439926.1_1 Forward -107 -88 13.0775 0.2
NP_441103.1_9 Reverse -235 -245 12.2942 0.299
NP_440700.1_8 Forward -253 -239 14.6509 0.232
NP_440894.1_10 Reverse -93 -112 9.43923 0.16
NP_440888.1_2 Reverse -245 -259 10.5204 0.0919
NP_440491.1_1 Forward -369 -350 8.37887 0.243
NP_440663.1_7 Forward -113 -94 16.3224 0.176
NP_440575.1_1 Reverse -54 -73 -3.44288 0.294
NP_441469.1_8 Reverse -104 -113 6.09625 0.236
NP_441469.1_8 Forward -115 -106 5.80125 0.253
NP_442337.1_6 Reverse -110 -129 14.5203 0.245
NP_442337.1_8 Reverse -94 -113 9.14423 0.171
NP_441462.1_2 Forward -351 -341 -0.806614 0.254
NP_441462.1_2 Forward -298 -288 -0.904945 0.265
NP_442204.1_5 Forward -379 -360 -0.197208 0.28
NP_441560.1_3 Forward -135 -117 8.7706 0.28
NP_442428.1_5 Reverse -106 -113 4.66067 0.244
NP_441443.1_1 Forward -324 -305 -3.83545 0.287
NP_440673.1_3 Reverse -17 -24 8.20058 0.234
NP_440673.1_7 Reverse -20 -39 1.86774 0.235
NP_440673.1_7 Reverse -356 -375 1.67108 0.242
NP_441052.1_2 Reverse -245 -255 2.92996 0.187
NP_442219.1_8 Reverse -164 -183 7.39404 0.267
NP_441884.1_9 Forward -372 -353 -22.3217 0.277
NP_440314.1_9 Forward -297 -278 -8.94866 0.257
NP_441004.1_1 Forward -321 -302 -7.08038 0.194
NP_441004.1_1 Forward -84 -65 -14.7502 0.27
NP_441004.1_1 Forward -258 -239 -15.5368 0.275
NP_441004.1_1 Forward -381 -362 -17.7001 0.294
NP_441004.1_1 Forward -363 -344 -18.1918 0.298
NP_442813.1_4 Forward -377 -358 -7.67036 0.299
NP_442813.1_4 Forward -378 -359 -9.14533 0.299
NP_442873.1_5 Forward -260 -241 13.9616 0.179
NP_440296.1_10 Forward -372 -353 -13.6686 0.269
NP_441115.1_4 Reverse -359 -377 10.7364 0.168
NP_442206.1_1 Reverse -342 -361 -10.227 0.219
NP_441851.1_10 Reverse -288 -298 6.17489 0.182
NP_441851.1_10 Reverse -30 -40 4.79825 0.247
NP_442622.1_5 Reverse -343 -362 4.32602 0.0957
NP_440611.1_6 Reverse -298 -317 13.2741 0.127
NP_441982.1_8 Forward -133 -119 18.8817 0.106
NP_441409.1_3 Forward -191 -172 9.14423 0.226
NP_442843.1_1 Reverse -106 -125 -7.67036 0.25
NP_442843.1_1 Forward -368 -349 -9.63698 0.267
NP_440431.1_3 Forward -105 -86 -9.93197 0.264
NP_442168.1_5 Reverse -290 -309 -0.0988766 0.261
NP_442006.1_2 Forward -315 -298 -13.0392 0.197
NP_442006.1_2 Forward -93 -76 -17.9557 0.285
NP_440483.1_1 Forward -358 -339 -4.52377 0.219
NP_441078.1_4 Forward -351 -342 6.29291 0.079
NP_441078.1_4 Reverse -342 -351 -1.6719 0.266
NP_442729.1_8 Reverse -27 -40 5.82081 0.228
NP_440707.1_9 Forward -314 -295 4.52268 0.255
NP_442443.1_1 Forward -311 -292 -3.73712 0.267
NP_443024.1_2 Forward -291 -278 16.8333 0.167
NP_441732.1_2 Forward -133 -117 -16.3627 0.165
NP_441732.1_2 Reverse -338 -354 -16.6577 0.186
NP_442540.1_8 Reverse -303 -322 13.6675 0.279
NP_442797.1_6 Reverse -227 -246 7.44938 0.289
NP_442797.1_7 Reverse -305 -323 0.412472 0.274
NP_442353.1_4 Forward -30 -11 0.490334 0.268
NP_442968.1_8 Forward -269 -250 11.3075 0.298
NP_442489.1_7 Forward -351 -342 -1.47524 0.203
NP_442489.1_7 Reverse -289 -298 -1.57357 0.213
NP_441830.1_2 Forward -368 -349 -5.80207 0.294
NP_440559.1_1 Forward -297 -288 4.52295 0.26
NP_442913.1_10 Forward -360 -341 -4.6221 0.242
NP_442008.1_2 Reverse -242 -261 7.07928 0.216
NP_440779.1_5 Reverse -360 -377 -5.76269 0.152
NP_442346.1_5 Forward -352 -342 9.61647 0.118
NP_442346.1_10 Forward -362 -343 -3.3438 0.294
NP_440545.1_3 Forward -355 -338 -6.451 0.28
NP_441744.1_6 Forward -372 -353 18.05 0.21
NP_440486.1_6 Forward -322 -303 8.45592 0.242
NP_440459.1_2 Reverse -96 -113 7.41366 0.291
NP_441653.1_3 Forward -381 -367 16.7159 0.213
NP_440010.1_3 Forward -381 -362 3.83436 0.175
NP_442796.1_10 Forward -81 -62 9.83255 0.249
NP_441915.1_2 Forward -360 -341 14.8474 0.292
NP_442140.1_3 Reverse -106 -116 6.66654 0.159
NP_442140.1_3 Forward -113 -103 3.91327 0.271
NP_441671.1_10 Forward -326 -307 4.71934 0.219
NP_442089.1_6 Reverse -120 -139 4.42435 0.262
NP_442497.1_10 Forward -297 -288 0.589713 0.153
NP_441239.1_9 Forward -392 -380 4.66053 0.248
NP_441239.1_9 Reverse -312 -324 3.38223 0.285
NP_441239.1_9 Reverse -349 -361 3.18557 0.292
NP_441951.1_9 Forward -214 -195 1.57275 0.254
NP_442193.1_1 Forward -321 -303 7.98396 0.277
NP_442809.1_6 Forward -253 -234 5.01433 0.256
NP_440546.1_4 Reverse -221 -231 7.42815 0.241
NP_440546.1_7 Reverse -250 -260 14.238 0.279
NP_440675.1_1 Forward -369 -350 4.916 0.23
NP_440675.1_1 Forward -324 -305 4.916 0.23
NP_442340.1_3 Reverse -344 -363 -6.1954 0.223
NP_440868.1_8 Forward -373 -354 -5.50708 0.288
NP_441474.1_1 Reverse -296 -315 -1.77127 0.264
NP_442402.1_4 Reverse -237 -256 -9.24438 0.287
NP_442402.1_9 Reverse -278 -297 9.53756 0.277
NP_440696.1_3 Forward -369 -351 4.83737 0.198
NP_440696.1_3 Reverse -95 -113 1.49411 0.217
NP_442039.1_7 Reverse -107 -117 7.94484 0.269
NP_442679.1_1 Forward -100 -81 -4.03212 0.269
NP_440160.1_2 Forward -41 -22 -6.58872 0.283
NP_440505.1_3 Forward -308 -298 7.25653 0.16
NP_441252.1_6 Forward -301 -294 14.1004 0.25
NP_442533.1_1 Forward -257 -238 -12.8819 0.236
NP_442533.1_1 Forward -369 -350 -13.4719 0.237
NP_442533.1_6 Reverse -342 -351 5.70292 0.132
NP_442533.1_6 Reverse -245 -254 4.0313 0.194
NP_442541.1_10 Reverse -350 -364 4.03056 0.252
NP_441219.1_6 Forward -178 -160 13.1955 0.178
NP_441028.1_6 Reverse -235 -245 12.6642 0.183
NP_441028.1_6 Reverse -234 -244 5.38779 0.255
NP_441028.1_6 Reverse -122 -132 3.71617 0.281
NP_441527.1_4 Forward -154 -135 -7.78302 0.237
NP_441527.1_4 Forward -64 -45 -9.50187 0.259
NP_439965.1_1 Forward -263 -244 -6.49039 0.214
NP_441680.1_4 Reverse -358 -377 1.47442 0.246
NP_442588.1_1 Forward -372 -353 12.9791 0.145
NP_442674.1_2 Forward -336 -317 14.1591 0.199
NP_440670.1_8 Reverse -289 -298 3.63797 0.239
NP_441479.1_9 Forward -312 -294 16.9321 0.23
NP_441705.1_3 Forward -177 -158 -6.1954 0.291
NP_440828.1_4 Reverse -341 -360 -6.19614 0.267
NP_440404.1_9 Forward -164 -145 7.59119 0.279
NP_441399.1_10 Forward -366 -347 16.3224 0.209
NP_441427.1_6 Reverse -92 -110 7.09898 0.297
NP_440223.1_7 Forward -246 -232 13.8643 0.218
NP_440028.1_6 Forward -83 -65 10.3439 0.282
NP_442022.1_9 Forward -372 -353 19.0757 0.0705
NP_442264.1_2 Forward -325 -308 4.75873 0.293
NP_441021.1_1 Reverse -343 -362 -12.5869 0.291
NP_442209.1_6 Reverse -239 -258 15.3391 0.185
NP_440387.1_1 Reverse -342 -358 1.82849 0.0943
NP_440387.1_1 Reverse -289 -305 -4.1697 0.178
NP_441431.1_3 Forward -321 -302 4.62101 0.263
NP_441993.1_1 Forward -321 -302 5.55261 0.2
NP_441993.1_1 Forward -363 -344 5.26024 0.205
NP_442437.1_8 Reverse -106 -125 5.40766 0.252
NP_442698.1_10 Forward -76 -57 5.89931 0.233
NP_442698.1_10 Forward -181 -162 2.16274 0.284
NP_442323.1_7 Forward -389 -370 1.76863 0.278
NP_441500.1_8 Forward -104 -90 15.3062 0.264
NP_439988.1_3 Forward -286 -272 4.71948 0.292
NP_439988.1_3 Forward -356 -342 3.8345 0.298
NP_442867.1_8 Reverse -97 -116 7.57094 0.242
NP_442867.1_8 Forward -214 -195 3.93269 0.295
NP_440457.1_1 Forward -309 -297 -0.74767 0.273
NP_440142.1_7 Reverse -375 -394 11.8975 0.2
NP_440142.1_7 Forward -297 -278 8.65258 0.232
NP_441984.1_10 Reverse -103 -117 19.2725 0.296
NP_441332.1_6 Reverse -350 -360 11.2595 0.261
NP_442509.1_5 Reverse -344 -361 13.3128 0.265
NP_442509.1_9 Forward -239 -229 6.56775 0.263
NP_442514.1_5 Reverse -237 -256 2.06362 0.172
NP_442862.1_3 Forward -217 -200 6.92201 0.263
NP_440628.1_3 Forward -162 -148 15.6342 0.262
NP_441428.1_8 Reverse -343 -362 4.62101 0.237
NP_439962.1_4 Reverse -343 -362 -3.04881 0.245
NP_439962.1_4 Forward -323 -304 -8.85033 0.298
NP_442495.1_5 Forward -309 -290 6.68596 0.291
NP_441105.1_3 Reverse -239 -258 -8.55534 0.274
NP_440216.1_9 Forward -245 -236 5.99792 0.289
NP_441226.1_7 Forward -113 -106 11.2485 0.0971
NP_440198.1_2 Forward -143 -124 16.464 0.206
NP_441111.1_7 Forward -297 -289 -0.570565 0.233
NP_442969.1_4 Reverse -34 -53 6.88262 0.274
NP_440416.1_9 Reverse -238 -257 -10.4236 0.141
NP_440416.1_9 Forward -261 -242 -12.1936 0.155
NP_443052.1_9 Reverse -65 -84 -3.93378 0.253
NP_443052.1_9 Reverse -239 -258 -6.98204 0.291
NP_440072.1_5 Forward -315 -297 14.0805 0.229
NP_440591.1_9 Forward -322 -304 5.72234 0.237
NP_442154.1_1 Forward -371 -353 1.10079 0.0962
NP_442154.1_1 Forward -314 -296 -7.84733 0.148
NP_442154.1_1 Forward -323 -305 -13.4522 0.217
NP_442154.1_1 Forward -359 -341 -18.5654 0.282
NP_440261.1_5 Reverse -343 -356 -12.0754 0.27
NP_440261.1_5 Forward -297 -284 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTCTTCAGTCCCCTAGCCCTTTTCCTAGCGGTGTTGGCTGGCATGGGGGCTACGGCCTTTATTAGCTATAAATTGGGGGATGCGGCCCTGGAGGGGGTTGTGCAACCGCCCAGTAACCCCATGGAGCAGTTCATTATTCCGCCTGGGGATGAGCCAGGGGAAAAACCCACAGATGGGTCGGAATCCGGTGCCAAGTTTGAGCCCGTCAATATTCAACAGGTGGCGAAAGAAACTAGGGCATATATTAAGAAACAACAGAAACTACCCAAGGGGGAAACCAACTCTGCCAACGCAGACCAGGGACAAGAAAAGTCTGAAGTGGAGACGGAGACGGAAAAAAAGTCTTAGATTCTAATGCTGCAAGCCCCCTAGTCAGCGACGAAAATCAAGGGGTCTTG

CDS

ATGCGGGTAGAGAATATTACCCAAGATCGCCGTACACTGCAGTTGGCGGTGAGCTTACAAAATAATGGCTCGGAGGAAGTGGAGTTTTTGTATAGTTTTTTGGAAGTCAGGGACCAGGATAATAATTTATTGAGTTCCTTTACTGATTCTTTGCCTCCTTCCTTACCCGGCGATCGCCAAGCGTATAAAGGCACCATCGAGTTATTTGGCCCGCTGCCGGATTCGGTGCGCAGTGTGTCGATCCGTTTAGCCAGCTATCCCGACGAAAAGGTTAAATTACAGATTGATGCCATTCCCATTCCTTAG

Protein

MRVENITQDRRTLQLAVSLQNNGSEEVEFLYSFLEVRDQDNNLLSSFTDSLPPSLPGDRQAYKGTIELFGPLPDSVRSVSIRLASYPDEKVKLQIDAIPIP