Your browser is old and dusty. Try Google Chrome!

Details for slr0260

ORF slr0260
Accession NP_441256.1
Symbol cobO
Category Cobalamin, heme, phycobilin and porphyrin
Definition cob(I)alamin adenosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -383 -369 2.06454 0.179
NP_441061.1_2 Forward -362 -348 -0.000409212 0.219
NP_440795.1_7 Forward -377 -370 10.8555 0.132
NP_441418.1_6 Reverse -354 -373 -19.3717 0.0876
NP_441418.1_6 Reverse -369 -388 -30.3848 0.274
NP_442291.1_5 Reverse -76 -92 4.68009 0.0869
NP_442151.1_6 Forward -378 -364 7.07942 0.211
NP_442151.1_6 Forward -384 -370 5.01447 0.298
NP_441818.1_1 Forward -377 -366 12.9395 0.0946
NP_440226.1_1 Reverse -369 -388 2.0644 0.278
NP_440226.1_1 Reverse -291 -310 1.67108 0.295
NP_440996.1_3 Reverse -182 -200 8.67227 0.296
NP_442173.1_1 Forward -362 -354 6.01761 0.2
NP_442752.1_4 Reverse -369 -376 10.5605 0.1
NP_442752.1_4 Forward -86 -79 5.54565 0.194
NP_443027.1_4 Forward -88 -78 7.35486 0.24
NP_443027.1_4 Reverse -72 -82 7.25653 0.24
NP_442975.1_10 Reverse -73 -87 13.1753 0.0459
NP_442909.1_7 Forward -383 -369 8.3571 0.182
NP_441250.1_3 Reverse -172 -191 3.14605 0.266
NP_440061.1_9 Forward -380 -366 6.48882 0.244
NP_441476.1_5 Forward -383 -364 1.67108 0.188
NP_440878.1_4 Reverse -227 -245 13.2938 0.266
NP_442062.1_3 Reverse -52 -71 4.12936 0.198
NP_441859.1_3 Reverse -73 -92 4.22689 0.228
NP_440304.1_4 Forward -342 -332 4.0116 0.281
NP_440304.1_4 Reverse -352 -362 3.42162 0.299
NP_441781.1_7 Forward -363 -344 2.55606 0.206
NP_441781.1_7 Forward -378 -359 -2.85214 0.289
NP_441581.1_9 Forward -293 -274 5.0129 0.296
NP_440370.1_10 Reverse -255 -274 11.6025 0.181
NP_440769.1_8 Reverse -121 -140 14.3558 0.15
NP_440856.1_7 Forward -378 -359 -7.27704 0.249
NP_441083.1_5 Forward -378 -368 6.96153 0.0717
NP_441083.1_5 Reverse -77 -87 -0.806614 0.28
NP_442889.1_10 Forward -192 -173 10.6234 0.274
NP_440056.1_9 Forward -27 -8 13.9702 0.277
NP_440178.1_7 Reverse -347 -366 -22.2233 0.258
NP_441716.1_2 Forward -74 -55 10.1506 0.214
NP_441387.1_8 Forward -191 -172 14.5621 0.235
NP_440438.2_8 Forward -24 -5 0.687771 0.289
NP_440747.1_10 Forward -381 -369 -12.0557 0.199
NP_440057.1_6 Reverse -121 -140 13.9547 0.262
NP_442848.1_1 Reverse -363 -377 6.09611 0.0803
NP_441077.1_6 Reverse -45 -61 20.4443 0.0411
NP_441077.1_6 Reverse -1 -17 2.80187 0.276
NP_442485.1_3 Reverse -63 -82 -2.65548 0.264
NP_440781.1_7 Forward -237 -219 20.4373 0.247
NP_442658.1_1 Reverse -346 -356 9.02601 0.169
NP_440184.1_1 Reverse -52 -71 1.82342 0.261
NP_442937.1_5 Reverse -364 -383 9.53756 0.187
NP_442321.1_1 Forward -359 -340 3.24438 0.126
NP_440450.1_1 Reverse -374 -393 14.6508 0.026
NP_442486.1_6 Forward -384 -365 0.687771 0.266
NP_442816.1_7 Reverse -275 -294 3.867 0.287
NP_442690.1_1 Reverse -11 -30 -0.197208 0.126
NP_442690.1_1 Forward -141 -122 -1.47551 0.128
NP_442690.1_1 Forward -32 -13 -15.8318 0.28
NP_442911.1_2 Forward -373 -354 -10.3253 0.276
NP_440153.1_5 Forward -377 -363 0.88457 0.288
NP_440993.1_4 Forward -357 -340 5.25038 0.263
NP_441099.1_5 Forward -388 -369 -7.27704 0.172
NP_442002.1_1 Reverse -296 -314 -7.65067 0.251
NP_442438.1_10 Forward -368 -354 -0.590395 0.269
NP_442431.1_10 Forward -368 -350 5.62401 0.197
NP_442431.1_10 Reverse -363 -381 4.24738 0.206
NP_441674.1_6 Reverse -349 -368 2.55606 0.275
NP_441550.1_8 Forward -85 -75 4.99446 0.274
NP_441041.1_4 Reverse -264 -283 -6.1954 0.164
NP_441041.1_4 Reverse -363 -382 -12.4886 0.266
NP_441041.1_7 Forward -366 -354 7.51478 0.162
NP_440569.1_10 Forward -30 -11 9.97848 0.229
NP_442004.1_6 Forward -378 -364 12.4876 0.104
NP_442941.1_3 Forward -377 -367 6.17489 0.0982
NP_442281.1_1 Reverse -343 -357 4.71887 0.184
NP_442281.1_1 Reverse -349 -363 1.67063 0.293
NP_441556.1_4 Reverse -354 -373 11.5476 0.247
NP_441644.1_6 Reverse -375 -385 7.0594 0.137
NP_442215.1_2 Forward -359 -343 0.255197 0.154
NP_442215.1_2 Forward -365 -349 -3.77637 0.222
NP_442933.1_6 Forward -137 -118 12.5568 0.287
NP_442970.1_1 Reverse -15 -29 11.3752 0.269
NP_442142.1_4 Forward -381 -368 4.34528 0.223
NP_442292.1_1 Forward -377 -368 -0.590259 0.258
NP_442476.1_6 Forward -377 -363 0.196253 0.269
NP_443009.1_5 Forward -84 -73 10.9729 0.0699
NP_440405.1_3 Reverse -125 -144 11.6809 0.293
NP_440183.1_9 Reverse -334 -353 -13.7669 0.26
NP_440379.1_5 Forward -360 -341 -9.34199 0.263
NP_441015.1_10 Reverse -364 -383 -3.14714 0.185
NP_441426.1_3 Reverse -341 -360 9.83173 0.257
NP_441826.1_2 Forward -390 -376 2.16287 0.134
NP_441826.1_2 Reverse -363 -377 0.589577 0.18
NP_441826.1_2 Forward -89 -75 -3.24533 0.284
NP_442868.1_6 Reverse -367 -377 4.69992 0.169
NP_442719.1_2 Forward -29 -11 -5.68475 0.22
NP_442427.1_3 Forward -278 -260 5.91901 0.171
NP_442808.1_1 Reverse -76 -86 4.99446 0.178
NP_442692.1_1 Forward -388 -369 -5.01543 0.274
NP_441114.1_3 Forward -355 -346 14.5527 0.193
NP_442789.1_4 Reverse -364 -383 -8.45701 0.299
NP_441878.1_6 Reverse -347 -357 -7.39479 0.222
NP_442419.1_2 Reverse -364 -383 -4.81876 0.293
NP_441308.1_8 Reverse -75 -85 10.9931 0.22
NP_441308.1_8 Reverse -367 -377 8.53483 0.254
NP_441308.1_8 Reverse -262 -272 8.33817 0.261
NP_442183.1_1 Reverse -369 -383 3.8345 0.295
NP_442397.1_9 Forward -363 -344 3.44104 0.264
NP_441819.1_5 Reverse -119 -138 9.7875 0.261
NP_441819.1_5 Forward -140 -121 9.11906 0.275
NP_442444.1_9 Reverse -127 -146 16.0274 0.1
NP_441238.1_10 Reverse -231 -245 11.2093 0.292
NP_442347.1_2 Reverse -78 -87 9.4395 0.0691
NP_442347.1_2 Reverse -370 -379 8.55452 0.0849
NP_442347.1_2 Forward -395 -386 5.70292 0.226
NP_442347.1_10 Forward -320 -306 16.4202 0.183
NP_442645.1_2 Forward -380 -361 -17.6018 0.259
NP_442047.1_2 Forward -257 -243 14.3559 0.19
NP_441633.1_3 Reverse -72 -85 -4.60227 0.205
NP_442764.1_8 Forward -307 -288 9.24257 0.171
NP_440136.1_2 Forward -377 -370 3.97235 0.288
NP_442998.1_5 Reverse -43 -53 12.1731 0.176
NP_441007.1_5 Forward -356 -337 12.6841 0.203
NP_442860.1_7 Forward -32 -14 7.93358 0.283
NP_441704.1_8 Reverse -358 -377 12.0933 0.122
NP_442866.1_1 Forward -362 -343 -8.45701 0.279
NP_440748.1_5 Reverse -350 -369 15.4374 0.0942
NP_441939.1_3 Forward -377 -358 7.86593 0.188
NP_441199.1_10 Forward -131 -113 10.3151 0.3
NP_440677.1_1 Forward -372 -353 8.75091 0.203
NP_442386.1_9 Forward -379 -370 4.7192 0.289
NP_441340.1_9 Reverse -128 -138 16.8354 0.194
NP_442484.1_2 Forward -389 -370 0.196116 0.25
NP_440586.1_8 Reverse -75 -82 5.64364 0.297
NP_440027.1_3 Forward -378 -360 1.69003 0.299
NP_439996.1_2 Forward -371 -352 10.5209 0.123
NP_439996.1_2 Reverse -355 -374 10.1275 0.123
NP_439996.1_6 Forward -358 -339 8.30201 0.253
NP_442239.1_8 Forward -366 -347 12.5858 0.238
NP_439943.1_4 Reverse -176 -195 7.37428 0.265
NP_441138.1_5 Reverse -276 -289 10.9479 0.227
NP_440574.1_3 Forward -395 -376 9.0459 0.156
NP_442511.1_10 Reverse -167 -186 18.4848 0.0931
NP_441803.1_2 Forward -383 -364 20.059 0.0228
NP_440267.1_2 Forward -278 -264 6.88214 0.219
NP_442384.1_10 Reverse -369 -382 2.77255 0.213
NP_442244.1_6 Forward -363 -344 2.16274 0.291
NP_440344.1_10 Forward -385 -368 -8.31929 0.125
NP_441965.1_3 Reverse -359 -378 -1.18052 0.28
NP_441965.1_10 Reverse -366 -382 8.02334 0.135
NP_440350.1_5 Reverse -274 -293 -7.27704 0.299
NP_441679.1_6 Reverse -364 -383 2.16274 0.243
NP_441679.1_6 Reverse -72 -91 -1.08219 0.273
NP_440999.1_9 Reverse -73 -87 -3.24533 0.289
NP_440888.1_2 Forward -378 -364 5.99717 0.254
NP_441543.1_2 Forward -377 -368 4.12963 0.279
NP_442845.1_2 Forward -384 -370 6.6861 0.205
NP_442845.1_8 Reverse -378 -397 12.8808 0.291
NP_440380.1_1 Reverse -348 -367 -10.522 0.284
NP_441178.1_6 Reverse -338 -357 2.6536 0.27
NP_441918.1_7 Forward -87 -68 2.55606 0.265
NP_441918.1_7 Reverse -260 -279 -2.45882 0.297
NP_442710.1_7 Forward -65 -46 -3.57057 0.263
NP_443064.1_6 Forward -378 -368 13.1486 0.0796
NP_442337.1_7 Reverse -282 -300 15.0638 0.214
NP_440148.1_1 Forward -94 -75 -4.72043 0.222
NP_443062.1_1 Reverse -279 -297 3.67056 0.289
NP_440454.1_2 Forward -289 -275 15.3858 0.18
NP_440516.1_8 Reverse -369 -378 -0.68859 0.297
NP_442428.1_5 Reverse -370 -377 9.57722 0.0852
NP_442120.1_10 Reverse -348 -367 -6.09707 0.203
NP_441052.1_2 Forward -378 -368 8.04317 0.0533
NP_441052.1_2 Reverse -369 -379 6.07655 0.0943
NP_441052.1_2 Reverse -77 -87 6.07655 0.0943
NP_442219.1_9 Reverse -370 -379 12.1928 0.0455
NP_442219.1_9 Reverse -78 -87 1.86802 0.295
NP_440436.1_4 Forward -356 -347 6.48915 0.157
NP_440314.1_1 Forward -35 -16 10.9142 0.219
NP_442907.1_2 Reverse -349 -367 8.27895 0.271
NP_442366.1_3 Forward -364 -346 2.28076 0.132
NP_442873.1_3 Forward -373 -354 16.5182 0.0822
NP_440296.1_6 Forward -121 -103 11.843 0.295
NP_442694.1_4 Reverse -270 -279 10.8161 0.294
NP_442694.1_9 Reverse -221 -240 20.354 0.115
YP_003858593.1_4 Reverse -46 -65 21.9273 0.0568
NP_442515.1_1 Reverse -347 -361 -4.13031 0.298
NP_442689.1_8 Reverse -15 -32 -1.0428 0.206
NP_442689.1_8 Forward -137 -120 -1.63279 0.22
NP_442689.1_8 Forward -28 -11 -3.40274 0.251
NP_440940.1_7 Reverse -67 -85 3.36165 0.274
NP_441409.1_6 Reverse -258 -277 -11.2103 0.216
NP_442237.1_2 Forward -175 -156 17.9979 0.193
NP_440195.1_5 Forward -363 -344 5.70265 0.232
NP_442243.1_1 Reverse -32 -50 -2.73484 0.295
NP_440078.1_10 Forward -86 -67 3.14605 0.269
NP_441333.1_2 Forward -134 -121 16.6774 0.279
NP_441732.1_2 Reverse -344 -360 -16.3627 0.165
NP_441732.1_2 Forward -382 -366 -16.6577 0.186
NP_442815.1_2 Reverse -367 -385 6.214 0.212
NP_440760.1_1 Forward -378 -359 -18.6834 0.216
NP_440199.1_10 Reverse -161 -171 15.9097 0.0861
NP_441057.1_4 Forward -358 -340 -3.22577 0.286
NP_442400.1_10 Forward -237 -224 8.65605 0.278
NP_440713.1_4 Reverse -359 -378 7.7676 0.174
NP_440757.1_7 Reverse -361 -379 -1.75081 0.275
NP_440386.1_3 Forward -31 -12 -5.60541 0.257
NP_442749.1_5 Forward -85 -68 7.93447 0.255
NP_441022.1_1 Reverse -22 -31 12.6973 0.232
NP_440363.1_9 Forward -365 -347 13.7855 0.249
NP_442008.1_9 Forward -135 -116 9.11906 0.249
NP_440335.1_9 Forward -291 -273 9.55725 0.294
NP_440352.1_5 Forward -196 -177 10.0276 0.287
NP_440010.1_4 Forward -382 -363 2.16195 0.227
NP_442551.1_4 Forward -359 -344 -2.8717 0.276
NP_442603.1_7 Reverse -369 -383 6.39049 0.245
NP_441585.1_5 Reverse -341 -360 3.14526 0.256
NP_443040.1_1 Reverse -110 -124 10.0873 0.291
NP_441329.1_3 Reverse -125 -135 15.8708 0.231
NP_441329.1_6 Reverse -99 -118 4.82192 0.198
NP_441329.1_6 Reverse -103 -122 -2.14899 0.293
NP_440912.1_3 Forward -388 -369 8.75009 0.271
NP_441973.1_6 Forward -28 -10 14.6105 0.287
NP_440830.1_3 Reverse -120 -139 13.0766 0.296
NP_442028.1_1 Forward -127 -114 8.27408 0.289
NP_439901.1_1 Reverse -340 -359 2.94938 0.269
NP_440590.1_4 Forward -377 -364 10.344 0.0283
NP_440590.1_4 Reverse -254 -267 -4.50394 0.262
NP_440821.1_4 Forward -380 -370 3.02829 0.131
NP_440624.1_5 Reverse -47 -65 6.89614 0.298
NP_441892.1_1 Reverse -339 -356 0.432165 0.168
NP_440665.1_1 Forward -375 -356 -3.73712 0.186
NP_442193.1_1 Forward -357 -339 11.6222 0.224
NP_442193.1_1 Reverse -270 -288 7.98396 0.277
NP_440740.1_2 Reverse -268 -287 14.8474 0.222
NP_442270.1_9 Reverse -358 -377 -5.31042 0.205
NP_441017.1_8 Forward -360 -345 14.1396 0.174
NP_440989.1_3 Forward -88 -69 16.5191 0.129
NP_441541.1_1 Reverse -116 -134 -4.8681 0.285
NP_441617.1_6 Forward -29 -10 2.45773 0.2
NP_442138.1_10 Reverse -77 -96 -7.96535 0.296
NP_442052.1_7 Reverse -364 -378 12.586 0.259
NP_442052.1_8 Reverse -346 -356 13.4514 0.253
NP_442899.1_4 Reverse -164 -180 6.84268 0.24
NP_442402.1_4 Reverse -81 -100 -8.45774 0.282
NP_442402.1_10 Forward -74 -64 11.9759 0.23
NP_441848.1_4 Reverse -13 -29 15.0945 0.154
NP_441848.1_4 Reverse -122 -138 8.88755 0.288
NP_441848.1_4 Forward -39 -23 8.69657 0.288
NP_441848.1_7 Forward -56 -37 -3.24622 0.28
NP_442039.1_7 Reverse -350 -360 14.1397 0.211
NP_442039.1_7 Forward -189 -179 11.8781 0.257
NP_441811.1_8 Reverse -363 -377 18.9775 0.0457
NP_442829.1_2 Reverse -131 -147 8.04446 0.287
NP_442837.1_3 Reverse -370 -377 10.1672 0.0935
NP_440805.1_4 Reverse -106 -125 9.50102 0.277
NP_440505.1_3 Forward -88 -78 4.60159 0.277
NP_441203.1_2 Forward -357 -338 0.982764 0.157
NP_442532.1_7 Reverse -348 -362 2.06454 0.254
NP_440914.1_1 Reverse -348 -358 10.6645 0.129
NP_440914.1_1 Forward -378 -368 9.00547 0.186
NP_440914.1_1 Reverse -375 -385 7.83437 0.219
NP_440914.1_1 Reverse -264 -274 7.15123 0.249
NP_440263.1_5 Reverse -223 -237 9.83269 0.294
NP_440263.1_5 Forward -27 -13 9.63603 0.294
NP_441326.1_2 Reverse -354 -373 10.7175 0.251
NP_441697.1_5 Reverse -46 -65 8.25963 0.142
NP_441697.1_5 Forward -237 -218 -8.92892 0.268
NP_441028.1_6 Forward -49 -39 15.2208 0.152
NP_441028.1_6 Reverse -78 -88 3.51951 0.292
NP_439945.1_2 Reverse -7 -24 12.6734 0.237
NP_441527.1_4 Reverse -103 -122 -12.1756 0.285
NP_440115.1_6 Reverse -366 -376 6.56821 0.178
NP_439965.1_1 Forward -387 -368 -1.08219 0.157
NP_441972.1_5 Forward -377 -358 4.52268 0.103
NP_441106.1_1 Reverse -263 -272 2.26134 0.293
NP_441286.1_1 Reverse -368 -380 0.727295 0.108
NP_441286.1_1 Forward -379 -367 -7.04085 0.3
NP_442674.1_3 Reverse -340 -359 5.01354 0.278
NP_441930.1_3 Forward -32 -13 4.21432 0.274
NP_440083.1_8 Forward -38 -19 8.45592 0.225
NP_441021.1_1 Forward -362 -343 -10.3253 0.234
NP_441463.1_3 Forward -382 -363 3.73603 0.0982
NP_441463.1_3 Forward -367 -348 -6.68705 0.247
NP_441463.1_3 Forward -388 -369 -9.63698 0.282
NP_442362.1_2 Reverse -16 -33 17.1484 0.263
NP_440107.1_5 Forward -379 -360 -0.688862 0.178
NP_442794.1_1 Reverse -344 -356 6.1355 0.192
NP_441962.1_4 Reverse -349 -368 -2.65548 0.135
NP_441962.1_4 Forward -377 -358 -13.2752 0.271
NP_441962.1_4 Forward -345 -326 -14.2585 0.285
NP_440387.1_1 Forward -86 -70 -4.66135 0.194
NP_440114.1_10 Reverse -264 -278 10.226 0.151
NP_440766.1_5 Forward -26 -14 7.36932 0.29
NP_441237.1_9 Forward -356 -346 10.0098 0.255
NP_442103.1_2 Forward -372 -354 15.7513 0.192
NP_442867.1_8 Forward -355 -336 7.37428 0.244
NP_442509.1_9 Reverse -77 -87 7.25606 0.229
NP_441489.1_3 Forward -135 -121 11.7571 0.211
NP_441489.1_3 Forward -189 -175 8.70139 0.232
NP_442737.1_5 Forward -391 -372 15.3029 0.166
NP_441885.1_5 Reverse -369 -379 -0.314959 0.195
NP_441885.1_5 Reverse -77 -87 -0.904945 0.241
NP_440478.1_9 Forward -380 -361 10.8159 0.255
NP_441466.1_3 Forward -393 -374 12.5858 0.105
NP_442341.1_7 Forward -87 -73 9.14437 0.0773
NP_442341.1_7 Forward -379 -365 7.66941 0.0994
NP_441173.1_9 Reverse -179 -187 13.2937 0.17
NP_441173.1_9 Reverse -17 -25 9.85212 0.275
NP_443059.1_10 Reverse -340 -359 4.42355 0.198
NP_439924.1_1 Forward -174 -155 14.7491 0.17
NP_442638.1_3 Reverse -7 -26 10.3605 0.298
NP_441122.1_1 Forward -361 -346 4.60145 0.28
NP_440149.1_8 Forward -378 -359 2.3594 0.111
NP_442507.1_9 Reverse -358 -376 12.1139 0.231
NP_442417.1_5 Forward -372 -358 6.88276 0.201
NP_442252.1_4 Reverse -294 -313 16.5191 0.221
NP_440416.1_9 Forward -379 -360 -21.4367 0.294
NP_442116.1_6 Reverse -121 -138 13.039 0.172
NP_442116.1_6 Reverse -13 -30 5.59067 0.293
NP_440261.1_5 Reverse -75 -88 -4.60227 0.158
NP_440988.1_2 Forward -313 -295 10.0489 0.255
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCGCTTGATACCAATTGTCATCGGGATCACCACCGCTGAGGTTGCCATTGTCCAGGTGGGGCATTCTCATTAATCTAACCACATGACCAAAACCCGTATCTCGGTCAGTTAAACCATCAAAAAAAATGCCATCCTCTTCTGATCCTGTTAGATCTGCCAGCAAAAGTTGCTCAGAATTATCTTGTTCAGAATCGAGATAATCATCACTACAATTGGCAAAATATTGATTGATATCCATTTTCATCTCTCCTCTATTGCTAGAAGTTTTTCTAAAATATTGATTTTTTAATCTATTGTTATCGTAAATAAAAATGGGGATCATCGCAGTTTTCACAACAAATTCTTAACATTTGTCCCCCGTAAGAGTTACAATTTTTGCAGAAATTCTTAACAGTTACC

CDS

ATGGTCAATTCCCTGTCCGACGAGCAGTACAAAATTAAGATGCAAAAGCGCAAAGCTTTACAGGATGAGCGCATTGCCTCTGCTAAGGCAGAGAAAGGTCTGGTAATTGTTCACACCGGCAACGGCAAAGGAAAAACCACCGCCGCCCTGGGCATGGTGTTGCGGTCCCTGGGTCATGGTTATCGGGTAGGAATTATTCAATTCATCAAAGGGGCCTGGGAACCGGCGGAAAAAGCGGCCTTTACCCCTTGGCAAGACCAATTAACTTTTTTGGCCCTGGGAGAAGGTTTTACCTGGGAAACTCAAGACCGGCAACGGGACCAGGCGATCGCCCATGCAGCGTGGCAAAAAGCCCTGGAGTATATCCGCAATCCCGATTACCAACTAGTCCTACTGGATGAGGTAAATGTGGCGTTAAAGCTGGGCTATCTGGACGTGGAAACAGTACTAGCCGGCCTGCAAGGGAAGCCGGAATCTAATCACGTTATTTTGACAGGCCGGGGAGCACCCCAACCATTGATTGACCGGGCCGATTTAGTCACAGAAATGACCCTGATCAAACATCCTTTCCGGGAGCAAAATGTTAAGGCCCAACCCGGCATTGAGTTTTAG

Protein

MVNSLSDEQYKIKMQKRKALQDERIASAKAEKGLVIVHTGNGKGKTTAALGMVLRSLGHGYRVGIIQFIKGAWEPAEKAAFTPWQDQLTFLALGEGFTWETQDRQRDQAIAHAAWQKALEYIRNPDYQLVLLDEVNVALKLGYLDVETVLAGLQGKPESNHVILTGRGAPQPLIDRADLVTEMTLIKHPFREQNVKAQPGIEF