Your browser is old and dusty. Try Google Chrome!

Details for slr0250

ORF slr0250
Accession NP_440036.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -346 -360 15.9292 0.0325
NP_441061.1_2 Reverse -196 -210 1.08123 0.195
NP_441061.1_2 Forward -353 -339 -0.590395 0.234
NP_441061.1_2 Reverse -216 -230 -1.27871 0.255
NP_440557.1_1 Reverse -346 -365 5.99764 0.153
NP_440795.1_7 Forward -353 -346 14.6904 0.0123
NP_440795.1_7 Reverse -346 -353 14.6904 0.0123
NP_441418.1_6 Reverse -345 -364 8.35759 0.00455
NP_441418.1_6 Forward -354 -335 -10.522 0.0362
NP_441418.1_6 Reverse -131 -150 -29.7948 0.238
NP_441418.1_6 Forward -363 -344 -30.0898 0.256
NP_441418.1_6 Forward -204 -185 -30.2865 0.267
NP_442291.1_5 Reverse -201 -217 -1.12144 0.192
NP_440897.1_6 Forward -354 -335 4.91521 0.128
NP_441453.1_1 Forward -361 -343 10.9331 0.124
NP_441453.1_4 Reverse -345 -353 16.539 0.00633
NP_441453.1_4 Forward -354 -346 16.539 0.00633
NP_441453.1_4 Forward -204 -196 6.70593 0.121
NP_441453.1_7 Reverse -155 -162 12.9205 0.23
NP_441453.1_7 Reverse -118 -125 12.9205 0.23
NP_441623.1_1 Reverse -138 -156 -4.99573 0.282
NP_442151.1_2 Reverse -356 -375 14.6508 0.259
NP_442151.1_6 Forward -354 -340 9.2427 0.155
NP_442838.1_7 Forward -209 -190 -11.0136 0.263
NP_443043.1_10 Forward -358 -339 4.52268 0.195
NP_441818.1_6 Forward -361 -347 9.04604 0.274
NP_440226.1_1 Reverse -345 -364 15.1424 0.0267
NP_440120.1_4 Reverse -32 -46 14.5526 0.273
NP_440150.1_6 Forward -357 -338 7.37428 0.223
NP_442287.1_1 Reverse -207 -217 16.3025 0.147
NP_442655.1_10 Forward -342 -323 -1.37718 0.182
NP_442173.1_1 Forward -353 -345 15.4574 0.00633
NP_442173.1_1 Reverse -346 -354 15.4574 0.00633
NP_442173.1_1 Reverse -196 -204 5.82095 0.2
NP_442173.1_1 Forward -84 -76 5.72262 0.203
NP_442752.1_4 Forward -354 -347 13.8055 0.0199
NP_442752.1_4 Reverse -345 -352 13.8055 0.0199
NP_442752.1_4 Forward -204 -197 13.8055 0.0199
NP_442752.1_4 Forward -140 -133 4.26735 0.293
NP_443027.1_4 Forward -356 -346 14.828 0.0437
NP_443027.1_4 Forward -206 -196 10.1081 0.144
NP_443027.1_4 Reverse -381 -391 7.15819 0.244
NP_443027.1_4 Reverse -343 -353 5.87989 0.294
NP_441812.1_3 Reverse -344 -358 13.2743 0.167
NP_442975.1_10 Reverse -341 -355 11.2087 0.0508
NP_441675.1_4 Forward -325 -306 4.62101 0.254
NP_440784.1_7 Forward -353 -346 15.9687 0.0123
NP_440784.1_7 Reverse -346 -353 15.9687 0.0123
NP_440784.1_7 Reverse -196 -203 6.23397 0.241
NP_440784.1_7 Forward -203 -196 6.13563 0.241
NP_440061.1_9 Reverse -200 -214 17.6002 0.0138
NP_441476.1_5 Forward -209 -190 -2.85214 0.231
NP_441476.1_5 Reverse -340 -359 -3.3438 0.235
NP_441476.1_5 Reverse -190 -209 -7.67036 0.29
NP_442062.1_8 Forward -354 -344 19.4496 0.000558
NP_442062.1_8 Reverse -345 -355 19.4496 0.000558
NP_442062.1_8 Forward -204 -194 7.45319 0.0985
NP_440761.1_3 Reverse -235 -254 9.01981 0.263
NP_440761.1_4 Reverse -71 -90 -14.8485 0.273
NP_441859.1_3 Forward -205 -186 10.0284 0.121
NP_441859.1_3 Reverse -344 -363 7.4718 0.157
NP_440304.1_4 Forward -356 -346 10.8948 0.051
NP_440304.1_4 Reverse -74 -84 3.71661 0.293
NP_440304.1_4 Reverse -343 -353 1.84832 0.299
NP_442242.1_4 Forward -353 -346 14.3954 0.0124
NP_442242.1_4 Reverse -346 -353 14.3954 0.0124
NP_442242.1_4 Forward -203 -196 12.4288 0.0393
NP_440916.1_1 Forward -45 -31 11.406 0.206
NP_442602.1_2 Reverse -201 -220 -2.0655 0.296
NP_439918.1_3 Reverse -342 -361 3.24438 0.266
NP_441208.1_9 Reverse -192 -206 6.98109 0.229
NP_441208.1_9 Reverse -342 -356 6.09611 0.253
NP_441594.1_6 Forward -363 -344 7.66927 0.17
NP_440370.1_10 Reverse -186 -205 15.6341 0.0802
NP_440370.1_10 Forward -363 -344 9.24257 0.231
NP_442276.1_2 Forward -216 -197 5.60432 0.291
NP_440132.1_1 Reverse -343 -361 11.5239 0.207
NP_440132.1_1 Forward -206 -188 9.16393 0.25
NP_442110.1_7 Forward -398 -384 3.24451 0.213
NP_442110.1_7 Reverse -345 -359 2.35953 0.222
NP_442110.1_7 Reverse -383 -397 1.76955 0.222
NP_442110.1_7 Forward -204 -190 1.37622 0.23
NP_441082.1_10 Reverse -118 -131 10.049 0.237
NP_441083.1_5 Forward -354 -344 11.3864 0.0159
NP_441083.1_5 Reverse -345 -355 11.3864 0.0159
NP_441083.1_5 Reverse -389 -399 5.19158 0.123
NP_441083.1_5 Forward -204 -194 -0.0199663 0.251
NP_441083.1_5 Forward -398 -388 -0.118297 0.256
NP_441083.1_5 Reverse -202 -212 -0.216628 0.261
NP_442827.1_8 Reverse -337 -356 1.76863 0.172
NP_441434.1_1 Reverse -242 -256 8.5104 0.254
NP_441434.1_7 Reverse -197 -211 3.24451 0.254
NP_441738.1_2 Forward -352 -345 15.28 0.0102
NP_441738.1_2 Reverse -347 -354 15.28 0.0102
NP_441738.1_2 Reverse -197 -204 15.28 0.0102
NP_441738.1_2 Reverse -307 -314 6.03696 0.295
NP_441558.1_5 Forward -356 -337 16.6174 0.0285
NP_441558.1_5 Forward -206 -187 6.68596 0.206
NP_441558.1_5 Forward -377 -358 3.83436 0.296
NP_440209.1_1 Reverse -345 -353 18.1123 0.00295
NP_440209.1_1 Forward -354 -346 18.1123 0.00295
NP_440209.1_1 Forward -204 -196 14.8674 0.012
NP_442136.1_4 Reverse -347 -366 9.24175 0.288
NP_442889.1_8 Forward -357 -343 4.12889 0.27
NP_440407.1_4 Forward -348 -329 18.879 0.0654
NP_441713.1_1 Forward -360 -341 -6.49039 0.12
NP_441770.1_4 Reverse -352 -371 -6.88371 0.228
NP_441716.1_1 Forward -354 -340 6.6861 0.191
NP_442111.1_4 Forward -355 -341 8.25939 0.0773
NP_442111.1_4 Forward -205 -191 1.67122 0.296
NP_441495.1_1 Forward -283 -264 13.7658 0.193
NP_440906.1_5 Forward -353 -346 15.8704 0.0124
NP_440906.1_5 Reverse -346 -353 15.8704 0.0124
NP_440906.1_5 Forward -203 -196 12.0355 0.0724
NP_440906.1_5 Reverse -196 -203 12.0355 0.0724
NP_440747.1_10 Forward -357 -345 7.70879 0.00236
NP_440747.1_10 Reverse -342 -354 5.44718 0.0137
NP_440747.1_10 Reverse -192 -204 -11.7607 0.142
NP_440747.1_10 Reverse -263 -275 -12.0557 0.199
NP_440747.1_10 Forward -214 -202 -12.1541 0.227
NP_441130.1_10 Forward -356 -342 12.3893 0.0957
NP_441130.1_10 Forward -206 -192 11.0127 0.107
NP_441854.1_10 Reverse -352 -371 10.2259 0.139
NP_441486.1_1 Reverse -342 -356 18.9775 0.00367
NP_441486.1_1 Forward -357 -343 12.4876 0.0116
NP_441486.1_1 Reverse -386 -400 -5.60527 0.248
NP_442634.1_2 Reverse -339 -358 8.55425 0.151
NP_442634.1_4 Reverse -74 -88 2.85119 0.126
NP_442634.1_4 Reverse -343 -357 -1.67204 0.149
NP_442634.1_4 Forward -206 -192 -5.31028 0.246
NP_441265.1_3 Reverse -189 -203 6.78443 0.181
NP_441014.1_8 Reverse -202 -221 -0.590531 0.218
NP_441014.1_10 Forward -399 -380 3.34192 0.215
NP_441014.1_10 Reverse -344 -363 2.45694 0.216
NP_442848.1_1 Reverse -383 -397 3.34284 0.136
NP_443018.1_3 Forward -353 -346 14.8871 0.0123
NP_443018.1_3 Reverse -346 -353 14.8871 0.0123
NP_443018.1_3 Reverse -384 -391 11.5438 0.0752
NP_443018.1_3 Forward -203 -196 5.34899 0.212
NP_443018.1_3 Reverse -196 -203 5.34899 0.212
NP_441316.1_7 Reverse -343 -358 -2.97003 0.273
NP_441634.1_3 Forward -175 -156 13.0775 0.242
NP_441634.1_8 Forward -356 -342 3.14618 0.155
NP_440376.1_1 Forward -354 -345 19.4693 0.000692
NP_440376.1_1 Reverse -345 -354 19.4693 0.000692
NP_440376.1_1 Reverse -266 -275 5.21127 0.144
NP_440376.1_1 Forward -375 -366 4.81794 0.149
NP_440376.1_1 Forward -218 -209 0.884706 0.259
NP_440376.1_1 Forward -204 -195 -0.000272808 0.285
NP_440376.1_1 Reverse -195 -204 -0.0986038 0.285
NP_441857.1_7 Forward -391 -381 17.6791 0.289
NP_441588.1_4 Forward -352 -342 7.25653 0.178
NP_441588.1_4 Reverse -197 -207 6.96153 0.178
NP_442687.1_7 Forward -355 -345 15.8113 0.0125
NP_442687.1_7 Reverse -344 -354 15.8113 0.0125
NP_442687.1_7 Forward -141 -131 10.6981 0.0994
NP_442687.1_7 Reverse -75 -85 5.5849 0.194
NP_442687.1_7 Forward -205 -195 5.19158 0.217
NP_442687.1_7 Reverse -365 -375 4.60159 0.243
NP_441797.1_7 Reverse -151 -169 10.4422 0.292
NP_442485.1_3 Forward -365 -346 5.11266 0.169
NP_442485.1_3 Reverse -340 -359 -3.24547 0.272
NP_442530.1_2 Forward -328 -318 12.3697 0.276
NP_441013.1_2 Reverse -372 -390 -4.60241 0.299
NP_441422.1_7 Reverse -343 -360 -3.00942 0.226
NP_441422.1_7 Forward -206 -189 -7.33598 0.258
NP_440533.1_9 Reverse -345 -364 10.4225 0.136
NP_441763.1_10 Forward -215 -196 6.29183 0.269
NP_442658.1_1 Reverse -343 -353 15.9091 0.00966
NP_442658.1_1 Forward -356 -346 15.9091 0.00966
NP_442658.1_1 Reverse -193 -203 12.4676 0.0546
NP_442658.1_1 Forward -206 -196 8.92768 0.172
NP_442782.1_2 Reverse -345 -359 3.93283 0.257
NP_441414.1_9 Forward -354 -335 -4.03212 0.145
NP_442300.1_5 Reverse -343 -362 11.5042 0.282
NP_442937.1_5 Reverse -340 -359 10.3242 0.165
NP_441958.1_5 Forward -355 -345 12.2714 0.00183
NP_441958.1_5 Reverse -344 -354 12.2714 0.00183
NP_441958.1_5 Reverse -194 -204 0.963343 0.12
NP_441958.1_5 Reverse -75 -85 -2.57657 0.28
NP_441958.1_5 Forward -205 -195 -6.41148 0.28
NP_440318.1_1 Reverse -124 -143 7.17762 0.21
NP_442836.1_10 Reverse -358 -368 14.6313 0.212
NP_442685.1_2 Forward -324 -314 17.0896 0.11
NP_443001.1_7 Forward -387 -368 3.04771 0.279
NP_440984.1_7 Reverse -197 -211 5.60446 0.248
NP_441097.1_2 Forward -124 -107 3.57876 0.293
NP_442376.1_2 Reverse -190 -209 -12.6852 0.286
NP_442911.1_2 Reverse -185 -204 12.6841 0.0124
NP_442911.1_2 Forward -364 -345 4.22769 0.0392
NP_442911.1_2 Forward -385 -366 0.786102 0.0644
NP_442911.1_2 Reverse -335 -354 -1.08219 0.0811
NP_442911.1_2 Reverse -295 -314 -6.98204 0.197
NP_440153.1_5 Reverse -196 -210 2.75286 0.219
NP_442119.1_9 Forward -355 -336 11.4058 0.245
NP_442064.1_4 Reverse -256 -275 6.39016 0.251
NP_442536.1_9 Reverse -180 -199 15.5357 0.289
NP_443055.1_6 Forward -225 -207 -1.55487 0.28
NP_440993.1_2 Forward -90 -74 10.0883 0.106
NP_440993.1_3 Reverse -185 -204 -0.787962 0.273
NP_441913.1_1 Reverse -232 -248 18.0796 0.246
NP_441099.1_5 Reverse -185 -204 3.34271 0.0515
NP_441099.1_5 Reverse -335 -354 -9.83364 0.234
NP_442002.1_1 Forward -124 -106 -1.45582 0.195
NP_442002.1_9 Reverse -75 -82 12.4288 0.185
NP_442002.1_9 Forward -355 -348 10.7572 0.185
NP_442002.1_9 Reverse -344 -351 10.7572 0.185
NP_442002.1_9 Forward -205 -198 10.7572 0.185
NP_440809.1_9 Reverse -336 -354 -7.35568 0.225
NP_440809.1_9 Forward -363 -345 -7.65067 0.225
NP_442013.1_1 Reverse -343 -362 9.63589 0.276
NP_441938.1_1 Reverse -343 -362 12.2908 0.167
NP_441294.1_7 Reverse -341 -355 10.2105 0.205
NP_441646.1_1 Reverse -260 -279 10.3242 0.117
NP_442438.1_10 Forward -359 -345 13.3726 0.0352
NP_442438.1_10 Forward -209 -195 8.16106 0.0812
NP_442438.1_10 Reverse -190 -204 2.35953 0.178
NP_442438.1_10 Reverse -340 -354 2.16287 0.185
NP_442438.1_10 Forward -145 -131 0.786239 0.213
NP_442231.1_5 Reverse -190 -209 16.1257 0.263
NP_441000.1_6 Forward -355 -341 4.22782 0.0964
NP_441000.1_6 Reverse -194 -208 -2.95034 0.221
NP_441000.1_6 Reverse -344 -358 -4.03198 0.225
NP_442771.1_1 Forward -206 -188 0.904127 0.0877
NP_442771.1_1 Reverse -193 -211 -0.374176 0.105
NP_442771.1_1 Reverse -343 -361 -4.99573 0.166
NP_440147.1_4 Reverse -343 -356 11.3273 0.0326
NP_440147.1_4 Forward -356 -343 2.18257 0.209
NP_441550.1_8 Reverse -343 -353 8.3377 0.124
NP_441550.1_8 Reverse -193 -203 7.45273 0.159
NP_441550.1_8 Forward -356 -346 6.0761 0.214
NP_441916.1_7 Forward -354 -344 18.4663 0.00144
NP_441916.1_7 Reverse -345 -355 18.4663 0.00144
NP_441041.1_4 Forward -354 -335 9.0459 0.0331
NP_441041.1_4 Reverse -345 -364 1.76941 0.0792
NP_441041.1_4 Forward -204 -185 -7.37537 0.186
NP_441041.1_4 Forward -398 -379 -11.9969 0.256
NP_441041.1_7 Reverse -192 -204 12.8595 0.0572
NP_441041.1_7 Reverse -342 -354 9.65268 0.108
NP_441041.1_7 Forward -357 -345 7.61196 0.162
NP_440016.1_9 Reverse -104 -123 10.9142 0.259
NP_442396.1_5 Forward -358 -345 6.80412 0.219
NP_442004.1_6 Reverse -345 -359 8.75105 0.14
NP_442004.1_6 Reverse -106 -120 5.01447 0.199
NP_442004.1_6 Forward -204 -190 4.71948 0.204
NP_442004.1_6 Forward -275 -261 2.35953 0.266
NP_440703.1_3 Forward -212 -193 15.6882 0.297
NP_441725.1_4 Reverse -378 -392 6.58715 0.271
NP_441725.1_5 Reverse -346 -356 11.2881 0.0247
NP_441725.1_5 Forward -203 -193 7.64985 0.0904
NP_441725.1_5 Forward -353 -343 2.04498 0.115
NP_441725.1_5 Reverse -267 -277 -0.511621 0.26
NP_441725.1_5 Reverse -196 -206 -0.708283 0.267
NP_441725.1_5 Reverse -367 -377 -0.806614 0.271
NP_439966.1_7 Forward -356 -346 18.4657 0.00473
NP_439966.1_7 Reverse -343 -353 9.91099 0.0968
NP_439966.1_7 Forward -206 -196 7.64939 0.15
NP_439966.1_7 Forward -394 -384 7.35439 0.15
NP_439966.1_9 Forward -206 -197 10.7178 0.0863
NP_439966.1_9 Forward -356 -347 0.983037 0.253
NP_439966.1_9 Reverse -343 -352 0.884706 0.253
NP_442941.1_3 Reverse -346 -356 11.4848 0.0116
NP_442941.1_3 Forward -353 -343 2.63497 0.14
NP_440289.1_2 Forward -357 -344 5.13249 0.0636
NP_440289.1_2 Forward -207 -194 3.46087 0.078
NP_440289.1_2 Reverse -342 -355 -3.52063 0.267
NP_440260.1_8 Forward -279 -261 -0.7675 0.221
NP_440260.1_8 Forward -363 -345 -2.83245 0.246
NP_441514.1_6 Reverse -33 -40 14.2971 0.248
NP_442281.1_1 Forward -359 -345 17.8952 0.00513
NP_442281.1_1 Forward -209 -195 6.0955 0.136
NP_442281.1_1 Reverse -361 -375 5.60385 0.152
NP_442281.1_1 Reverse -340 -354 3.73557 0.221
NP_441334.1_7 Reverse -193 -212 -20.945 0.284
NP_440177.1_1 Reverse -191 -209 2.87075 0.295
NP_440437.1_1 Reverse -339 -358 -5.99873 0.3
NP_442012.1_1 Forward -360 -341 11.1109 0.0769
NP_442288.1_3 Reverse -148 -165 6.62702 0.263
NP_441556.1_4 Forward -363 -344 11.5476 0.247
NP_441556.1_10 Reverse -340 -354 16.2567 0.117
NP_440498.1_1 Forward -363 -345 8.08229 0.0795
NP_443030.1_4 Forward -282 -263 2.85105 0.205
NP_441644.1_6 Forward -354 -344 10.1076 0.0628
NP_441644.1_6 Reverse -345 -355 10.1076 0.0628
NP_441644.1_6 Forward -204 -194 8.92768 0.0895
NP_441644.1_6 Reverse -202 -212 6.0761 0.167
NP_441644.1_6 Forward -398 -388 3.51951 0.277
NP_442215.1_2 Reverse -343 -359 3.59845 0.094
NP_442215.1_2 Forward -135 -119 -5.448 0.25
NP_442215.1_2 Forward -272 -256 -7.0213 0.284
NP_440253.1_2 Forward -354 -336 4.34571 0.104
NP_440929.1_8 Forward -354 -345 19.2726 0.000701
NP_440929.1_8 Reverse -345 -354 19.2726 0.000701
NP_440929.1_8 Reverse -195 -204 7.86621 0.0522
NP_440929.1_8 Forward -204 -195 7.57121 0.0706
NP_440929.1_8 Reverse -202 -211 5.50626 0.132
NP_440929.1_8 Forward -270 -261 3.53964 0.225
NP_442933.1_10 Forward -354 -345 17.601 0.00325
NP_442933.1_10 Reverse -345 -354 17.601 0.00325
NP_442933.1_10 Forward -204 -195 5.40793 0.19
NP_441751.2_8 Reverse -346 -360 5.60446 0.0419
NP_442926.1_5 Reverse -340 -359 14.4445 0.15
NP_442554.1_8 Reverse -346 -356 13.8447 0.0145
NP_442554.1_8 Forward -353 -343 13.2547 0.0187
NP_442554.1_8 Reverse -196 -206 6.27322 0.123
NP_442554.1_8 Forward -203 -193 4.10993 0.198
NP_442554.1_8 Reverse -384 -394 2.04498 0.285
NP_441762.1_7 Forward -355 -343 19.3118 0.00342
NP_441762.1_7 Reverse -344 -356 12.0354 0.0142
NP_441762.1_7 Reverse -194 -206 3.77555 0.0676
NP_441762.1_7 Forward -205 -193 -5.46756 0.212
NP_442142.1_4 Forward -357 -344 19.6848 0.0179
NP_442142.1_4 Reverse -192 -205 9.06515 0.103
NP_442142.1_4 Reverse -342 -355 7.2952 0.143
NP_442292.1_1 Forward -353 -344 9.63616 0.0183
NP_442292.1_1 Reverse -346 -355 9.63616 0.0183
NP_442292.1_1 Reverse -196 -205 -0.0986038 0.239
NP_442476.1_6 Reverse -346 -360 3.73617 0.154
NP_442476.1_6 Forward -203 -189 0.196253 0.269
NP_442381.1_8 Reverse -342 -361 -14.6519 0.284
NP_443009.1_5 Reverse -344 -355 11.6612 0.0602
NP_443009.1_5 Forward -355 -344 11.6612 0.0602
NP_443009.1_5 Reverse -194 -205 7.92465 0.118
NP_441715.1_4 Reverse -346 -356 16.303 0.0117
NP_441715.1_4 Forward -353 -343 9.41981 0.097
NP_440357.1_3 Reverse -343 -362 3.83436 0.242
NP_440183.1_9 Reverse -353 -372 -14.2585 0.263
NP_440379.1_5 Forward -363 -344 -5.60541 0.224
NP_440379.1_5 Reverse -198 -217 -8.26035 0.25
NP_441468.1_1 Forward -353 -346 15.8704 0.0124
NP_441468.1_1 Reverse -346 -353 15.8704 0.0124
NP_441468.1_1 Reverse -196 -203 6.13563 0.209
NP_441468.1_1 Forward -203 -196 6.0373 0.223
NP_441468.1_1 Reverse -384 -391 4.07068 0.263
NP_441020.2_6 Reverse -343 -360 21.8683 0.00226
NP_441015.1_10 Forward -359 -340 -6.98204 0.26
NP_441015.1_10 Reverse -346 -365 -10.4236 0.284
NP_441015.1_10 Forward -229 -210 -11.1119 0.291
NP_441015.1_10 Forward -344 -325 -11.2103 0.292
NP_441673.1_1 Forward -354 -345 20.8459 0.000698
NP_441673.1_1 Reverse -345 -354 20.8459 0.000698
NP_441673.1_1 Forward -204 -195 1.27803 0.155
NP_441673.1_1 Reverse -195 -204 1.27803 0.155
NP_441096.1_5 Forward -38 -20 14.6697 0.297
NP_442253.1_5 Reverse -357 -374 -0.944468 0.234
NP_442253.1_5 Forward -279 -262 -4.87771 0.293
NP_442253.1_5 Reverse -263 -280 -5.86102 0.295
NP_441826.1_2 Forward -210 -196 13.5693 0.0214
NP_441826.1_2 Forward -398 -384 4.12949 0.105
NP_441826.1_2 Forward -146 -132 -0.000409212 0.201
NP_442490.1_9 Forward -366 -347 -0.885524 0.179
NP_442868.1_6 Forward -356 -346 0.963343 0.205
NP_442868.1_6 Reverse -343 -353 0.865012 0.205
NP_442719.1_2 Forward -52 -34 -9.7163 0.267
NP_442227.1_2 Forward -37 -18 2.65439 0.226
NP_442227.1_2 Reverse -211 -230 1.27776 0.249
NP_442361.1_3 Forward -360 -347 8.18076 0.285
NP_442361.1_3 Forward -146 -133 7.98409 0.285
NP_440789.1_8 Reverse -22 -41 14.1591 0.277
NP_442808.1_1 Forward -355 -345 18.4657 0.00201
NP_442808.1_1 Reverse -344 -354 18.4657 0.00201
NP_442808.1_1 Forward -134 -124 2.24121 0.274
NP_442808.1_1 Reverse -265 -275 1.94622 0.281
NP_441101.1_10 Reverse -202 -221 -5.31042 0.281
NP_440871.1_2 Forward -130 -111 12.6841 0.267
NP_440031.1_10 Forward -126 -107 4.52268 0.256
NP_442692.1_1 Reverse -185 -204 -1.86883 0.274
NP_442692.1_10 Forward -43 -30 16.5182 0.213
NP_442542.1_9 Forward -211 -197 17.6985 0.0445
NP_442050.1_5 Forward -356 -346 9.12434 0.193
NP_442342.1_9 Forward -206 -190 4.28677 0.25
NP_441114.1_3 Forward -274 -265 7.86621 0.231
NP_440558.1_2 Forward -279 -260 4.22769 0.152
NP_440558.1_2 Reverse -204 -223 -4.72043 0.248
NP_440558.1_2 Reverse -263 -282 -4.81876 0.249
NP_440558.1_2 Reverse -34 -53 -6.68705 0.279
NP_442789.1_4 Reverse -343 -362 0.58944 0.192
NP_441518.1_3 Forward -364 -345 -0.295539 0.0951
NP_442792.1_5 Reverse -256 -273 9.38028 0.296
NP_441878.1_6 Forward -355 -345 10.4031 0.0176
NP_441878.1_6 Reverse -344 -354 10.4031 0.0176
NP_441878.1_6 Forward -376 -366 2.53664 0.0363
NP_441878.1_6 Forward -276 -266 2.14332 0.0501
NP_441878.1_6 Forward -218 -208 0.963343 0.128
NP_441878.1_6 Reverse -201 -211 0.865012 0.132
NP_441878.1_6 Reverse -194 -204 0.668351 0.139
NP_441878.1_6 Reverse -365 -375 -0.0199663 0.163
NP_441036.1_8 Forward -355 -345 17.7779 0.000554
NP_441036.1_8 Reverse -344 -354 17.7779 0.000554
NP_441036.1_8 Forward -223 -213 11.5831 0.114
NP_441036.1_8 Reverse -194 -204 5.87989 0.253
NP_442650.1_2 Forward -204 -190 7.07942 0.13
NP_441557.1_5 Forward -354 -345 19.9609 0.000699
NP_441557.1_5 Reverse -345 -354 19.9609 0.000699
NP_441557.1_5 Reverse -195 -204 7.66954 0.0443
NP_441557.1_5 Forward -204 -195 0.983037 0.0911
NP_441445.1_1 Forward -363 -344 17.5024 0.0319
NP_441445.1_1 Forward -284 -265 3.83436 0.205
NP_441445.1_1 Reverse -336 -355 0.58944 0.272
NP_442419.1_2 Reverse -340 -359 0.982764 0.238
NP_441308.1_8 Forward -356 -346 10.1081 0.22
NP_440101.1_3 Reverse -340 -359 4.22769 0.222
NP_441458.1_10 Forward -363 -344 12.7825 0.0883
NP_442183.1_1 Reverse -345 -359 18.3875 0.00758
NP_442183.1_1 Forward -204 -190 6.09611 0.188
NP_442183.1_1 Forward -85 -71 4.71948 0.25
NP_441459.1_3 Reverse -351 -370 10.9408 0.296
NP_442135.1_3 Forward -216 -197 10.6192 0.16
NP_441574.1_1 Reverse -342 -361 -7.67036 0.293
NP_441549.1_9 Forward -279 -261 -8.73231 0.237
NP_442347.1_2 Forward -353 -344 11.1111 0.056
NP_442347.1_2 Reverse -346 -355 11.1111 0.056
NP_442645.1_2 Forward -219 -200 -5.70374 0.0728
NP_442645.1_2 Forward -362 -343 -14.5535 0.175
NP_442645.1_2 Forward -278 -259 -16.1268 0.224
NP_442645.1_2 Reverse -337 -356 -21.83 0.29
NP_441037.1_4 Forward -206 -196 15.2117 0.028
NP_441037.1_4 Reverse -343 -353 14.7245 0.028
NP_441037.1_4 Reverse -193 -203 8.19481 0.237
NP_441037.1_4 Forward -356 -346 7.02532 0.237
NP_441633.1_3 Reverse -343 -356 10.7374 0.0286
NP_441633.1_3 Forward -356 -343 3.65753 0.0699
NP_441633.1_3 Reverse -193 -206 -4.01229 0.179
NP_441633.1_3 Forward -206 -193 -4.11062 0.181
NP_440136.1_2 Forward -353 -346 15.9687 0.0123
NP_440136.1_2 Reverse -346 -353 15.9687 0.0123
NP_440136.1_2 Reverse -196 -203 6.23397 0.171
NP_440136.1_2 Forward -203 -196 6.13563 0.193
NP_442590.1_10 Reverse -338 -357 10.2259 0.183
NP_442590.1_10 Reverse -202 -221 4.22769 0.278
NP_442590.1_10 Forward -360 -341 3.14605 0.295
NP_442998.1_5 Reverse -34 -44 13.0581 0.158
NP_442998.1_5 Forward -328 -318 7.64985 0.287
NP_442998.1_10 Forward -352 -345 15.5754 0.0102
NP_442998.1_10 Reverse -347 -354 15.5754 0.0102
NP_442998.1_10 Reverse -197 -204 15.5754 0.0102
NP_442998.1_10 Forward -83 -76 9.28223 0.117
NP_440299.1_1 Reverse -341 -354 17.8166 0.00525
NP_440299.1_1 Reverse -191 -204 14.2767 0.0259
NP_440299.1_1 Forward -358 -345 10.4418 0.0573
NP_440299.1_1 Forward -396 -383 7.68852 0.107
NP_440299.1_1 Reverse -262 -275 4.24695 0.213
NP_441799.1_1 Forward -358 -344 15.4369 0.0182
NP_441799.1_1 Reverse -341 -355 11.9953 0.0487
NP_441007.1_10 Forward -359 -346 3.95252 0.182
NP_441007.1_10 Forward -209 -196 0.904263 0.212
NP_441007.1_10 Reverse -190 -203 0.805932 0.216
NP_442334.1_2 Forward -214 -197 -5.1727 0.2
NP_442201.1_10 Reverse -334 -353 -8.35868 0.216
NP_442333.2_5 Forward -96 -77 -14.9469 0.286
NP_440256.1_1 Forward -214 -195 -3.73712 0.138
NP_440256.1_1 Forward -357 -338 -7.76869 0.245
NP_440256.1_1 Forward -395 -376 -8.55534 0.263
NP_440256.1_1 Reverse -342 -361 -8.65367 0.264
NP_440087.1_1 Forward -220 -201 -9.63698 0.297
NP_442007.1_8 Reverse -194 -212 13.1947 0.258
NP_441559.1_8 Reverse -340 -354 11.8976 0.0574
NP_441559.1_8 Forward -359 -345 -6.98191 0.281
NP_440915.1_6 Forward -208 -194 5.50613 0.0898
NP_440915.1_6 Reverse -341 -355 -2.16369 0.26
NP_440915.1_6 Reverse -262 -276 -3.24533 0.292
NP_441296.1_7 Reverse -150 -169 13.8641 0.267
NP_442785.1_7 Forward -356 -342 10.0294 0.231
NP_441866.1_6 Forward -178 -159 6.1935 0.293
NP_440134.1_2 Forward -377 -358 1.0811 0.298
NP_442866.1_1 Reverse -71 -90 -7.27704 0.266
NP_440748.1_5 Reverse -186 -205 5.89931 0.188
NP_441464.1_1 Reverse -375 -394 6.98095 0.273
NP_441464.1_8 Reverse -208 -222 5.01447 0.26
NP_440306.1_8 Reverse -311 -330 -1.18128 0.224
NP_440695.1_5 Reverse -345 -364 9.83255 0.15
NP_440695.1_6 Forward -46 -32 9.44178 0.285
NP_441939.1_3 Forward -203 -184 12.1925 0.103
NP_441939.1_3 Forward -353 -334 8.35759 0.175
NP_441199.1_6 Reverse -341 -360 4.03102 0.175
NP_441494.1_6 Reverse -190 -203 8.27909 0.23
NP_442993.1_1 Reverse -345 -361 -1.41643 0.0906
NP_440677.1_1 Reverse -336 -355 11.9958 0.15
NP_442386.1_9 Reverse -344 -353 15.7322 0.0144
NP_442386.1_9 Forward -355 -346 15.7322 0.0144
NP_442386.1_9 Forward -205 -196 5.89917 0.233
NP_441340.1_5 Forward -353 -346 15.6737 0.0124
NP_441340.1_5 Reverse -346 -353 15.6737 0.0124
NP_441340.1_5 Forward -203 -196 6.13563 0.175
NP_441340.1_5 Reverse -196 -203 5.93897 0.198
NP_441271.1_1 Reverse -189 -207 15.2596 0.202
NP_440168.1_4 Reverse -256 -275 -5.21209 0.255
NP_442506.1_9 Reverse -143 -162 8.35759 0.229
NP_440586.1_1 Reverse -341 -360 -4.52377 0.278
NP_440586.1_8 Forward -353 -346 13.2151 0.026
NP_440586.1_8 Reverse -346 -353 13.2151 0.026
NP_440586.1_8 Forward -203 -196 11.4451 0.0645
NP_440586.1_8 Reverse -384 -391 10.9535 0.119
NP_442251.1_6 Forward -353 -346 15.2804 0.0124
NP_442251.1_6 Reverse -346 -353 15.2804 0.0124
NP_442251.1_6 Reverse -196 -203 12.0355 0.0627
NP_442959.1_7 Forward -77 -58 -3.93378 0.267
NP_442959.1_8 Forward -328 -309 17.7658 0.222
NP_441262.1_3 Reverse -345 -352 14.7888 0.0223
NP_441262.1_3 Forward -354 -347 14.7888 0.0223
NP_441262.1_3 Forward -204 -197 14.7888 0.0223
NP_441262.1_3 Reverse -195 -202 5.15232 0.265
NP_440027.1_3 Reverse -192 -210 3.55831 0.27
NP_443051.1_1 Reverse -344 -353 10.4228 0.00754
NP_443051.1_1 Forward -355 -346 10.4228 0.00754
NP_443051.1_1 Reverse -194 -203 6.29291 0.0801
NP_443051.1_1 Forward -205 -196 0.786375 0.125
NP_439937.1_8 Reverse -343 -362 2.16274 0.217
NP_439937.1_8 Forward -206 -187 0.0977854 0.237
NP_439937.1_9 Forward -355 -338 -0.453507 0.122
NP_439937.1_9 Forward -102 -85 -17.268 0.296
NP_440408.1_7 Forward -127 -108 6.88262 0.298
NP_440439.1_1 Forward -357 -344 15.5556 0.0137
NP_440439.1_1 Reverse -342 -355 10.8357 0.0339
NP_440439.1_1 Forward -214 -201 -1.35735 0.263
NP_440372.1_2 Forward -353 -346 16.3621 0.0124
NP_440372.1_2 Reverse -346 -353 16.3621 0.0124
NP_440372.1_2 Forward -203 -196 6.72562 0.0929
NP_440372.1_2 Reverse -196 -203 6.62729 0.151
NP_441803.1_2 Forward -359 -340 27.6305 0.000751
NP_441803.1_2 Reverse -190 -209 0.58944 0.249
NP_439977.1_5 Reverse -189 -208 2.94938 0.164
NP_439977.1_5 Forward -360 -341 -0.39387 0.225
NP_439977.1_5 Forward -210 -191 -3.24547 0.298
NP_441572.1_7 Forward -210 -191 -1.27885 0.187
NP_441572.1_7 Forward -360 -341 -3.73712 0.219
NP_442384.1_10 Forward -354 -341 17.3255 0.00599
NP_442384.1_10 Reverse -345 -358 13.884 0.018
NP_442384.1_10 Reverse -202 -215 7.98409 0.0711
NP_442384.1_10 Forward -140 -127 2.18257 0.235
NP_442114.1_4 Reverse -195 -206 15.2016 0.107
NP_441018.1_7 Reverse -341 -360 6.58763 0.285
NP_442790.1_4 Reverse -67 -86 -8.35868 0.168
NP_442262.1_10 Forward -353 -346 14.1988 0.0123
NP_442262.1_10 Reverse -346 -353 14.1988 0.0123
NP_442262.1_10 Reverse -384 -391 11.7405 0.0841
NP_442262.1_10 Forward -84 -77 7.90559 0.266
NP_441689.1_5 Forward -356 -346 8.53436 0.132
NP_441689.1_5 Reverse -387 -397 7.35439 0.197
NP_441689.1_5 Forward -87 -77 5.48612 0.251
NP_442244.1_3 Reverse -198 -217 7.66927 0.177
NP_440163.1_10 Forward -357 -347 16.303 0.0762
NP_440344.1_10 Reverse -338 -355 7.512 0.0133
NP_440344.1_10 Forward -361 -344 6.82368 0.0165
NP_440344.1_10 Reverse -188 -205 -10.6792 0.187
NP_440282.1_10 Forward -364 -345 3.14605 0.144
NP_440282.1_10 Reverse -356 -375 -7.67036 0.253
NP_440531.1_6 Forward -362 -343 5.60432 0.112
NP_441060.1_9 Reverse -345 -364 10.0292 0.274
NP_440487.1_1 Forward -357 -338 -3.44213 0.214
NP_440487.1_1 Reverse -342 -361 -3.54046 0.214
NP_441335.1_8 Reverse -65 -84 9.3409 0.228
NP_441965.1_3 Reverse -185 -204 4.22769 0.175
NP_441965.1_10 Reverse -342 -358 10.7766 0.107
NP_440297.1_9 Reverse -346 -356 9.32148 0.0917
NP_440297.1_9 Reverse -367 -377 6.37155 0.193
NP_440297.1_9 Reverse -267 -277 0.865012 0.282
NP_440297.1_9 Forward -203 -193 -0.0199663 0.282
NP_440297.1_9 Forward -353 -343 -0.118297 0.282
NP_440297.1_9 Reverse -384 -394 -0.41329 0.283
NP_442280.1_10 Reverse -114 -132 4.96742 0.291
NP_441896.1_3 Reverse -336 -355 9.43923 0.0872
NP_441896.1_3 Forward -363 -344 -0.787193 0.247
NP_441103.1_9 Forward -41 -31 14.7357 0.203
NP_440894.1_10 Reverse -126 -145 11.2092 0.148
NP_440894.1_10 Reverse -340 -359 8.94757 0.168
NP_440894.1_10 Reverse -190 -209 3.24438 0.276
NP_442067.1_4 Forward -365 -346 11.3075 0.131
NP_442067.1_4 Reverse -349 -368 3.04771 0.289
NP_440999.1_9 Reverse -341 -355 3.04785 0.137
NP_440999.1_9 Forward -208 -194 1.86788 0.157
NP_440999.1_9 Forward -358 -344 1.08123 0.171
NP_440999.1_9 Reverse -350 -364 -0.885388 0.22
NP_440999.1_9 Reverse -211 -225 -3.44199 0.293
NP_440888.1_2 Reverse -345 -359 12.192 0.0495
NP_440888.1_2 Forward -398 -384 11.5037 0.0657
NP_440888.1_2 Forward -354 -340 10.1271 0.104
NP_440888.1_2 Reverse -216 -230 5.40719 0.28
NP_440600.1_4 Reverse -375 -393 -7.749 0.294
NP_440822.1_8 Reverse -156 -175 7.66927 0.258
NP_440491.1_1 Reverse -192 -211 15.3958 0.0862
NP_440052.1_5 Reverse -334 -353 -0.983855 0.193
NP_441543.1_2 Forward -353 -344 18.486 0.00236
NP_441543.1_2 Reverse -346 -355 18.486 0.00236
NP_441543.1_2 Reverse -196 -205 8.75118 0.0968
NP_441319.1_8 Forward -360 -342 14.1788 0.108
NP_441469.1_8 Reverse -344 -353 16.126 0.00797
NP_441469.1_8 Forward -355 -346 16.126 0.00797
NP_441469.1_8 Forward -205 -196 6.29291 0.227
NP_442578.1_7 Forward -353 -346 14.5921 0.026
NP_442578.1_7 Reverse -346 -353 14.5921 0.026
NP_442578.1_7 Forward -203 -196 5.93897 0.183
NP_442578.1_7 Reverse -384 -391 5.15232 0.291
NP_441462.1_2 Forward -354 -344 11.5831 0.00406
NP_441462.1_2 Reverse -345 -355 11.5831 0.00406
NP_441462.1_2 Forward -204 -194 1.84832 0.081
NP_441621.1_7 Reverse -343 -357 5.99778 0.068
NP_441621.1_7 Reverse -193 -207 5.21113 0.0933
NP_441621.1_7 Forward -206 -192 -1.37704 0.178
NP_441621.1_7 Forward -356 -342 -3.63866 0.192
NP_441621.1_7 Forward -215 -201 -6.58858 0.298
NP_443062.1_1 Reverse -345 -363 5.42569 0.229
NP_443062.1_1 Reverse -113 -131 3.76806 0.285
NP_443062.1_1 Forward -392 -374 3.47554 0.297
NP_443062.1_6 Reverse -337 -356 16.3224 0.066
NP_443062.1_6 Forward -362 -343 1.96607 0.264
NP_442204.1_1 Reverse -341 -352 6.94184 0.144
NP_442204.1_1 Reverse -379 -390 2.91027 0.266
NP_442204.1_1 Forward -358 -347 -0.137991 0.286
NP_442204.1_2 Forward -364 -345 12.7825 0.223
NP_442204.1_5 Forward -214 -195 23.9922 0.016
NP_441560.1_8 Reverse -190 -209 20.0829 0.0106
NP_442487.1_5 Reverse -334 -353 2.06362 0.3
NP_442780.1_3 Forward -327 -308 9.50102 0.233
NP_440516.1_2 Forward -360 -342 0.21581 0.235
NP_440516.1_2 Reverse -339 -357 -1.84914 0.292
NP_440516.1_8 Forward -354 -345 16.9127 0.00442
NP_440516.1_8 Reverse -345 -354 16.9127 0.00442
NP_440516.1_8 Forward -204 -195 8.25953 0.0391
NP_442428.1_4 Forward -276 -257 6.58763 0.196
NP_442428.1_5 Forward -353 -346 15.8704 0.0124
NP_442428.1_5 Reverse -346 -353 15.8704 0.0124
NP_442428.1_5 Reverse -196 -203 6.13563 0.209
NP_442428.1_5 Forward -203 -196 6.0373 0.212
NP_442428.1_5 Reverse -384 -391 4.46401 0.267
NP_440673.1_2 Reverse -335 -354 10.1945 0.22
NP_440673.1_3 Forward -390 -383 13.2155 0.0426
NP_440673.1_3 Forward -352 -345 12.4288 0.0426
NP_440673.1_3 Reverse -347 -354 12.4288 0.0426
NP_440673.1_3 Reverse -197 -204 12.4288 0.0426
NP_440673.1_7 Forward -215 -196 9.14423 0.115
NP_441714.1_3 Reverse -338 -356 15.948 0.138
NP_441052.1_2 Forward -275 -265 11.6814 0.0285
NP_441052.1_2 Forward -354 -344 10.5014 0.0285
NP_441052.1_2 Reverse -345 -355 10.5014 0.0285
NP_442219.1_9 Forward -353 -344 8.35786 0.0681
NP_442219.1_9 Reverse -346 -355 8.35786 0.0681
NP_440436.1_4 Forward -353 -344 18.1905 0.00233
NP_440436.1_4 Reverse -346 -355 18.1905 0.00233
NP_440436.1_4 Reverse -196 -205 14.9456 0.0103
NP_441884.1_9 Forward -220 -201 -13.3736 0.138
NP_441884.1_9 Forward -357 -338 -22.2233 0.277
NP_441884.1_9 Reverse -342 -361 -23.6 0.284
NP_440314.1_9 Forward -139 -120 -9.047 0.258
NP_441719.1_4 Forward -353 -346 16.3621 0.0124
NP_441719.1_4 Reverse -346 -353 16.3621 0.0124
NP_441719.1_4 Forward -203 -196 6.72562 0.093
NP_441719.1_4 Reverse -196 -203 6.62729 0.151
NP_441719.1_4 Reverse -384 -391 3.77569 0.285
NP_441733.1_10 Forward -357 -344 7.78743 0.15
NP_441733.1_10 Reverse -192 -205 7.29578 0.156
NP_441004.1_1 Reverse -348 -367 -12.0953 0.244
NP_441004.1_1 Forward -210 -191 -17.1101 0.289
NP_441004.1_1 Forward -345 -326 -17.6018 0.292
NP_442366.1_3 Forward -355 -337 7.59063 0.0743
NP_442366.1_3 Reverse -194 -212 3.16574 0.115
NP_442366.1_3 Reverse -344 -362 -2.3408 0.226
NP_442366.1_5 Reverse -342 -352 15.2208 0.0375
NP_442873.1_2 Reverse -353 -372 12.88 0.224
NP_442873.1_3 Forward -364 -345 8.06178 0.203
NP_442873.1_3 Reverse -200 -219 4.91521 0.262
NP_440296.1_10 Forward -220 -201 -12.8819 0.269
NP_441115.1_4 Forward -355 -337 15.358 0.0411
NP_441115.1_4 Reverse -382 -400 8.96649 0.229
NP_442206.1_10 Reverse -345 -360 7.05973 0.178
NP_442854.1_6 Reverse -76 -95 0.982764 0.287
NP_440328.1_4 Forward -210 -191 3.6377 0.174
NP_440328.1_4 Reverse -339 -358 -0.000545616 0.265
NP_443054.1_2 Forward -356 -342 11.2093 0.0761
NP_443054.1_2 Forward -226 -212 -0.0987402 0.284
NP_442430.1_10 Reverse -335 -354 16.0265 0.112
NP_441851.1_7 Reverse -349 -368 6.4893 0.286
NP_441851.1_9 Forward -242 -223 12.6841 0.186
NP_441851.1_10 Forward -355 -345 16.008 0.00552
NP_441851.1_10 Reverse -344 -354 16.008 0.00552
NP_441851.1_10 Reverse -194 -204 6.17489 0.182
NP_441851.1_10 Forward -205 -195 6.07655 0.187
NP_441851.1_10 Forward -276 -266 4.3066 0.277
NP_442208.1_5 Reverse -352 -371 -0.885524 0.248
NP_442208.1_5 Reverse -61 -80 -9.14533 0.292
NP_442622.1_5 Forward -224 -205 -3.14714 0.171
NP_442856.1_7 Forward -363 -344 -5.50708 0.281
NP_442856.1_7 Reverse -351 -370 -5.99873 0.291
NP_441668.1_4 Forward -385 -366 -2.16383 0.288
NP_442515.1_1 Reverse -265 -279 0.589577 0.187
NP_442515.1_1 Reverse -208 -222 -2.95034 0.284
NP_442515.1_1 Reverse -344 -358 -4.62196 0.298
NP_440593.1_3 Forward -209 -190 7.37428 0.109
NP_441046.1_2 Forward -344 -325 9.24257 0.221
NP_440940.1_2 Reverse -346 -365 16.9124 0.221
NP_440940.1_7 Forward -364 -346 4.93494 0.237
NP_440432.1_9 Forward -391 -376 -1.29841 0.167
NP_440474.1_8 Reverse -346 -360 7.57046 0.204
NP_442450.1_5 Forward -356 -346 9.32148 0.115
NP_442450.1_5 Reverse -343 -353 7.55152 0.13
NP_440588.1_2 Reverse -336 -355 -1.86883 0.157
NP_442006.1_2 Forward -348 -331 -16.5791 0.256
NP_441570.1_1 Reverse -345 -363 0.314141 0.0395
NP_441078.1_4 Forward -354 -345 19.6659 0.0007
NP_441078.1_4 Reverse -345 -354 19.6659 0.0007
NP_441078.1_4 Forward -275 -266 13.2744 0.00871
NP_441078.1_4 Reverse -195 -204 0.0980582 0.205
NP_441078.1_4 Forward -204 -195 0.0980582 0.205
NP_441078.1_4 Forward -375 -366 -1.86856 0.272
NP_441078.1_4 Reverse -266 -275 -1.96689 0.282
NP_441078.1_4 Reverse -202 -211 -1.96689 0.282
NP_442729.1_8 Forward -358 -345 9.36073 0.125
NP_440539.1_9 Reverse -200 -219 3.73603 0.23
NP_441663.1_7 Forward -357 -338 6.78429 0.21
NP_442348.1_2 Forward -193 -184 11.9961 0.225
NP_440526.1_3 Forward -203 -192 15.2994 0.0646
NP_440526.1_3 Reverse -196 -207 8.90795 0.11
NP_440526.1_3 Reverse -209 -220 1.6315 0.267
NP_441432.1_8 Reverse -344 -353 8.25953 0.0755
NP_441432.1_8 Forward -355 -346 8.25953 0.0755
NP_441432.1_8 Reverse -388 -397 5.3096 0.17
NP_442320.1_8 Forward -210 -196 5.01447 0.0442
NP_442320.1_8 Forward -360 -346 -1.96703 0.0847
NP_442344.1_7 Reverse -346 -365 1.37609 0.0784
NP_441732.1_2 Forward -358 -342 -7.51295 0.0859
NP_441732.1_2 Reverse -341 -357 -7.51295 0.0859
NP_441732.1_2 Forward -89 -73 -16.9527 0.223
NP_440629.1_6 Forward -360 -341 12.3102 0.289
NP_441737.1_1 Forward -89 -70 11.7008 0.169
NP_442003.1_9 Reverse -148 -167 6.58763 0.235
NP_440760.1_1 Forward -204 -185 -11.7019 0.0878
NP_440760.1_1 Reverse -345 -364 -20.3551 0.222
NP_442797.1_7 Reverse -201 -219 7.39397 0.198
NP_440199.1_10 Reverse -386 -396 8.04317 0.231
NP_442353.1_4 Reverse -339 -358 14.1583 0.0776
NP_440713.1_4 Forward -364 -345 6.09597 0.196
NP_440713.1_4 Reverse -347 -366 3.14605 0.251
NP_442489.1_7 Forward -354 -345 20.1576 0.000695
NP_442489.1_7 Reverse -345 -354 20.1576 0.000695
NP_442489.1_7 Reverse -195 -204 0.786375 0.152
NP_442489.1_7 Forward -204 -195 0.589713 0.17
NP_442489.1_7 Reverse -202 -211 -1.27858 0.185
NP_442489.1_7 Forward -375 -366 -1.37691 0.195
NP_442489.1_7 Forward -275 -266 -1.77023 0.247
NP_442489.1_7 Forward -398 -389 -1.86856 0.259
NP_442079.1_7 Reverse -346 -365 10.3242 0.111
NP_442079.1_7 Forward -391 -372 -0.39387 0.291
NP_440559.1_1 Reverse -346 -355 8.75118 0.0586
NP_440559.1_1 Forward -353 -344 8.75118 0.0586
NP_440559.1_1 Forward -203 -194 6.98123 0.117
NP_440559.1_1 Reverse -196 -205 5.50626 0.14
NP_441659.2_8 Forward -204 -194 12.6647 0.0147
NP_441659.2_8 Forward -354 -344 11.9764 0.0147
NP_441659.2_8 Reverse -345 -355 11.9764 0.0147
NP_441022.1_1 Forward -325 -316 11.0666 0.284
NP_442913.1_9 Forward -210 -191 8.06259 0.269
NP_442913.1_10 Reverse -193 -212 -4.91709 0.251
NP_441040.1_2 Reverse -200 -219 -11.1119 0.254
NP_439956.1_7 Reverse -70 -89 2.94938 0.265
NP_440442.1_3 Reverse -382 -396 15.5359 0.271
NP_442346.1_5 Forward -355 -345 9.02648 0.118
NP_442346.1_5 Reverse -344 -354 9.02648 0.118
NP_442346.1_5 Forward -205 -195 6.37155 0.205
NP_440352.1_5 Forward -337 -318 14.9918 0.135
NP_440545.1_3 Reverse -341 -358 11.6419 0.0247
NP_440545.1_3 Reverse -262 -279 8.98696 0.0411
NP_440545.1_3 Reverse -191 -208 5.34871 0.0623
NP_440545.1_3 Forward -208 -191 0.432165 0.139
NP_440831.1_3 Forward -363 -344 15.1241 0.106
NP_440459.1_2 Reverse -252 -269 13.2152 0.131
NP_440459.1_2 Reverse -336 -353 9.57695 0.224
NP_440459.1_8 Reverse -198 -216 7.09898 0.291
NP_440459.1_10 Reverse -47 -66 20.4523 0.196
NP_440010.1_4 Forward -367 -348 3.14526 0.22
NP_440010.1_4 Reverse -185 -204 -1.18128 0.267
NP_440010.1_4 Forward -364 -345 -1.8696 0.273
NP_441943.1_8 Reverse -152 -171 -12.4886 0.261
NP_442551.1_4 Reverse -264 -279 18.7611 0.0532
NP_442551.1_4 Forward -278 -263 0.864876 0.245
NP_441585.1_5 Forward -93 -74 -0.39464 0.291
NP_441888.1_7 Reverse -340 -354 4.03116 0.225
NP_440449.1_6 Forward -212 -194 8.83941 0.194
NP_441948.1_4 Reverse -338 -356 2.37909 0.125
NP_441948.1_4 Forward -361 -343 -0.669169 0.139
NP_441833.1_4 Forward -353 -346 15.9687 0.0124
NP_441833.1_4 Reverse -346 -353 15.9687 0.0124
NP_441833.1_4 Reverse -196 -203 14.1004 0.0258
NP_441833.1_4 Forward -203 -196 6.13563 0.198
NP_442799.1_8 Reverse -37 -56 21.2432 0.051
NP_442162.1_9 Forward -353 -346 16.2637 0.0124
NP_442162.1_9 Reverse -346 -353 16.2637 0.0124
NP_442162.1_9 Reverse -196 -203 6.62729 0.142
NP_442162.1_9 Forward -203 -196 6.52896 0.178
NP_442796.1_6 Forward -344 -325 21.5339 0.172
NP_440671.1_2 Reverse -198 -212 14.0609 0.28
NP_440671.1_4 Forward -91 -77 10.4227 0.158
NP_440671.1_5 Reverse -112 -126 16.0269 0.208
NP_441915.1_4 Reverse -207 -226 6.78348 0.293
NP_442199.1_5 Forward -362 -343 8.45592 0.0702
NP_442140.1_3 Forward -353 -343 16.2046 0.0255
NP_442140.1_3 Forward -203 -193 14.3364 0.0486
NP_442140.1_3 Reverse -346 -356 8.33817 0.119
NP_442140.1_3 Reverse -196 -206 8.04317 0.124
NP_440875.1_9 Reverse -197 -207 17.619 0.0104
NP_440875.1_9 Reverse -347 -357 9.05339 0.233
NP_441813.1_5 Forward -356 -346 17.188 0.00979
NP_441813.1_5 Reverse -343 -353 9.91146 0.021
NP_441813.1_5 Forward -206 -196 0.176696 0.215
NP_440594.1_3 Reverse -195 -213 18.112 0.167
NP_440590.1_4 Forward -353 -340 22.1438 0.00377
NP_440590.1_4 Reverse -196 -209 18.8988 0.00741
NP_440590.1_4 Reverse -346 -359 -4.89726 0.269
NP_440567.1_1 Reverse -346 -360 15.1426 0.0179
NP_440567.1_1 Forward -353 -339 7.66941 0.067
NP_440567.1_1 Reverse -196 -210 6.78443 0.0803
NP_440567.1_1 Forward -203 -189 1.86788 0.191
NP_442497.1_10 Forward -353 -344 10.4228 0.0087
NP_442497.1_10 Reverse -346 -355 10.4228 0.0087
NP_442497.1_10 Forward -203 -194 8.1612 0.0625
NP_442497.1_10 Reverse -196 -205 0.688044 0.141
NP_440821.1_4 Forward -356 -346 19.0562 0.00399
NP_440821.1_4 Reverse -343 -353 10.2065 0.0163
NP_440821.1_4 Reverse -193 -203 9.22315 0.0334
NP_440821.1_4 Forward -206 -196 8.92815 0.0382
NP_441239.1_9 Forward -356 -344 15.8703 0.0178
NP_441239.1_9 Reverse -343 -355 14.887 0.0247
NP_441239.1_9 Reverse -228 -240 10.5604 0.076
NP_441239.1_9 Reverse -200 -212 9.57708 0.102
NP_441239.1_9 Forward -219 -207 7.90546 0.147
NP_441239.1_9 Reverse -193 -205 7.80712 0.148
NP_441239.1_9 Forward -206 -194 5.64384 0.213
NP_441951.1_4 Reverse -131 -150 4.81767 0.273
NP_441892.1_1 Forward -363 -346 -5.46769 0.281
NP_441892.1_4 Forward -212 -193 4.03102 0.203
NP_442044.1_1 Reverse -261 -280 3.44104 0.132
NP_442193.1_8 Forward -278 -259 15.9282 0.211
NP_442270.1_9 Reverse -340 -359 -7.57203 0.213
NP_441017.1_6 Reverse -379 -393 12.782 0.217
NP_441874.1_1 Forward -168 -154 12.291 0.24
NP_441526.1_6 Reverse -349 -368 2.55606 0.283
NP_440354.1_7 Forward -360 -342 9.26226 0.228
NP_442138.1_10 Reverse -345 -364 9.53756 0.0445
NP_440546.1_2 Reverse -143 -162 13.2741 0.239
NP_440546.1_4 Forward -354 -344 11.8882 0.0679
NP_440546.1_4 Reverse -345 -355 11.8882 0.0679
NP_440546.1_4 Reverse -117 -127 8.00989 0.209
NP_441230.1_5 Reverse -340 -359 4.22769 0.188
NP_440462.1_6 Forward -356 -346 15.418 0.0142
NP_440462.1_6 Reverse -343 -353 9.02648 0.0498
NP_440462.1_6 Forward -206 -196 8.33817 0.0646
NP_440462.1_6 Reverse -381 -391 5.09324 0.168
NP_442340.1_3 Forward -169 -150 -4.22878 0.215
NP_440868.1_4 Forward -358 -346 17.7386 0.0124
NP_440868.1_4 Reverse -341 -353 11.2487 0.0327
NP_441582.1_5 Forward -356 -337 4.22689 0.236
NP_440036.1_10 Forward -382 -370 18.9185 0.282
NP_441848.1_7 Reverse -315 -334 11.405 0.196
NP_441848.1_7 Reverse -316 -335 0.785326 0.228
NP_440696.1_3 Reverse -341 -359 -4.20908 0.298
NP_440696.1_6 Forward -216 -197 10.7175 0.207
NP_442039.1_4 Forward -353 -346 15.1821 0.0124
NP_442039.1_4 Reverse -346 -353 15.1821 0.0124
NP_441811.1_8 Forward -281 -267 5.99778 0.289
NP_440825.1_7 Forward -353 -343 12.4217 0.155
NP_442837.1_3 Forward -353 -346 15.7721 0.0124
NP_442837.1_3 Reverse -346 -353 15.7721 0.0124
NP_442837.1_3 Reverse -196 -203 6.13563 0.25
NP_442837.1_3 Forward -203 -196 5.93897 0.265
NP_440160.1_2 Reverse -365 -384 -2.26216 0.245
NP_440160.1_9 Forward -375 -356 7.96426 0.27
NP_442053.1_1 Forward -354 -345 18.3876 0.0007
NP_442053.1_1 Reverse -345 -354 18.3876 0.0007
NP_440505.1_3 Forward -356 -346 13.8447 0.0247
NP_440505.1_3 Forward -206 -196 12.8614 0.0427
NP_440505.1_3 Reverse -343 -353 6.76487 0.169
NP_440505.1_3 Reverse -264 -274 4.99491 0.252
NP_440505.1_7 Forward -37 -18 3.44104 0.213
NP_441102.1_1 Reverse -346 -365 3.83436 0.282
NP_442456.1_5 Forward -244 -226 9.95058 0.26
NP_441252.1_6 Reverse -73 -80 11.9372 0.25
NP_441203.1_1 Reverse -196 -215 -9.53865 0.137
NP_441408.2_7 Reverse -381 -400 -1.47551 0.251
NP_440914.1_1 Forward -354 -344 8.6151 0.186
NP_440914.1_1 Reverse -345 -355 8.6151 0.186
NP_440914.1_1 Forward -275 -265 6.3705 0.283
NP_441011.1_8 Forward -353 -344 16.9127 0.00602
NP_441011.1_8 Reverse -346 -355 16.9127 0.00602
NP_441011.1_8 Reverse -196 -205 7.17789 0.179
NP_442533.1_6 Forward -354 -345 17.2076 0.00137
NP_442533.1_6 Reverse -345 -354 17.2076 0.00137
NP_442533.1_6 Forward -275 -266 6.8829 0.101
NP_442533.1_6 Forward -211 -202 5.11294 0.155
NP_442533.1_6 Reverse -208 -217 4.42462 0.179
NP_442533.1_6 Reverse -202 -211 3.93297 0.197
NP_442533.1_6 Forward -269 -260 1.47469 0.298
NP_442541.1_10 Reverse -202 -216 10.1271 0.198
NP_442232.1_3 Reverse -187 -206 -14.9469 0.288
NP_442322.1_4 Reverse -109 -126 -4.68172 0.26
NP_442229.1_1 Reverse -343 -357 9.83206 0.184
NP_441482.1_7 Forward -360 -346 0.196253 0.0595
NP_441482.1_7 Reverse -189 -203 -8.75187 0.193
NP_439944.1_9 Forward -203 -193 13.2547 0.0649
NP_439944.1_9 Reverse -346 -356 10.3048 0.0887
NP_439944.1_9 Forward -32 -22 6.46988 0.179
NP_439944.1_9 Reverse -384 -394 4.99491 0.284
NP_441697.1_5 Reverse -165 -184 -6.44613 0.232
NP_441028.1_6 Reverse -151 -161 3.51951 0.292
NP_440116.1_8 Forward -210 -191 -0.4922 0.11
NP_441527.1_4 Reverse -23 -42 -11.2207 0.278
NP_441527.1_4 Forward -337 -318 -12.9396 0.296
NP_440007.1_9 Reverse -257 -271 1.57289 0.285
NP_439965.1_1 Forward -363 -344 6.98095 0.076
NP_441602.1_3 Reverse -190 -209 -1.7705 0.231
NP_441602.1_3 Forward -209 -190 -5.9004 0.3
NP_441106.1_1 Reverse -344 -353 18.191 0.0028
NP_441106.1_1 Forward -355 -346 18.191 0.0028
NP_441106.1_1 Forward -205 -196 8.35786 0.0585
NP_441106.1_1 Reverse -382 -391 4.71961 0.21
NP_441106.1_1 Reverse -260 -269 3.04799 0.244
NP_441869.1_2 Reverse -331 -350 8.35759 0.287
NP_439903.1_6 Reverse -174 -193 -1.08295 0.292
NP_442306.1_10 Reverse -340 -359 -19.1751 0.197
NP_441286.1_1 Reverse -344 -356 4.95553 0.027
NP_441286.1_1 Forward -205 -193 2.98891 0.051
NP_441286.1_1 Forward -355 -343 -3.50094 0.145
NP_441286.1_1 Reverse -265 -277 -5.36923 0.197
NP_441286.1_1 Reverse -194 -206 -5.66422 0.213
NP_440670.1_8 Forward -354 -345 18.3876 0.000699
NP_440670.1_8 Reverse -345 -354 18.3876 0.000699
NP_440670.1_8 Reverse -195 -204 13.2744 0.0157
NP_440670.1_8 Forward -398 -389 9.34117 0.0581
NP_440670.1_8 Forward -204 -195 7.37455 0.0774
NP_441930.1_1 Reverse -205 -224 8.55425 0.235
NP_441930.1_2 Forward -276 -266 13.0581 0.248
NP_441930.1_2 Reverse -67 -77 12.9597 0.248
NP_440886.1_7 Forward -355 -345 17.7774 0.0011
NP_440886.1_7 Reverse -344 -354 17.7774 0.0011
NP_440886.1_7 Forward -205 -195 4.60114 0.227
NP_442614.1_2 Reverse -266 -280 10.521 0.234
NP_442614.1_2 Reverse -345 -359 9.34103 0.242
NP_442614.1_2 Forward -204 -190 7.9644 0.257
NP_442072.1_9 Reverse -194 -212 -4.20908 0.0413
NP_442072.1_9 Forward -355 -337 -13.6489 0.118
NP_442072.1_9 Reverse -130 -148 -15.2222 0.174
NP_441808.1_7 Forward -93 -74 16.8141 0.115
NP_440907.2_8 Forward -353 -343 14.2375 0.0312
NP_440907.2_8 Reverse -196 -206 8.14104 0.117
NP_440907.2_8 Forward -203 -193 7.94438 0.117
NP_440907.2_8 Reverse -346 -356 7.84605 0.117
NP_442264.1_2 Forward -364 -347 4.85706 0.292
NP_441021.1_1 Reverse -196 -215 -6.68705 0.18
NP_441021.1_8 Forward -120 -102 9.95058 0.135
NP_441021.1_8 Reverse -340 -358 1.78911 0.258
NP_441463.1_3 Forward -364 -345 0.196116 0.132
NP_441463.1_3 Reverse -256 -275 -6.68705 0.247
NP_441463.1_7 Reverse -379 -398 14.0608 0.285
NP_441626.1_2 Forward -353 -346 15.7721 0.0124
NP_441626.1_2 Reverse -346 -353 15.7721 0.0124
NP_441626.1_2 Forward -203 -196 6.0373 0.212
NP_441626.1_2 Reverse -196 -203 6.0373 0.212
NP_440107.1_5 Reverse -344 -363 -3.24547 0.178
NP_442794.1_1 Reverse -341 -353 2.89058 0.286
NP_442615.1_1 Forward -363 -345 9.85225 0.0236
NP_442615.1_1 Reverse -336 -354 -1.45582 0.128
NP_442615.1_1 Reverse -257 -275 -5.29072 0.209
NP_441962.1_4 Reverse -190 -209 -2.55715 0.135
NP_441962.1_9 Forward -223 -204 5.89931 0.258
NP_440387.1_1 Forward -354 -338 14.9065 0.00603
NP_440387.1_1 Reverse -345 -361 11.7599 0.0152
NP_441431.1_2 Forward -357 -343 12.192 0.126
NP_441431.1_2 Reverse -342 -356 7.86545 0.231
NP_441993.1_1 Forward -224 -205 0.679741 0.294
NP_441174.1_2 Forward -357 -343 14.0609 0.176
NP_440114.1_10 Reverse -345 -359 8.25939 0.21
NP_442437.1_8 Reverse -346 -365 7.37428 0.242
NP_442323.1_7 Forward -90 -71 9.04509 0.163
NP_441510.2_2 Forward -358 -339 5.11187 0.26
NP_440287.1_6 Reverse -193 -212 1.67108 0.266
NP_440293.1_3 Forward -224 -205 -4.52377 0.264
NP_440766.1_4 Reverse -191 -205 10.1277 0.0871
NP_440766.1_4 Reverse -341 -355 9.04604 0.0871
NP_440766.1_4 Forward -358 -344 7.9644 0.0871
NP_440766.1_4 Forward -208 -194 1.37622 0.236
NP_439988.1_3 Reverse -64 -78 4.32615 0.295
NP_439988.1_7 Forward -205 -191 11.5037 0.292
NP_441237.1_9 Forward -203 -193 12.7631 0.105
NP_442743.1_4 Reverse -196 -215 -7.57203 0.279
NP_441246.1_6 Forward -339 -321 8.96727 0.118
NP_439910.1_2 Reverse -337 -354 -11.8592 0.0788
NP_439910.1_2 Forward -362 -345 -21.3973 0.183
NP_440457.1_1 Reverse -191 -203 3.87389 0.182
NP_440457.1_1 Forward -358 -346 1.21895 0.244
NP_440457.1_1 Reverse -341 -353 0.137309 0.25
NP_442940.1_2 Forward -375 -356 11.7008 0.167
NP_440798.1_6 Forward -353 -340 5.62415 0.14
NP_441984.1_6 Forward -169 -157 13.5103 0.274
NP_441436.1_8 Reverse -75 -94 7.17762 0.293
NP_441436.1_9 Forward -40 -30 16.4991 0.27
NP_440473.1_9 Reverse -65 -84 -9.24366 0.26
NP_442509.1_9 Forward -354 -344 16.2041 0.00739
NP_442509.1_9 Reverse -345 -355 16.2041 0.00739
NP_442509.1_9 Reverse -195 -205 12.0743 0.105
NP_442509.1_9 Forward -140 -130 7.25606 0.229
NP_442514.1_5 Forward -171 -152 -1.47628 0.201
NP_441440.1_1 Forward -216 -197 8.25926 0.284
NP_440554.1_4 Reverse -346 -356 14.6313 0.02
NP_440554.1_4 Forward -391 -381 7.45319 0.103
NP_440554.1_4 Forward -353 -343 7.35486 0.103
NP_440554.1_4 Reverse -196 -206 4.40493 0.19
NP_441845.1_6 Forward -216 -198 19.292 0.0597
NP_441885.1_5 Forward -354 -344 11.4848 0.00668
NP_441885.1_5 Reverse -345 -355 11.4848 0.00668
NP_441885.1_5 Forward -275 -265 7.64985 0.0466
NP_441885.1_5 Reverse -389 -399 -0.216628 0.189
NP_442228.1_10 Reverse -115 -134 20.1573 0.0904
NP_441428.1_8 Forward -362 -343 7.57094 0.206
NP_442341.1_7 Forward -355 -341 19.3708 0.00848
NP_442341.1_7 Reverse -344 -358 14.0609 0.0326
NP_442341.1_7 Reverse -265 -279 7.07942 0.111
NP_442341.1_7 Forward -399 -385 6.09611 0.135
NP_442341.1_7 Reverse -194 -208 2.75286 0.247
NP_442341.1_7 Forward -134 -120 2.16287 0.267
NP_442341.1_9 Reverse -343 -357 9.6354 0.147
NP_442341.1_9 Forward -272 -258 7.86545 0.185
NP_442341.1_9 Forward -356 -342 5.1122 0.279
NP_441756.1_5 Forward -221 -202 1.37609 0.217
NP_441756.1_5 Reverse -198 -217 -5.11376 0.298
NP_439906.1_5 Reverse -208 -227 16.9124 0.147
NP_442395.2_4 Forward -205 -186 8.75009 0.121
NP_440409.1_1 Forward -212 -193 -3.3438 0.255
NP_443000.1_7 Forward -356 -346 8.73149 0.0437
NP_443000.1_7 Reverse -343 -353 1.94665 0.226
NP_441842.1_1 Forward -352 -339 13.6867 0.137
NP_441842.1_10 Forward -211 -197 8.75105 0.211
NP_441842.1_10 Forward -361 -347 7.07942 0.267
NP_440275.1_3 Reverse -193 -203 16.7946 0.0151
NP_440275.1_3 Forward -356 -346 8.4365 0.0602
NP_440275.1_3 Forward -206 -196 8.33817 0.0602
NP_440275.1_3 Reverse -343 -353 8.33817 0.0602
NP_440091.1_1 Forward -208 -196 2.79224 0.184
NP_440091.1_1 Forward -358 -346 1.41561 0.197
NP_440091.1_1 Reverse -341 -353 0.727295 0.233
NP_443060.1_8 Forward -342 -323 15.9291 0.257
NP_441902.1_3 Reverse -20 -30 14.4393 0.222
NP_440679.1_10 Reverse -347 -366 -14.0619 0.226
NP_440127.1_3 Forward -40 -21 13.7649 0.271
NP_441359.1_5 Reverse -192 -211 0.196116 0.299
NP_442451.1_2 Reverse -200 -219 -2.55715 0.185
NP_442451.1_2 Forward -212 -193 -4.81876 0.215
NP_440175.1_4 Forward -219 -200 -12.5869 0.235
NP_440175.1_7 Reverse -113 -131 9.65589 0.278
NP_440149.1_8 Reverse -345 -364 4.12936 0.0864
NP_440149.1_8 Forward -398 -379 -3.54046 0.192
NP_441105.1_3 Reverse -184 -203 -1.18052 0.147
NP_441105.1_3 Forward -365 -346 -3.73712 0.185
NP_441105.1_3 Forward -374 -355 -9.14533 0.284
NP_440216.1_1 Forward -354 -340 -1.08205 0.0293
NP_440216.1_1 Reverse -202 -216 -2.16369 0.0482
NP_440216.1_1 Reverse -345 -359 -2.26202 0.0484
NP_440216.1_1 Reverse -195 -209 -11.0135 0.159
NP_440216.1_1 Forward -211 -197 -11.5051 0.192
NP_440216.1_6 Reverse -201 -217 0.845183 0.24
NP_440216.1_9 Forward -161 -152 5.99792 0.289
NP_440172.1_1 Forward -354 -344 8.73149 0.0586
NP_440172.1_1 Reverse -345 -355 8.73149 0.0586
NP_440172.1_1 Forward -398 -388 7.15819 0.0897
NP_440172.1_1 Reverse -76 -86 4.99491 0.157
NP_442290.1_3 Forward -203 -184 12.3892 0.241
NP_442015.1_10 Reverse -341 -354 20.5705 0.00366
NP_442015.1_10 Forward -144 -131 11.229 0.0372
NP_442015.1_10 Forward -358 -345 9.36073 0.0503
NP_442015.1_10 Reverse -191 -204 5.82081 0.132
NP_441226.1_7 Forward -353 -346 14.4934 0.0123
NP_441226.1_7 Reverse -346 -353 14.4934 0.0123
NP_441757.1_3 Reverse -344 -363 2.55606 0.155
NP_441111.1_7 Forward -353 -345 18.7023 0.00294
NP_441111.1_7 Reverse -346 -354 18.7023 0.00294
NP_441111.1_7 Reverse -196 -204 8.96754 0.0463
NP_441766.1_2 Forward -354 -345 17.5026 0.00297
NP_441766.1_2 Reverse -345 -354 17.5026 0.00297
NP_441766.1_2 Reverse -195 -204 6.5879 0.0918
NP_440416.1_9 Forward -361 -342 4.916 0.0355
NP_440416.1_9 Reverse -338 -357 -7.37537 0.0996
NP_440416.1_9 Reverse -259 -278 -17.3068 0.237
NP_440416.1_9 Forward -399 -380 -18.4868 0.259
NP_443052.1_8 Reverse -335 -354 -5.21209 0.127
NP_443052.1_8 Forward -364 -345 -8.65367 0.177
NP_443052.1_8 Forward -232 -213 -9.93197 0.198
NP_440591.1_9 Forward -399 -381 4.34571 0.283
NP_442564.1_10 Reverse -153 -167 10.9143 0.267
NP_440261.1_5 Reverse -346 -359 -1.06236 0.0655
NP_440261.1_5 Forward -353 -340 -4.40561 0.147
NP_440261.1_5 Reverse -196 -209 -10.7971 0.21
NP_440261.1_5 Forward -203 -190 -10.8955 0.221
NP_440261.1_5 Forward -374 -361 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGCCGATTTCCATCGCTTGAGTAGGGAGTTGGCCCAGACCGTCACGGCGATCGCCGACGAGTTAATGGAGGAGGAAAAAATTTGTTGCGAACTGAGTAGTGAATTGGTGTGGTTAGAAATTGAGGGCTATGCCCACGCCTATGAATTGAGGTTTATTTTGTGCCAGGGGCGTAAAGCAGAGGGCGGCTGGCCAGCGGCGATCGTACCGGCATTGTTAAACAGTTTGCAGTCCTTTGACCCAGGGGAAACCTAAACCCACGGTGAACGTCCAAAACCCAGGGGTGGAGGATGGATTTCTGACCTTAGCGACCCAAACAGATTGCCCCAATTCGCTACACTAGCTTTATTGGGTTGACAATCTTCCCCTGCTTTCTTCCCTAAGCTTGCCTGTTAGCGATT

CDS

ATGGTTCGTTTGCTCATGGTATTCCCTCAACGTTTTTCCCCCTCCCATTTGCTATCTCGTCACTGGGGTTGGTTGGCGGTCGCCATGGCCTCCCTAGGGAGCTTGTCTTCCCTGCCCGTCAACGTCAATTCCTCGGTGGTGGCCCAAACGGCCCCTTCTAGTCCCATGACTGTCCGCTCTGATATCCAAGAAGCTAATTCCCAAACCGGGGTGGTGACCGCTAGGGGGAATGTTCAAGTTTACTATCCTGCGCGGAATTTGCAAGCAACGGCGGCCCAGGCCCAATATTTTTCCCAGGAGAGACGTTTAGTCCTTAGTGGCAACGTCTATGTGCTCCAGGACGGCAACAGTATGCGGGCGGAAACCATGACCTATTTAGTGGACGAAGGGCGTTTTGTCGCTAACCCCCAAGCAAATCAACAGGTGGAATCCATTTATCTAGTGGAAGAGTCCCAAAGTCCAGCCGGCCCCGCCCCCACTGGTCCCAATCCTCTCCCCGGTGATACCCTGCCAGATTTGCCGCCCCTGGGTTCTTAG

Protein

MVRLLMVFPQRFSPSHLLSRHWGWLAVAMASLGSLSSLPVNVNSSVVAQTAPSSPMTVRSDIQEANSQTGVVTARGNVQVYYPARNLQATAAQAQYFSQERRLVLSGNVYVLQDGNSMRAETMTYLVDEGRFVANPQANQQVESIYLVEESQSPAGPAPTGPNPLPGDTLPDLPPLGS