Your browser is old and dusty. Try Google Chrome!

Details for slr0241

ORF slr0241
Accession NP_440023.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -46 -60 9.43936 0.0734
NP_441061.1_2 Forward -220 -206 4.91614 0.142
NP_440557.1_1 Reverse -46 -65 1.37609 0.256
NP_440795.1_7 Forward -53 -46 14.6904 0.0123
NP_440795.1_7 Reverse -46 -53 14.6904 0.0123
NP_440795.1_7 Reverse -213 -220 11.3472 0.0978
NP_442291.1_5 Forward -55 -39 3.10679 0.114
NP_442291.1_5 Reverse -44 -60 -3.57971 0.245
NP_441453.1_4 Reverse -45 -53 16.539 0.00633
NP_441453.1_4 Forward -54 -46 16.539 0.00633
NP_441453.1_4 Reverse -212 -220 7.19758 0.0757
NP_441453.1_4 Forward -221 -213 4.93597 0.224
NP_441453.1_4 Forward -47 -39 4.93597 0.224
NP_441453.1_7 Forward -386 -379 14.1988 0.175
NP_442151.1_6 Forward -221 -207 7.66941 0.192
NP_442151.1_6 Reverse -212 -226 7.07942 0.211
NP_442151.1_6 Reverse -45 -59 6.6861 0.224
NP_440561.1_4 Forward -107 -88 16.5175 0.158
NP_441818.1_1 Reverse -46 -57 9.69459 0.232
NP_441818.1_9 Reverse -14 -33 -9.93197 0.291
NP_440226.1_1 Forward -54 -35 6.98095 0.115
NP_440226.1_1 Reverse -45 -64 6.88262 0.118
NP_440348.1_6 Reverse -378 -397 10.6192 0.137
NP_440150.1_2 Reverse -106 -125 4.71854 0.281
NP_442173.1_1 Forward -53 -45 15.4574 0.00633
NP_442173.1_1 Reverse -46 -54 15.4574 0.00633
NP_442173.1_1 Forward -220 -212 5.62429 0.206
NP_442173.1_1 Reverse -111 -119 5.13263 0.226
NP_442173.1_1 Reverse -213 -221 4.73931 0.258
NP_442173.1_1 Forward -313 -305 4.54265 0.27
NP_442173.1_5 Forward -395 -385 15.3426 0.287
NP_442752.1_4 Forward -54 -47 13.8055 0.0199
NP_442752.1_4 Reverse -45 -52 13.8055 0.0199
NP_442752.1_4 Reverse -212 -219 10.8555 0.0846
NP_443027.1_4 Forward -56 -46 14.828 0.0437
NP_443027.1_4 Reverse -303 -313 13.353 0.0521
NP_443027.1_4 Reverse -210 -220 7.35486 0.24
NP_443027.1_4 Reverse -43 -53 5.87989 0.294
NP_441812.1_3 Reverse -44 -58 14.3559 0.126
NP_442975.1_10 Forward -318 -304 6.58715 0.17
NP_442975.1_10 Forward -58 -44 5.30886 0.228
NP_442975.1_10 Reverse -41 -55 3.14559 0.263
NP_440784.1_7 Forward -53 -46 15.9687 0.0123
NP_440784.1_7 Reverse -46 -53 15.9687 0.0123
NP_440784.1_7 Forward -220 -213 12.4288 0.0475
NP_440784.1_7 Forward -313 -306 6.23397 0.241
NP_440784.1_7 Reverse -213 -220 6.23397 0.241
NP_440784.1_7 Reverse -306 -313 6.13563 0.241
NP_440061.1_9 Forward -341 -327 8.45543 0.174
NP_440061.1_9 Forward -389 -375 6.19383 0.255
NP_440061.1_9 Forward -223 -209 5.1122 0.294
NP_441054.1_2 Reverse -149 -168 14.2574 0.171
NP_441054.1_4 Forward -356 -338 -3.22577 0.26
NP_440878.1_9 Reverse -6 -25 6.19431 0.174
NP_440878.1_9 Reverse -327 -346 2.26107 0.177
NP_442062.1_8 Forward -54 -44 19.4496 0.000558
NP_442062.1_8 Reverse -45 -55 19.4496 0.000558
NP_442062.1_8 Reverse -212 -222 7.74818 0.0897
NP_442062.1_8 Forward -221 -211 4.50326 0.212
NP_442062.1_8 Reverse -200 -210 3.51995 0.267
NP_441900.1_1 Forward -222 -203 12.1138 0.222
NP_440304.1_4 Forward -56 -46 10.8948 0.051
NP_440304.1_4 Reverse -26 -36 2.24165 0.299
NP_440304.1_4 Reverse -43 -53 1.84832 0.299
NP_442242.1_4 Forward -53 -46 14.3954 0.0124
NP_442242.1_4 Reverse -46 -53 14.3954 0.0124
NP_442242.1_4 Reverse -306 -313 12.4288 0.0393
NP_440044.1_8 Forward -313 -294 10.0292 0.0612
NP_440044.1_8 Forward -104 -85 -1.47551 0.246
NP_441035.1_3 Forward -186 -167 1.86774 0.227
NP_442602.1_3 Reverse -267 -286 -2.55715 0.261
NP_441200.1_4 Forward -295 -276 5.01433 0.299
NP_440893.1_3 Forward -65 -46 0.588665 0.273
NP_441594.1_6 Forward -192 -173 6.78429 0.186
NP_440370.1_10 Reverse -36 -55 8.06259 0.243
NP_442110.1_7 Forward -105 -91 2.06454 0.222
NP_442110.1_7 Reverse -99 -113 0.392915 0.261
NP_441925.1_4 Forward -36 -17 -14.1609 0.261
NP_440856.1_4 Reverse -205 -224 -0.983855 0.189
NP_440856.1_7 Forward -120 -101 -8.752 0.278
NP_441083.1_5 Forward -54 -44 11.3864 0.0159
NP_441083.1_5 Reverse -45 -55 11.3864 0.0159
NP_441083.1_5 Forward -221 -211 1.16001 0.215
NP_441083.1_5 Reverse -212 -222 -0.118297 0.256
NP_441434.1_7 Forward -52 -38 13.0776 0.0987
NP_441434.1_7 Reverse -40 -54 1.57289 0.299
NP_441738.1_2 Forward -52 -45 15.28 0.0102
NP_441738.1_2 Reverse -47 -54 15.28 0.0102
NP_441738.1_2 Forward -312 -305 11.5435 0.084
NP_441558.1_5 Forward -56 -37 14.0608 0.0523
NP_441558.1_5 Reverse -210 -229 5.70265 0.242
NP_441558.1_5 Reverse -303 -322 5.40766 0.251
NP_441558.1_5 Forward -217 -198 4.42435 0.281
NP_440209.1_1 Reverse -45 -53 18.1123 0.00295
NP_440209.1_1 Forward -54 -46 18.1123 0.00295
NP_440209.1_1 Reverse -212 -220 8.37755 0.0576
NP_440209.1_1 Forward -314 -306 5.62429 0.0821
NP_440209.1_1 Reverse -305 -313 5.23096 0.145
NP_440209.1_1 Forward -47 -39 5.23096 0.145
NP_442889.1_8 Forward -57 -43 13.1753 0.0588
NP_442889.1_8 Reverse -42 -56 10.9137 0.077
NP_441713.1_1 Forward -60 -41 -13.9635 0.257
NP_441713.1_1 Reverse -22 -41 -15.6352 0.268
NP_440178.1_7 Forward -286 -267 -0.787193 0.0225
NP_440178.1_7 Forward -55 -36 -12.2919 0.118
NP_440178.1_7 Reverse -44 -63 -13.7669 0.143
NP_442570.1_3 Reverse -156 -175 -4.42544 0.23
NP_442445.1_1 Forward -338 -319 13.6675 0.225
NP_442111.1_4 Forward -222 -208 1.76955 0.294
NP_441624.1_7 Reverse -206 -220 6.6861 0.275
NP_440906.1_5 Forward -53 -46 15.8704 0.0124
NP_440906.1_5 Reverse -46 -53 15.8704 0.0124
NP_440906.1_5 Forward -313 -306 12.0355 0.0724
NP_440906.1_5 Reverse -306 -313 12.0355 0.0724
NP_440906.1_5 Reverse -213 -220 6.23397 0.234
NP_440906.1_5 Forward -220 -213 6.0373 0.262
NP_440747.1_10 Reverse -209 -221 7.11881 0.00789
NP_440747.1_10 Reverse -42 -54 5.44718 0.0137
NP_440747.1_10 Forward -57 -45 -2.02597 0.0196
NP_441130.1_10 Forward -56 -42 11.7993 0.106
NP_441130.1_10 Reverse -210 -224 5.80112 0.214
NP_441486.1_1 Forward -57 -43 21.2391 0.00239
NP_441486.1_1 Reverse -42 -56 19.0758 0.0036
NP_441486.1_1 Forward -224 -210 0.786239 0.126
NP_440944.1_2 Forward -66 -47 -1.67217 0.259
NP_440403.1_10 Reverse -96 -115 3.04771 0.278
NP_440842.1_10 Reverse -375 -389 4.32615 0.254
NP_441014.1_10 Reverse -44 -63 4.91521 0.194
NP_442848.1_1 Reverse -39 -53 -3.73699 0.27
NP_441012.1_4 Forward -219 -206 13.0973 0.224
NP_443018.1_3 Forward -53 -46 14.8871 0.0123
NP_443018.1_3 Reverse -46 -53 14.8871 0.0123
NP_443018.1_3 Reverse -213 -220 13.8055 0.024
NP_443018.1_3 Forward -220 -213 13.6088 0.0352
NP_443018.1_3 Forward -313 -306 5.34899 0.212
NP_443018.1_3 Reverse -306 -313 5.34899 0.212
NP_441634.1_8 Reverse -210 -224 6.3911 0.114
NP_441634.1_8 Forward -56 -42 2.45787 0.167
NP_441634.1_8 Reverse -43 -57 -4.4253 0.295
NP_441634.1_9 Forward -194 -175 9.63507 0.275
NP_440376.1_1 Forward -54 -45 19.4693 0.000692
NP_440376.1_1 Reverse -45 -54 19.4693 0.000692
NP_440376.1_1 Reverse -212 -221 6.48957 0.0963
NP_440376.1_1 Forward -286 -277 -0.000272808 0.285
NP_440376.1_1 Forward -221 -212 -0.196935 0.285
NP_441588.1_4 Forward -52 -42 16.4996 0.0369
NP_441588.1_4 Reverse -47 -57 6.96153 0.178
NP_441588.1_4 Reverse -40 -50 6.76487 0.185
NP_442687.1_7 Forward -55 -45 15.8113 0.0125
NP_442687.1_7 Reverse -44 -54 15.8113 0.0125
NP_442687.1_7 Forward -222 -212 7.35486 0.134
NP_442583.1_8 Forward -220 -201 8.65258 0.248
NP_440642.1_10 Forward -388 -374 2.8506 0.277
NP_440042.1_2 Reverse -327 -346 0.58944 0.213
NP_440741.1_4 Forward -221 -202 13.9625 0.215
NP_441763.1_10 Forward -65 -46 11.5033 0.143
NP_440360.1_10 Reverse -92 -106 2.5562 0.262
NP_442658.1_1 Reverse -43 -53 15.9091 0.00966
NP_442658.1_1 Forward -56 -46 15.9091 0.00966
NP_442658.1_1 Forward -316 -306 10.4026 0.119
NP_442658.1_1 Reverse -88 -98 9.41933 0.157
NP_442658.1_1 Reverse -210 -220 7.0594 0.214
NP_442658.1_1 Forward -211 -201 4.99446 0.288
NP_441855.2_4 Reverse -329 -348 10.8728 0.24
NP_442782.1_2 Forward -47 -33 3.44117 0.265
NP_442782.1_2 Forward -168 -154 -0.000409212 0.297
NP_441414.1_9 Forward -54 -35 14.2574 0.0129
NP_441414.1_9 Reverse -45 -64 11.5042 0.0181
NP_442937.1_5 Forward -110 -91 10.3242 0.165
NP_442937.1_5 Reverse -207 -226 5.89931 0.295
NP_442321.1_9 Reverse -153 -172 14.5524 0.265
NP_441958.1_5 Forward -55 -45 12.2714 0.00183
NP_441958.1_5 Reverse -44 -54 12.2714 0.00183
NP_441958.1_5 Forward -222 -212 0.865012 0.12
NP_441958.1_5 Reverse -37 -47 -0.511621 0.208
NP_441958.1_5 Reverse -211 -221 -6.60814 0.283
NP_442836.1_5 Forward -60 -41 9.0459 0.137
NP_440203.1_5 Forward -218 -208 8.82935 0.283
NP_442025.1_4 Forward -115 -96 9.63589 0.292
NP_439905.1_1 Reverse -91 -104 6.80412 0.275
NP_439905.1_2 Reverse -175 -189 16.3225 0.188
NP_439905.1_2 Reverse -319 -333 13.9626 0.188
NP_440984.1_7 Reverse -40 -54 9.43936 0.127
NP_439990.1_5 Forward -59 -46 6.70579 0.223
NP_442911.1_2 Reverse -35 -54 7.66927 0.024
NP_442911.1_2 Forward -64 -45 3.53937 0.0428
NP_442911.1_2 Reverse -202 -221 -4.72043 0.14
NP_442911.1_2 Forward -118 -99 -10.522 0.282
NP_441580.1_6 Reverse -294 -313 -7.37537 0.241
NP_440153.1_5 Forward -53 -39 4.03116 0.199
NP_440153.1_5 Forward -107 -93 0.392915 0.299
NP_441591.1_10 Reverse -36 -55 6.58763 0.282
NP_442064.1_4 Reverse -202 -221 11.3067 0.186
NP_443055.1_3 Forward -63 -44 11.8865 0.24
NP_443055.1_6 Reverse -212 -230 -2.24319 0.291
NP_443055.1_6 Reverse -90 -108 -2.34152 0.294
NP_440993.1_3 Reverse -280 -299 -2.26292 0.299
NP_440827.1_3 Reverse -201 -220 14.9458 0.186
NP_440138.1_6 Forward -118 -99 4.03023 0.24
NP_440138.1_6 Forward -220 -201 3.83357 0.24
NP_442002.1_9 Forward -55 -48 10.7572 0.185
NP_442002.1_9 Reverse -44 -51 10.7572 0.185
NP_441294.1_7 Forward -225 -211 15.6819 0.0213
NP_441294.1_7 Reverse -41 -55 13.0902 0.0747
NP_442438.1_10 Reverse -40 -54 11.5043 0.0463
NP_442438.1_10 Forward -59 -45 1.57289 0.191
NP_441000.1_6 Forward -55 -41 13.6676 0.0396
NP_441000.1_6 Reverse -44 -58 4.81781 0.0933
NP_441000.1_6 Reverse -51 -65 -0.983719 0.21
NP_441000.1_6 Forward -315 -301 -4.7203 0.251
NP_440484.1_3 Forward -170 -156 13.7659 0.242
NP_440147.1_4 Reverse -43 -56 11.3273 0.0326
NP_440147.1_4 Forward -223 -210 9.16406 0.0428
NP_440147.1_4 Forward -56 -43 2.18257 0.209
NP_441550.1_8 Forward -223 -213 11.2876 0.052
NP_441550.1_8 Reverse -43 -53 8.3377 0.124
NP_441550.1_8 Forward -56 -46 6.0761 0.214
NP_441550.1_8 Reverse -210 -220 5.38779 0.252
NP_441550.1_8 Reverse -26 -36 4.89613 0.281
NP_441916.1_7 Forward -54 -44 18.4663 0.00144
NP_441916.1_7 Reverse -45 -55 18.4663 0.00144
NP_441916.1_7 Reverse -212 -222 4.79825 0.159
NP_441041.1_4 Forward -54 -35 -2.55715 0.114
NP_441041.1_4 Reverse -45 -64 -2.95047 0.118
NP_441041.1_7 Reverse -42 -54 18.9817 0.00435
NP_441041.1_7 Forward -57 -45 10.916 0.0864
NP_441041.1_7 Forward -122 -110 4.98816 0.282
NP_442396.1_5 Reverse -41 -54 8.47575 0.153
NP_442396.1_5 Forward -58 -45 6.90245 0.215
NP_440569.1_6 Forward -342 -323 3.24438 0.253
NP_441547.1_2 Reverse -201 -219 12.9988 0.108
NP_440703.1_9 Reverse -90 -103 8.57349 0.226
NP_441725.1_5 Reverse -46 -56 11.2881 0.0247
NP_441725.1_5 Forward -53 -43 2.04498 0.115
NP_441725.1_5 Reverse -213 -223 1.25834 0.137
NP_441725.1_5 Forward -313 -303 0.176696 0.206
NP_441725.1_5 Forward -220 -210 -0.511621 0.26
NP_439966.1_7 Forward -56 -46 18.4657 0.00473
NP_439966.1_7 Reverse -43 -53 9.91099 0.0968
NP_439966.1_7 Reverse -210 -220 5.58445 0.216
NP_439966.1_9 Forward -56 -47 0.983037 0.253
NP_439966.1_9 Reverse -43 -52 0.884706 0.253
NP_442941.1_3 Reverse -46 -56 11.4848 0.0116
NP_442941.1_3 Forward -220 -210 9.41981 0.0319
NP_442941.1_3 Forward -53 -43 2.63497 0.14
NP_442941.1_3 Forward -313 -303 0.766681 0.171
NP_440289.1_2 Forward -57 -44 14.6706 0.0107
NP_440289.1_2 Reverse -42 -55 5.91914 0.0605
NP_440983.1_5 Forward -221 -202 -6.1954 0.276
NP_440260.1_8 Reverse -197 -215 -1.16082 0.232
NP_442281.1_1 Reverse -40 -54 12.3887 0.0379
NP_442281.1_1 Forward -59 -45 11.012 0.0511
NP_442281.1_1 Reverse -207 -221 10.5204 0.0576
NP_442281.1_1 Forward -124 -110 2.45727 0.266
NP_440437.1_1 Reverse -39 -58 10.7175 0.0427
NP_441457.1_7 Forward -110 -91 7.07928 0.168
NP_440723.1_4 Reverse -107 -126 -11.1119 0.284
NP_440498.1_1 Reverse -36 -54 6.90232 0.0845
NP_440375.1_8 Forward -53 -34 2.26107 0.23
NP_441644.1_6 Reverse -212 -222 11.5826 0.0463
NP_441644.1_6 Forward -54 -44 10.1076 0.0628
NP_441644.1_6 Reverse -45 -55 10.1076 0.0628
NP_441644.1_6 Forward -221 -211 6.27276 0.163
NP_441644.1_6 Forward -314 -304 5.09279 0.21
NP_441644.1_6 Forward -47 -37 4.99446 0.216
NP_443049.1_6 Reverse -211 -221 11.6409 0.24
NP_442215.1_2 Forward -56 -40 7.2367 0.0694
NP_442215.1_2 Reverse -43 -59 4.68009 0.0831
NP_442215.1_2 Forward -128 -112 -1.02311 0.177
NP_442215.1_2 Reverse -172 -188 -1.12144 0.179
NP_442215.1_2 Forward -223 -207 -5.25134 0.248
NP_440253.1_2 Reverse -337 -355 -0.964162 0.227
NP_440929.1_8 Forward -54 -45 19.2726 0.000701
NP_440929.1_8 Reverse -45 -54 19.2726 0.000701
NP_440929.1_8 Reverse -212 -221 7.66954 0.0624
NP_440929.1_8 Forward -221 -212 7.57121 0.0706
NP_440929.1_8 Reverse -28 -37 4.0313 0.193
NP_440780.1_1 Forward -368 -349 7.59119 0.274
NP_442933.1_5 Reverse -232 -251 8.84924 0.289
NP_442933.1_6 Forward -363 -344 14.4666 0.284
NP_442933.1_10 Forward -54 -45 17.601 0.00325
NP_442933.1_10 Reverse -45 -54 17.601 0.00325
NP_442933.1_10 Reverse -212 -221 5.70292 0.165
NP_442933.1_10 Forward -47 -38 4.42462 0.246
NP_441751.2_8 Reverse -46 -60 12.8809 0.0186
NP_441751.2_8 Forward -220 -206 -4.62196 0.176
NP_442554.1_8 Forward -220 -210 15.123 0.00944
NP_442554.1_8 Reverse -46 -56 13.8447 0.0145
NP_442554.1_8 Forward -53 -43 13.2547 0.0187
NP_442554.1_8 Reverse -213 -223 9.81313 0.0545
NP_442554.1_8 Forward -313 -303 3.91327 0.203
NP_441762.1_7 Forward -55 -43 19.3118 0.00342
NP_441762.1_7 Reverse -44 -56 12.0354 0.0142
NP_441762.1_7 Reverse -89 -101 -3.50094 0.11
NP_441762.1_7 Reverse -304 -316 -4.9759 0.185
NP_441762.1_7 Reverse -37 -49 -7.43418 0.29
NP_442142.1_4 Forward -57 -44 18.4065 0.0255
NP_442142.1_4 Reverse -42 -55 15.1616 0.0289
NP_442142.1_4 Forward -317 -304 7.00021 0.151
NP_442142.1_4 Forward -218 -205 6.31189 0.169
NP_442142.1_4 Reverse -177 -190 4.44361 0.222
NP_442142.1_4 Reverse -107 -120 3.26365 0.262
NP_442292.1_1 Forward -220 -211 15.536 0.0107
NP_442292.1_1 Forward -53 -44 9.63616 0.0183
NP_442292.1_1 Reverse -46 -55 9.63616 0.0183
NP_442292.1_1 Forward -313 -304 7.17789 0.0777
NP_442292.1_1 Reverse -213 -222 -0.786921 0.287
NP_440919.1_9 Forward -270 -251 13.5691 0.229
NP_442143.1_10 Forward -53 -34 12.9791 0.213
NP_440039.1_9 Forward -110 -91 13.3725 0.269
NP_442476.1_6 Forward -53 -39 2.2612 0.188
NP_442476.1_6 Forward -220 -206 0.196253 0.269
NP_440895.1_6 Reverse -206 -219 14.5723 0.202
NP_440895.1_10 Forward -315 -298 0.92382 0.164
NP_441264.1_10 Forward -105 -91 16.5192 0.264
NP_443009.1_5 Reverse -44 -55 11.6612 0.0602
NP_443009.1_5 Forward -55 -44 11.6612 0.0602
NP_443009.1_5 Reverse -211 -222 5.07306 0.218
NP_443009.1_5 Reverse -276 -287 4.58141 0.239
NP_442301.1_2 Reverse -89 -108 5.2102 0.267
NP_441715.1_4 Reverse -46 -56 16.303 0.0117
NP_441715.1_4 Forward -53 -43 9.41981 0.097
NP_441715.1_4 Forward -220 -210 7.55152 0.108
NP_440279.1_2 Reverse -201 -220 7.66927 0.224
NP_440015.1_9 Reverse -45 -63 4.14905 0.163
NP_441448.1_1 Forward -110 -91 10.4225 0.191
NP_442076.1_5 Forward -202 -183 7.96426 0.256
NP_441198.1_8 Forward -223 -213 10.5368 0.265
NP_440379.1_5 Forward -177 -158 0.884433 0.164
NP_441758.1_3 Reverse -30 -48 19.7828 0.153
NP_441468.1_1 Forward -53 -46 15.8704 0.0124
NP_441468.1_1 Reverse -46 -53 15.8704 0.0124
NP_441468.1_1 Reverse -213 -220 13.8055 0.0242
NP_441468.1_1 Forward -313 -306 6.13563 0.209
NP_441468.1_1 Reverse -306 -313 6.0373 0.223
NP_441468.1_1 Forward -220 -213 6.0373 0.223
NP_441020.2_6 Forward -56 -39 12.8219 0.0847
NP_441673.1_1 Forward -54 -45 20.8459 0.000698
NP_441673.1_1 Reverse -45 -54 20.8459 0.000698
NP_441673.1_1 Reverse -212 -221 1.37636 0.114
NP_441673.1_1 Forward -221 -212 1.1797 0.163
NP_441673.1_1 Reverse -96 -105 -7.86675 0.187
NP_441673.1_1 Forward -105 -96 -7.96508 0.206
NP_441826.1_2 Reverse -39 -53 11.111 0.0403
NP_441826.1_2 Forward -60 -46 4.03116 0.105
NP_441826.1_2 Forward -189 -175 0.196253 0.194
NP_441826.1_5 Forward -384 -365 1.67108 0.289
NP_441826.1_5 Reverse -379 -398 0.884433 0.298
NP_442868.1_6 Reverse -210 -220 9.51814 0.0447
NP_442868.1_6 Forward -56 -46 0.963343 0.205
NP_442868.1_6 Reverse -43 -53 0.865012 0.205
NP_441056.1_1 Forward -221 -202 -7.96535 0.282
NP_442427.1_8 Forward -355 -336 7.96426 0.203
NP_442808.1_1 Forward -55 -45 18.4657 0.00201
NP_442808.1_1 Reverse -44 -54 18.4657 0.00201
NP_442808.1_1 Forward -315 -305 7.84605 0.0668
NP_441101.1_1 Forward -110 -92 13.0972 0.231
NP_441315.1_2 Reverse -89 -107 17.0172 0.213
NP_440145.1_3 Reverse -260 -279 -5.50708 0.269
NP_442542.1_2 Reverse -335 -348 10.1474 0.129
NP_442542.1_9 Reverse -31 -45 6.88214 0.219
NP_442542.1_9 Reverse -298 -312 5.89884 0.256
NP_442050.1_5 Forward -56 -46 9.12434 0.193
NP_442050.1_5 Reverse -303 -313 7.64939 0.243
NP_441114.1_3 Forward -70 -61 7.66954 0.231
NP_440558.1_2 Forward -224 -205 -2.65548 0.229
NP_440558.1_2 Forward -129 -110 -6.29373 0.273
NP_441048.1_4 Forward -71 -52 14.4541 0.183
NP_441518.1_3 Forward -115 -96 -14.4552 0.276
NP_441878.1_6 Forward -55 -45 10.4031 0.0176
NP_441878.1_6 Reverse -44 -54 10.4031 0.0176
NP_441878.1_6 Forward -222 -212 9.41981 0.0266
NP_441878.1_6 Reverse -211 -221 1.65166 0.0795
NP_441878.1_6 Reverse -328 -338 -0.0199663 0.163
NP_441878.1_6 Forward -286 -276 -6.60814 0.193
NP_441036.1_8 Forward -55 -45 17.7779 0.000554
NP_441036.1_8 Reverse -44 -54 17.7779 0.000554
NP_441036.1_8 Reverse -37 -47 12.5664 0.0744
NP_441557.1_5 Forward -54 -45 19.9609 0.000699
NP_441557.1_5 Reverse -45 -54 19.9609 0.000699
NP_441557.1_5 Forward -221 -212 7.57121 0.049
NP_441557.1_5 Reverse -212 -221 1.08137 0.0794
NP_441557.1_5 Forward -47 -38 -0.983583 0.272
NP_441557.1_5 Reverse -305 -314 -1.57357 0.291
NP_441445.1_1 Forward -63 -44 4.81767 0.187
NP_442066.2_9 Forward -58 -45 9.36073 0.175
NP_441739.1_2 Reverse -117 -133 4.18776 0.245
NP_441308.1_8 Forward -56 -46 10.1081 0.22
NP_440101.1_3 Reverse -40 -59 1.76941 0.269
NP_440101.1_6 Forward -27 -8 10.7175 0.284
NP_442183.1_1 Reverse -45 -59 13.4709 0.0423
NP_442183.1_9 Reverse -69 -79 10.7964 0.268
NP_441574.1_1 Forward -111 -92 -7.57203 0.292
NP_442347.1_2 Forward -53 -44 11.1111 0.056
NP_442347.1_2 Reverse -46 -55 11.1111 0.056
NP_442645.1_2 Reverse -37 -56 -2.95047 0.0487
NP_442645.1_2 Forward -62 -43 -7.17871 0.102
NP_442645.1_2 Forward -107 -88 -19.9617 0.288
NP_442965.1_1 Reverse -119 -138 8.45592 0.244
NP_441037.1_4 Reverse -43 -53 14.7245 0.028
NP_441037.1_4 Forward -49 -39 9.65667 0.21
NP_441037.1_4 Forward -56 -46 7.02532 0.237
NP_441037.1_4 Forward -223 -213 6.53804 0.255
NP_442594.1_7 Reverse -34 -53 8.25844 0.187
NP_440151.1_2 Reverse -330 -348 14.9646 0.277
NP_441633.1_3 Reverse -43 -56 10.7374 0.0286
NP_441633.1_3 Forward -56 -43 3.65753 0.0699
NP_441633.1_3 Reverse -172 -185 1.88757 0.109
NP_441633.1_3 Forward -39 -26 -6.47056 0.253
NP_441633.1_3 Reverse -210 -223 -6.56889 0.259
NP_440136.1_2 Forward -53 -46 15.9687 0.0123
NP_440136.1_2 Reverse -46 -53 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 11.1505 0.0519
NP_440136.1_2 Reverse -213 -220 6.52896 0.116
NP_440136.1_2 Forward -313 -306 6.23397 0.171
NP_440136.1_2 Reverse -306 -313 6.13563 0.193
NP_440136.1_2 Forward -220 -213 6.13563 0.193
NP_442590.1_10 Reverse -152 -171 9.43923 0.196
NP_442590.1_10 Reverse -38 -57 7.7676 0.219
NP_442590.1_10 Forward -54 -35 6.19431 0.249
NP_442998.1_10 Forward -52 -45 15.5754 0.0102
NP_442998.1_10 Reverse -47 -54 15.5754 0.0102
NP_442998.1_10 Forward -219 -212 6.13563 0.181
NP_442998.1_10 Forward -312 -305 5.84064 0.235
NP_442998.1_10 Reverse -40 -47 5.84064 0.235
NP_440299.1_1 Reverse -41 -54 8.18017 0.0964
NP_440299.1_1 Forward -225 -212 4.34528 0.209
NP_440299.1_1 Reverse -208 -221 2.18201 0.294
NP_440299.1_1 Forward -58 -45 2.18201 0.294
NP_441799.1_1 Reverse -41 -55 16.1252 0.0153
NP_441799.1_1 Forward -58 -44 13.5686 0.0311
NP_441799.1_1 Forward -225 -211 9.43874 0.0922
NP_441799.1_9 Reverse -44 -63 -1.7705 0.213
NP_442802.1_2 Forward -35 -16 13.9616 0.223
NP_441007.1_10 Reverse -207 -220 0.314277 0.233
NP_441007.1_10 Reverse -300 -313 -0.669033 0.287
NP_442334.1_2 Reverse -375 -392 -4.77938 0.2
NP_442201.1_10 Forward -65 -46 -12.9802 0.27
NP_441449.1_8 Reverse -97 -116 14.9535 0.21
NP_440256.1_1 Forward -57 -38 0.884433 0.0791
NP_440256.1_1 Reverse -59 -78 -4.22878 0.15
NP_441559.1_8 Forward -291 -277 0.196253 0.169
NP_441559.1_8 Forward -59 -45 -6.29359 0.276
NP_441559.1_8 Forward -399 -385 -7.76856 0.299
NP_440915.1_6 Reverse -208 -222 8.35772 0.0559
NP_440915.1_6 Reverse -41 -55 3.53951 0.101
NP_440915.1_6 Forward -58 -44 -3.24533 0.292
NP_440915.1_6 Forward -290 -276 -3.44199 0.296
NP_442452.1_3 Reverse -184 -203 3.14605 0.267
NP_442866.1_1 Reverse -153 -172 -9.047 0.288
NP_440748.1_5 Forward -117 -98 5.89931 0.188
NP_440748.1_5 Forward -123 -104 -0.983855 0.264
NP_441464.1_8 Reverse -212 -226 8.94771 0.192
NP_441464.1_8 Forward -33 -19 8.35772 0.198
NP_441464.1_8 Reverse -96 -110 5.40779 0.255
NP_441838.1_10 Reverse -91 -110 11.0125 0.259
NP_441939.1_3 Forward -220 -201 5.99764 0.255
NP_439985.1_7 Forward -227 -208 6.78429 0.192
NP_442993.1_1 Reverse -45 -61 18.9381 0.00415
NP_442386.1_9 Reverse -44 -53 15.7322 0.0144
NP_442386.1_9 Forward -55 -46 15.7322 0.0144
NP_442386.1_9 Reverse -211 -220 11.799 0.0835
NP_442386.1_9 Reverse -89 -98 8.84908 0.182
NP_442386.1_9 Forward -120 -111 8.35743 0.201
NP_442386.1_9 Forward -315 -306 8.06244 0.209
NP_442386.1_9 Reverse -109 -118 4.7192 0.289
NP_441340.1_5 Forward -53 -46 15.6737 0.0124
NP_441340.1_5 Reverse -46 -53 15.6737 0.0124
NP_441340.1_5 Forward -220 -213 13.5105 0.0314
NP_441340.1_5 Reverse -213 -220 6.23397 0.132
NP_441340.1_5 Reverse -306 -313 6.13563 0.175
NP_441340.1_5 Forward -313 -306 5.93897 0.198
NP_441947.1_4 Reverse -85 -104 13.6675 0.215
NP_442484.1_2 Reverse -201 -220 5.99764 0.159
NP_442791.1_5 Forward -55 -36 -8.85033 0.279
NP_442791.1_5 Reverse -109 -128 -8.94866 0.279
NP_442791.1_5 Reverse -37 -56 -11.7019 0.29
NP_442240.1_2 Reverse -46 -65 -14.1602 0.176
NP_440586.1_8 Forward -53 -46 13.2151 0.026
NP_440586.1_8 Reverse -46 -53 13.2151 0.026
NP_440586.1_8 Reverse -306 -313 11.4451 0.0645
NP_440586.1_8 Forward -220 -213 11.3468 0.0736
NP_440586.1_8 Reverse -213 -220 9.47853 0.146
NP_440586.1_8 Forward -46 -39 7.70858 0.227
NP_442251.1_6 Forward -53 -46 15.2804 0.0124
NP_442251.1_6 Reverse -46 -53 15.2804 0.0124
NP_442251.1_6 Forward -313 -306 12.0355 0.0627
NP_440684.1_9 Forward -60 -46 10.1277 0.209
NP_440684.1_9 Forward -53 -39 7.76774 0.253
NP_441262.1_3 Reverse -305 -312 14.8871 0.0223
NP_441262.1_3 Reverse -45 -52 14.7888 0.0223
NP_441262.1_3 Forward -54 -47 14.7888 0.0223
NP_441262.1_3 Reverse -212 -219 5.25066 0.215
NP_440027.1_3 Reverse -35 -53 5.03327 0.249
NP_440027.1_3 Reverse -89 -107 2.87 0.284
NP_440027.1_3 Forward -64 -46 2.08335 0.293
NP_443051.1_1 Reverse -44 -53 10.4228 0.00754
NP_443051.1_1 Forward -55 -46 10.4228 0.00754
NP_443051.1_1 Reverse -304 -313 7.86621 0.0477
NP_443051.1_1 Forward -222 -213 6.19458 0.0849
NP_443051.1_1 Reverse -211 -220 0.688044 0.134
NP_439996.1_9 Forward -213 -194 8.16011 0.284
NP_439984.1_2 Forward -53 -40 11.7207 0.26
NP_439937.1_9 Reverse -179 -196 -3.69841 0.157
NP_440439.1_1 Forward -57 -44 8.37742 0.0537
NP_440439.1_1 Reverse -42 -55 1.39592 0.156
NP_440439.1_1 Reverse -35 -48 -1.06236 0.249
NP_440372.1_2 Forward -53 -46 16.3621 0.0124
NP_440372.1_2 Reverse -46 -53 16.3621 0.0124
NP_440372.1_2 Reverse -306 -313 6.72562 0.0929
NP_440372.1_2 Forward -313 -306 6.62729 0.151
NP_440372.1_2 Reverse -213 -220 6.62729 0.151
NP_440372.1_2 Forward -220 -213 6.52896 0.188
NP_440372.1_2 Reverse -39 -46 4.07068 0.262
NP_442783.1_8 Forward -389 -370 13.8633 0.285
NP_441181.1_2 Forward -398 -379 19.174 0.0333
NP_441789.1_7 Reverse -29 -48 -1.67294 0.253
NP_441803.1_2 Reverse -105 -124 9.93088 0.0928
NP_441803.1_2 Forward -59 -40 1.57275 0.229
NP_441803.1_2 Forward -107 -88 -0.197208 0.269
NP_440139.1_1 Reverse -39 -58 5.01354 0.168
NP_440139.1_1 Forward -60 -41 1.37531 0.263
NP_441572.1_3 Reverse -202 -221 21.2389 0.0211
NP_441572.1_7 Forward -60 -41 3.44104 0.117
NP_441572.1_7 Reverse -206 -225 -1.18052 0.186
NP_441572.1_7 Forward -189 -170 -1.37718 0.188
NP_442384.1_10 Forward -54 -41 7.39411 0.0822
NP_442384.1_10 Reverse -45 -58 6.50913 0.0995
NP_442384.1_10 Forward -221 -208 2.08423 0.237
NP_442384.1_10 Forward -179 -166 1.39592 0.26
NP_442384.1_10 Reverse -117 -130 1.10092 0.268
NP_440364.1_2 Reverse -201 -220 15.4927 0.222
NP_441877.1_7 Reverse -85 -104 -0.492971 0.287
NP_441018.1_7 Forward -130 -111 6.29264 0.294
NP_442262.1_10 Forward -53 -46 14.1988 0.0123
NP_442262.1_10 Reverse -46 -53 14.1988 0.0123
NP_442262.1_10 Reverse -213 -220 13.0188 0.0314
NP_442262.1_10 Forward -220 -213 11.6422 0.092
NP_441689.1_5 Forward -56 -46 8.53436 0.132
NP_440163.1_10 Forward -57 -47 15.2213 0.0762
NP_440344.1_10 Forward -61 -44 1.31714 0.0311
NP_440344.1_10 Reverse -38 -55 -8.41762 0.127
NP_440282.1_10 Forward -331 -312 -6.58872 0.25
NP_440531.1_6 Forward -62 -43 13.9625 0.0397
NP_441060.1_3 Forward -171 -152 17.0107 0.184
NP_442910.1_1 Reverse -205 -224 0.884433 0.156
NP_440189.1_10 Forward -349 -330 3.83436 0.279
NP_442832.1_3 Forward -54 -35 18.9773 0.149
NP_440297.1_9 Reverse -213 -223 9.61647 0.0917
NP_440297.1_9 Reverse -46 -56 9.32148 0.0917
NP_440297.1_9 Forward -220 -210 0.176696 0.282
NP_440297.1_9 Forward -53 -43 -0.118297 0.282
NP_440297.1_9 Forward -313 -303 -0.216628 0.282
NP_442280.1_10 Reverse -155 -173 10.4218 0.223
NP_442280.1_10 Reverse -160 -178 7.69463 0.268
NP_442280.1_10 Reverse -202 -220 7.20763 0.268
NP_440894.1_10 Forward -59 -40 6.58763 0.215
NP_440999.1_9 Forward -58 -44 2.06454 0.154
NP_440888.1_2 Reverse -45 -59 14.5519 0.0168
NP_440888.1_2 Forward -54 -40 11.307 0.0705
NP_440888.1_2 Forward -221 -207 6.39049 0.236
NP_442557.1_2 Forward -348 -330 13.2938 0.212
NP_440052.1_5 Reverse -2 -21 -1.27885 0.195
NP_441759.1_2 Reverse -297 -316 -1.37718 0.298
NP_441543.1_2 Forward -53 -44 18.486 0.00236
NP_441543.1_2 Reverse -46 -55 18.486 0.00236
NP_441543.1_2 Forward -220 -211 14.651 0.0119
NP_442845.1_2 Reverse -206 -220 7.37441 0.195
NP_442845.1_2 Forward -60 -46 6.3911 0.21
NP_442845.1_2 Forward -221 -207 4.42448 0.259
NP_442845.1_2 Forward -125 -111 3.24451 0.298
NP_441551.1_5 Reverse -155 -171 5.95771 0.291
NP_441918.1_7 Forward -146 -127 -2.0655 0.297
NP_441469.1_8 Reverse -44 -53 16.126 0.00797
NP_441469.1_8 Forward -55 -46 16.126 0.00797
NP_441469.1_8 Forward -222 -213 12.4878 0.107
NP_441469.1_8 Forward -315 -306 5.70292 0.257
NP_441469.1_8 Reverse -211 -220 5.3096 0.277
NP_442337.1_8 Forward -200 -181 2.94938 0.217
NP_442578.1_7 Forward -53 -46 14.5921 0.026
NP_442578.1_7 Reverse -46 -53 14.5921 0.026
NP_442578.1_7 Reverse -306 -313 5.93897 0.183
NP_440710.1_1 Reverse -192 -210 -3.02911 0.205
NP_441462.1_2 Forward -54 -44 11.5831 0.00406
NP_441462.1_2 Reverse -45 -55 11.5831 0.00406
NP_441462.1_2 Reverse -212 -222 1.55333 0.0864
NP_441462.1_2 Forward -47 -37 -0.0199663 0.177
NP_441462.1_2 Forward -105 -95 -0.511621 0.236
NP_441621.1_7 Reverse -97 -111 3.44117 0.11
NP_441621.1_7 Forward -56 -42 -3.63866 0.192
NP_441621.1_7 Reverse -43 -57 -3.83532 0.195
NP_441621.1_7 Forward -223 -209 -5.70361 0.26
NP_441621.1_7 Forward -30 -16 -6.39192 0.29
NP_443062.1_1 Reverse -45 -63 19.6618 0.0208
NP_443062.1_1 Forward -54 -36 15.4689 0.0378
NP_443062.1_1 Forward -221 -203 9.03346 0.142
NP_443062.1_1 Forward -314 -296 5.81572 0.218
NP_443062.1_6 Reverse -37 -56 11.9958 0.0996
NP_443062.1_6 Forward -62 -43 2.85105 0.247
NP_442204.1_1 Reverse -208 -219 12.5467 0.0565
NP_442204.1_1 Reverse -34 -45 0.255333 0.282
NP_442204.1_5 Reverse -35 -54 -0.0988766 0.278
NP_442204.1_6 Reverse -278 -297 5.89931 0.269
NP_440516.1_2 Forward -60 -42 7.4923 0.118
NP_440516.1_8 Forward -54 -45 16.9127 0.00442
NP_440516.1_8 Reverse -45 -54 16.9127 0.00442
NP_440516.1_8 Reverse -305 -314 7.86621 0.0516
NP_440516.1_8 Forward -47 -38 6.09625 0.0949
NP_440516.1_8 Reverse -212 -221 -0.196935 0.185
NP_440516.1_8 Forward -346 -337 -0.590259 0.283
NP_442080.1_7 Forward -272 -253 -4.42544 0.296
NP_442428.1_4 Forward -55 -36 3.93269 0.238
NP_442428.1_5 Forward -53 -46 15.8704 0.0124
NP_442428.1_5 Reverse -46 -53 15.8704 0.0124
NP_442428.1_5 Reverse -213 -220 14.1988 0.0242
NP_442428.1_5 Forward -313 -306 6.13563 0.209
NP_442428.1_5 Reverse -306 -313 6.0373 0.212
NP_442428.1_5 Forward -220 -213 6.0373 0.212
NP_442859.1_2 Reverse -46 -65 5.50599 0.201
NP_441835.1_3 Reverse -385 -399 16.5192 0.248
NP_440673.1_2 Reverse -86 -105 7.65814 0.296
NP_440673.1_3 Forward -52 -45 12.4288 0.0426
NP_440673.1_3 Reverse -47 -54 12.4288 0.0426
NP_440673.1_3 Forward -219 -212 11.6422 0.0724
NP_440673.1_3 Forward -312 -305 5.34899 0.298
NP_441052.1_2 Forward -54 -44 10.5014 0.0285
NP_441052.1_2 Reverse -45 -55 10.5014 0.0285
NP_441052.1_2 Forward -221 -211 8.33817 0.0462
NP_442219.1_9 Forward -53 -44 8.35786 0.0681
NP_442219.1_9 Reverse -46 -55 8.35786 0.0681
NP_442219.1_9 Forward -220 -211 7.96454 0.0696
NP_442219.1_9 Forward -118 -109 5.70292 0.135
NP_440436.1_4 Forward -53 -44 18.1905 0.00233
NP_440436.1_4 Reverse -46 -55 18.1905 0.00233
NP_440436.1_4 Forward -220 -211 14.2573 0.0147
NP_440436.1_4 Reverse -181 -190 6.09583 0.172
NP_440436.1_4 Reverse -306 -315 5.80084 0.182
NP_440436.1_4 Reverse -39 -48 5.40752 0.204
NP_441884.1_8 Forward -55 -36 -9.83364 0.268
NP_441884.1_8 Forward -48 -29 -10.3253 0.268
NP_440314.1_9 Reverse -213 -232 -8.16202 0.245
NP_441719.1_4 Forward -53 -46 16.3621 0.0124
NP_441719.1_4 Reverse -46 -53 16.3621 0.0124
NP_441719.1_4 Reverse -306 -313 6.72562 0.093
NP_441719.1_4 Forward -313 -306 6.62729 0.151
NP_441719.1_4 Reverse -213 -220 6.62729 0.151
NP_441719.1_4 Forward -220 -213 6.52896 0.188
NP_441733.1_10 Forward -57 -44 10.2457 0.106
NP_441733.1_10 Reverse -42 -55 10.1474 0.106
NP_441004.1_1 Reverse -379 -398 -15.8318 0.279
NP_442813.1_4 Reverse -8 -27 -8.06369 0.299
NP_442366.1_3 Reverse -44 -62 7.88563 0.0708
NP_442366.1_3 Forward -222 -204 -0.570838 0.194
NP_442366.1_3 Forward -55 -37 -1.75081 0.217
NP_442366.1_5 Reverse -42 -52 12.7626 0.108
NP_442366.1_5 Forward -302 -292 9.91099 0.298
NP_441115.1_4 Forward -55 -37 15.948 0.0333
NP_441115.1_4 Reverse -44 -62 11.2281 0.148
NP_441115.1_4 Forward -48 -30 7.3932 0.286
NP_442206.1_7 Reverse -328 -347 9.53756 0.295
NP_440328.1_4 Forward -53 -34 0.491109 0.25
NP_440328.1_4 Forward -98 -79 -0.197208 0.27
NP_443054.1_2 Forward -56 -42 20.7474 0.0119
NP_443054.1_2 Reverse -275 -289 10.6193 0.0761
NP_443054.1_2 Reverse -43 -57 3.53951 0.24
NP_442430.1_10 Forward -64 -45 11.3067 0.245
NP_440864.1_9 Reverse -9 -28 -4.72043 0.218
NP_441851.1_10 Forward -55 -45 16.008 0.00552
NP_441851.1_10 Reverse -44 -54 16.008 0.00552
NP_441851.1_10 Reverse -211 -221 14.1397 0.0219
NP_441851.1_10 Forward -222 -212 6.07655 0.187
NP_441851.1_10 Reverse -109 -119 4.69992 0.254
NP_442208.1_5 Forward -107 -88 -3.54046 0.258
NP_442208.1_5 Reverse -322 -341 -5.21209 0.26
NP_440611.1_8 Forward -161 -142 12.1925 0.195
NP_442856.1_7 Forward -104 -85 -6.39206 0.297
NP_442515.1_1 Reverse -95 -109 2.45787 0.135
NP_442515.1_1 Reverse -211 -225 2.16287 0.141
NP_442515.1_1 Reverse -44 -58 -4.7203 0.298
NP_440593.1_3 Reverse -285 -304 -5.99873 0.268
NP_441982.1_6 Reverse -122 -131 12.5809 0.274
NP_440463.1_7 Forward -340 -326 14.7492 0.296
NP_440165.1_5 Forward -48 -29 -5.70374 0.226
NP_441046.1_2 Forward -65 -46 1.47442 0.256
NP_440940.1_7 Reverse -35 -53 5.72158 0.225
NP_441349.1_10 Reverse -202 -221 -0.295539 0.0936
NP_441349.1_10 Reverse -35 -54 -0.295539 0.0936
NP_441349.1_10 Forward -64 -45 -9.53865 0.294
NP_441409.1_6 Forward -320 -301 -15.0452 0.275
NP_442314.1_1 Reverse -367 -385 2.18243 0.231
NP_440432.1_9 Forward -313 -298 2.5365 0.115
NP_440432.1_9 Reverse -227 -242 -0.905081 0.167
NP_440432.1_9 Forward -53 -38 -4.05167 0.196
NP_439960.1_4 Reverse -205 -224 13.0766 0.267
NP_439960.1_10 Forward -115 -97 -2.63579 0.257
NP_440474.1_8 Reverse -46 -60 16.5185 0.0486
NP_440474.1_8 Forward -313 -299 5.60385 0.246
NP_441477.1_10 Forward -54 -36 -0.865831 0.294
NP_441124.1_5 Reverse -354 -364 12.3397 0.225
NP_441124.1_5 Reverse -353 -363 10.8118 0.283
NP_442450.1_5 Forward -56 -46 9.32148 0.115
NP_442450.1_5 Reverse -43 -53 7.55152 0.13
NP_442450.1_5 Forward -223 -213 5.78156 0.227
NP_442450.1_5 Forward -185 -175 5.78156 0.227
NP_442168.1_5 Reverse -213 -232 -3.83545 0.293
NP_440588.1_2 Reverse -203 -222 3.34271 0.103
NP_440588.1_2 Forward -63 -44 -1.27885 0.155
NP_440195.1_4 Reverse -33 -52 10.9142 0.154
NP_440195.1_5 Forward -227 -208 5.211 0.256
NP_440023.1_1 Forward -278 -259 28.5154 0.000823
NP_440023.1_2 Forward -104 -85 31.662 0.000161
NP_440023.1_3 Forward -314 -295 29.6954 0.000471
NP_440023.1_4 Forward -380 -361 26.1555 0.00504
NP_440023.1_5 Forward -143 -124 31.8587 0.00000611
NP_440023.1_6 Forward -248 -229 23.7955 0.0129
NP_440023.1_7 Forward -356 -337 22.8122 0.0387
NP_440023.1_8 Forward -50 -31 29.4004 0.000185
NP_440023.1_9 Forward -80 -61 22.8122 0.057
NP_442006.1_2 Forward -339 -322 -4.87771 0.137
NP_442006.1_2 Reverse -377 -394 -17.5624 0.279
NP_442006.1_2 Reverse -369 -386 -18.1524 0.288
NP_442243.1_1 Reverse -206 -224 -2.24319 0.288
NP_441570.1_1 Forward -105 -87 -3.22577 0.0703
NP_441570.1_1 Forward -54 -36 -7.65067 0.0925
NP_441570.1_1 Forward -314 -296 -10.1089 0.16
NP_441570.1_1 Forward -119 -101 -10.5023 0.171
NP_441570.1_1 Reverse -45 -63 -14.0422 0.225
NP_441570.1_1 Forward -47 -29 -17.8771 0.295
NP_440078.1_10 Reverse -45 -64 2.75272 0.269
NP_441078.1_4 Forward -54 -45 19.6659 0.0007
NP_441078.1_4 Reverse -45 -54 19.6659 0.0007
NP_441078.1_4 Reverse -212 -221 7.66954 0.052
NP_441078.1_4 Reverse -201 -210 3.7363 0.131
NP_441078.1_4 Forward -221 -212 0.491382 0.188
NP_442729.1_7 Forward -127 -109 5.32902 0.292
NP_442729.1_8 Forward -58 -45 9.45906 0.125
NP_442348.1_2 Forward -286 -277 10.6195 0.259
NP_442443.1_1 Forward -293 -274 -4.13045 0.268
NP_440526.1_3 Forward -220 -209 8.02298 0.126
NP_440526.1_3 Forward -393 -382 4.58141 0.267
NP_440526.1_3 Forward -53 -42 2.02482 0.267
NP_440526.1_3 Reverse -46 -57 1.92649 0.267
NP_441432.1_8 Reverse -211 -220 14.0611 0.0258
NP_441432.1_8 Reverse -44 -53 8.25953 0.0755
NP_441432.1_8 Forward -55 -46 8.25953 0.0755
NP_441432.1_8 Forward -347 -338 5.40793 0.158
NP_442320.1_8 Reverse -206 -220 -2.55701 0.0913
NP_442320.1_8 Forward -60 -46 -2.55701 0.0913
NP_442320.1_8 Reverse -39 -53 -3.147 0.11
NP_442320.1_8 Reverse -299 -313 -5.11362 0.206
NP_442344.1_7 Forward -53 -34 1.27776 0.0812
NP_441732.1_2 Reverse -92 -108 -16.1661 0.165
NP_442003.1_4 Reverse -213 -232 9.53756 0.3
NP_442815.1_2 Forward -36 -18 6.01734 0.212
NP_440760.1_1 Reverse -45 -64 -10.0303 0.084
NP_440760.1_1 Forward -221 -202 -16.8151 0.187
NP_440760.1_1 Forward -54 -35 -19.9617 0.22
NP_440760.1_7 Reverse -348 -367 8.75009 0.183
NP_440199.1_10 Forward -57 -47 14.533 0.0861
NP_441805.1_2 Forward -119 -100 -1.57384 0.223
NP_441057.1_3 Reverse -321 -340 -1.47551 0.138
NP_442407.1_6 Forward -176 -157 14.1591 0.264
NP_441072.1_2 Forward -58 -39 10.8159 0.194
NP_442489.1_7 Forward -54 -45 20.1576 0.000695
NP_442489.1_7 Reverse -45 -54 20.1576 0.000695
NP_442489.1_7 Reverse -212 -221 8.1612 0.0294
NP_442489.1_7 Forward -221 -212 0.491382 0.178
NP_440386.1_1 Forward -111 -92 -0.0988766 0.257
NP_440559.1_1 Reverse -46 -55 8.75118 0.0586
NP_440559.1_1 Forward -53 -44 8.75118 0.0586
NP_440559.1_1 Forward -220 -211 7.76787 0.0918
NP_440559.1_1 Reverse -213 -222 6.68623 0.134
NP_440559.1_1 Forward -313 -304 4.52295 0.26
NP_441659.2_8 Forward -54 -44 11.9764 0.0147
NP_441659.2_8 Reverse -45 -55 11.9764 0.0147
NP_441659.2_8 Forward -221 -211 6.56821 0.0714
NP_441659.2_8 Reverse -212 -222 6.27322 0.0797
NP_441659.2_8 Forward -47 -37 4.79825 0.125
NP_441659.2_8 Reverse -99 -109 2.83163 0.187
NP_442749.1_5 Forward -144 -127 13.2369 0.159
NP_441022.1_1 Forward -207 -198 12.4095 0.232
NP_440363.1_9 Forward -80 -62 17.0304 0.179
NP_442913.1_10 Reverse -36 -55 0.786102 0.151
NP_441040.1_2 Reverse -362 -381 -6.39206 0.181
NP_440708.1_6 Reverse -320 -339 1.86774 0.188
NP_441800.1_3 Reverse -201 -219 16.3421 0.173
NP_441800.1_3 Forward -220 -202 3.95239 0.289
NP_442776.1_1 Forward -332 -313 6.4893 0.226
NP_442346.1_5 Reverse -211 -221 14.6313 0.0115
NP_442346.1_5 Forward -55 -45 9.02648 0.118
NP_442346.1_5 Reverse -44 -54 9.02648 0.118
NP_442346.1_5 Forward -222 -212 7.35486 0.172
NP_440545.1_3 Forward -225 -208 8.20031 0.0462
NP_440545.1_3 Reverse -95 -112 3.0871 0.089
NP_440545.1_3 Reverse -208 -225 -4.18939 0.22
NP_440545.1_3 Reverse -41 -58 -4.97604 0.237
NP_440545.1_3 Forward -112 -95 -6.746 0.287
NP_441629.1_1 Forward -197 -178 9.73422 0.189
NP_441629.1_1 Forward -229 -210 5.50599 0.298
NP_441923.1_9 Forward -29 -10 11.4058 0.232
NP_440004.1_5 Reverse -300 -319 16.2241 0.216
NP_440459.1_2 Reverse -36 -53 17.0501 0.0834
NP_440459.1_2 Forward -348 -331 12.1336 0.158
NP_440459.1_2 Forward -56 -39 7.90532 0.276
NP_440010.1_3 Reverse -365 -384 1.47442 0.25
NP_440010.1_10 Forward -390 -371 3.04771 0.264
NP_442311.1_4 Forward -113 -94 14.7491 0.127
NP_442603.1_7 Forward -299 -285 5.80051 0.273
NP_440449.1_6 Reverse -329 -347 4.6571 0.294
NP_441948.1_4 Reverse -38 -56 7.78729 0.0623
NP_441833.1_4 Forward -53 -46 15.9687 0.0124
NP_441833.1_4 Reverse -46 -53 15.9687 0.0124
NP_441833.1_4 Forward -313 -306 14.1004 0.0258
NP_441833.1_4 Reverse -213 -220 6.23397 0.163
NP_441833.1_4 Reverse -306 -313 6.13563 0.198
NP_441833.1_4 Forward -220 -213 6.13563 0.198
NP_442162.1_9 Forward -53 -46 16.2637 0.0124
NP_442162.1_9 Reverse -46 -53 16.2637 0.0124
NP_442162.1_9 Forward -313 -306 6.62729 0.142
NP_442162.1_9 Reverse -213 -220 6.62729 0.142
NP_442162.1_9 Reverse -306 -313 6.52896 0.178
NP_442162.1_9 Forward -220 -213 6.43063 0.208
NP_440788.1_8 Forward -23 -4 7.17762 0.286
NP_440671.1_4 Forward -60 -46 9.73436 0.172
NP_440671.1_4 Reverse -206 -220 9.43936 0.184
NP_440671.1_4 Forward -25 -11 6.58777 0.243
NP_440671.1_4 Forward -189 -175 6.29277 0.252
NP_440671.1_4 Reverse -39 -53 5.60446 0.279
NP_442045.1_5 Reverse -296 -315 -0.000545616 0.266
NP_442199.1_5 Reverse -204 -223 -7.4737 0.296
NP_442140.1_3 Reverse -306 -316 16.4996 0.0255
NP_442140.1_3 Forward -53 -43 16.2046 0.0255
NP_442140.1_3 Reverse -213 -223 13.5497 0.0542
NP_442140.1_3 Reverse -46 -56 8.33817 0.119
NP_442140.1_3 Forward -220 -210 6.46988 0.168
NP_441671.1_6 Reverse -201 -220 11.7008 0.179
NP_440875.1_9 Forward -52 -42 8.46937 0.233
NP_440875.1_9 Reverse -47 -57 8.37203 0.233
NP_441813.1_5 Forward -56 -46 17.188 0.00979
NP_441813.1_5 Reverse -43 -53 9.91146 0.021
NP_441813.1_5 Reverse -210 -220 8.4365 0.0432
NP_441813.1_5 Reverse -303 -313 5.28991 0.138
NP_441813.1_5 Forward -316 -306 0.373358 0.203
NP_440590.1_4 Forward -53 -40 10.049 0.0314
NP_440590.1_4 Reverse -39 -52 6.80412 0.0565
NP_440590.1_4 Reverse -46 -59 5.32916 0.0585
NP_440590.1_4 Forward -220 -207 2.96921 0.0783
NP_440590.1_4 Reverse -111 -124 -1.75067 0.228
NP_440567.1_1 Forward -53 -39 9.63603 0.0422
NP_440567.1_1 Reverse -46 -60 4.91614 0.109
NP_440567.1_1 Reverse -306 -320 2.65453 0.167
NP_440567.1_1 Forward -220 -206 -0.393733 0.281
NP_442497.1_10 Forward -53 -44 10.4228 0.0087
NP_442497.1_10 Reverse -46 -55 10.4228 0.0087
NP_442497.1_10 Reverse -213 -222 8.25953 0.047
NP_442497.1_10 Forward -313 -304 5.99792 0.095
NP_442497.1_10 Forward -220 -211 0.589713 0.153
NP_440821.1_4 Forward -56 -46 19.0562 0.00399
NP_440821.1_4 Reverse -43 -53 10.2065 0.0163
NP_440821.1_4 Reverse -108 -118 2.92996 0.131
NP_440821.1_4 Reverse -303 -313 0.668351 0.159
NP_440821.1_4 Forward -223 -213 0.57002 0.169
NP_440821.1_4 Reverse -210 -220 -0.314959 0.251
NP_441239.1_9 Forward -56 -44 15.8703 0.0178
NP_441239.1_9 Reverse -43 -55 14.887 0.0247
NP_441239.1_9 Reverse -327 -339 11.4454 0.0607
NP_441239.1_9 Forward -223 -211 11.347 0.0627
NP_441239.1_9 Reverse -210 -222 4.16888 0.26
NP_441239.1_9 Reverse -172 -184 3.2839 0.289
NP_440706.1_1 Reverse -41 -60 -3.54046 0.258
NP_442643.1_3 Reverse -379 -398 -2.0655 0.252
NP_440354.1_7 Reverse -32 -50 6.70565 0.278
NP_442052.1_3 Reverse -158 -177 13.7658 0.152
NP_440546.1_4 Forward -54 -44 11.8882 0.0679
NP_440546.1_4 Reverse -45 -55 11.8882 0.0679
NP_440546.1_4 Forward -47 -37 10.5308 0.109
NP_440462.1_6 Forward -56 -46 15.418 0.0142
NP_440462.1_6 Reverse -43 -53 9.02648 0.0498
NP_442611.1_1 Forward -113 -94 -2.36049 0.292
NP_440868.1_4 Forward -58 -46 10.7571 0.0364
NP_440868.1_4 Reverse -41 -53 8.79043 0.0582
NP_440868.1_4 Forward -318 -306 2.79224 0.148
NP_442499.1_4 Forward -128 -114 11.5043 0.226
NP_441868.1_4 Reverse -163 -177 12.0943 0.284
NP_442402.1_4 Forward -140 -121 -10.2277 0.298
NP_441848.1_4 Reverse -350 -366 10.7974 0.241
NP_441084.1_6 Reverse -36 -50 13.7072 0.125
NP_440696.1_3 Reverse -170 -188 4.9357 0.198
NP_440696.1_3 Reverse -202 -220 -2.73412 0.279
NP_440696.1_3 Forward -225 -207 -3.12744 0.282
NP_442882.1_3 Reverse -366 -385 6.4893 0.178
NP_442039.1_4 Forward -53 -46 15.1821 0.0124
NP_442039.1_4 Reverse -46 -53 15.1821 0.0124
NP_442039.1_4 Reverse -213 -220 6.3323 0.289
NP_441926.1_3 Reverse -45 -61 7.13836 0.17
NP_440825.1_7 Forward -53 -43 12.4217 0.155
NP_442837.1_3 Forward -53 -46 15.7721 0.0124
NP_442837.1_3 Reverse -46 -53 15.7721 0.0124
NP_442837.1_3 Forward -313 -306 6.13563 0.25
NP_442837.1_3 Reverse -213 -220 6.0373 0.25
NP_442837.1_3 Reverse -306 -313 5.93897 0.265
NP_442837.1_3 Forward -220 -213 5.93897 0.265
NP_440160.1_2 Forward -339 -320 4.71934 0.217
NP_439994.1_3 Forward -328 -309 13.7064 0.118
NP_442053.1_1 Forward -54 -45 18.3876 0.0007
NP_442053.1_1 Reverse -45 -54 18.3876 0.0007
NP_440505.1_3 Forward -56 -46 13.8447 0.0247
NP_440505.1_3 Forward -348 -338 12.0747 0.0596
NP_440505.1_3 Reverse -210 -220 9.32148 0.122
NP_440505.1_3 Forward -288 -278 8.82982 0.133
NP_440505.1_3 Reverse -43 -53 6.76487 0.169
NP_440505.1_7 Forward -203 -184 6.58763 0.163
NP_440505.1_7 Forward -112 -93 -2.55715 0.289
NP_441203.1_1 Forward -220 -201 -19.0768 0.297
NP_440308.1_6 Forward -31 -12 0.491109 0.296
NP_440914.1_1 Forward -119 -109 12.5188 0.0569
NP_440914.1_1 Forward -314 -304 9.98138 0.164
NP_440914.1_1 Forward -54 -44 8.6151 0.186
NP_440914.1_1 Reverse -45 -55 8.6151 0.186
NP_441011.1_8 Forward -53 -44 16.9127 0.00602
NP_441011.1_8 Reverse -46 -55 16.9127 0.00602
NP_441011.1_8 Reverse -306 -315 5.60459 0.247
NP_442533.1_6 Forward -54 -45 17.2076 0.00137
NP_442533.1_6 Reverse -45 -54 17.2076 0.00137
NP_442533.1_6 Forward -221 -212 7.66954 0.0897
NP_442533.1_6 Reverse -212 -221 6.8829 0.101
NP_442533.1_6 Forward -338 -329 3.83464 0.202
NP_442533.1_6 Reverse -330 -339 3.83464 0.202
NP_442533.1_6 Reverse -96 -105 2.65466 0.246
NP_442533.1_6 Forward -47 -38 2.35967 0.259
NP_442541.1_10 Reverse -276 -290 8.75042 0.218
NP_442541.1_10 Forward -386 -372 6.0955 0.248
NP_442229.1_1 Forward -56 -42 12.0937 0.18
NP_442229.1_1 Reverse -43 -57 10.8154 0.18
NP_443016.1_1 Forward -344 -325 -5.50708 0.247
NP_441482.1_7 Reverse -206 -220 -0.983719 0.0612
NP_441482.1_7 Reverse -90 -104 -10.9151 0.222
NP_439944.1_9 Reverse -46 -56 10.3048 0.0887
NP_439944.1_9 Forward -313 -303 5.68323 0.231
NP_441697.1_5 Forward -366 -347 -8.26048 0.258
NP_440116.1_8 Forward -53 -34 10.5209 0.0295
NP_441527.1_4 Forward -22 -3 -9.1199 0.255
NP_440115.1_6 Reverse -209 -219 6.27322 0.191
NP_440007.1_9 Reverse -208 -222 10.521 0.163
NP_441680.1_5 Forward -182 -163 19.2723 0.106
NP_441347.1_5 Reverse -206 -220 8.94708 0.283
NP_441972.1_5 Forward -220 -201 2.65439 0.121
NP_441972.1_5 Reverse -175 -194 -2.75381 0.19
NP_441106.1_1 Reverse -44 -53 18.191 0.0028
NP_441106.1_1 Forward -55 -46 18.191 0.0028
NP_441106.1_1 Reverse -211 -220 6.48957 0.0895
NP_441106.1_1 Forward -315 -306 5.70292 0.131
NP_441106.1_1 Reverse -37 -46 4.52295 0.219
NP_439903.1_1 Reverse -120 -139 -0.000545616 0.236
NP_439903.1_6 Reverse -197 -216 9.43841 0.124
NP_441286.1_1 Reverse -44 -56 4.95553 0.027
NP_441286.1_1 Reverse -211 -223 -3.40261 0.145
NP_441286.1_1 Forward -55 -43 -3.50094 0.145
NP_441286.1_1 Forward -38 -26 -5.36923 0.197
NP_441286.1_1 Forward -347 -335 -5.76255 0.223
NP_440092.1_9 Forward -112 -93 16.3224 0.235
NP_440670.1_8 Forward -54 -45 18.3876 0.000699
NP_440670.1_8 Reverse -45 -54 18.3876 0.000699
NP_440670.1_8 Reverse -212 -221 6.78456 0.099
NP_440670.1_8 Reverse -38 -47 6.68623 0.105
NP_440670.1_8 Forward -221 -212 5.3096 0.167
NP_440670.1_8 Forward -314 -305 4.81794 0.18
NP_441886.1_9 Reverse -13 -32 19.5673 0.196
NP_441930.1_2 Forward -286 -276 14.9263 0.19
NP_440886.1_7 Forward -55 -45 17.7774 0.0011
NP_440886.1_7 Reverse -44 -54 17.7774 0.0011
NP_440886.1_7 Reverse -98 -108 6.66608 0.115
NP_440886.1_7 Forward -48 -38 3.22451 0.291
NP_442614.1_2 Reverse -45 -59 7.17775 0.275
NP_442614.1_2 Reverse -212 -226 6.58777 0.291
NP_439995.1_5 Forward -64 -45 5.70265 0.276
NP_442072.1_9 Forward -55 -37 14.4738 0.00501
NP_442072.1_9 Reverse -44 -62 -12.6655 0.0877
NP_439899.1_1 Reverse -352 -370 3.40863 0.299
NP_441753.1_10 Reverse -29 -48 2.65439 0.228
NP_440907.2_8 Forward -53 -43 14.2375 0.0312
NP_440907.2_8 Reverse -46 -56 7.84605 0.117
NP_440907.2_8 Reverse -213 -223 4.60114 0.257
NP_442264.1_5 Reverse -200 -214 14.3559 0.225
NP_441021.1_1 Forward -220 -201 -7.17871 0.182
NP_441021.1_8 Reverse -40 -58 18.2104 0.0605
NP_441463.1_6 Reverse -198 -212 5.64286 0.287
NP_441626.1_2 Forward -53 -46 15.7721 0.0124
NP_441626.1_2 Reverse -46 -53 15.7721 0.0124
NP_441626.1_2 Forward -18 -11 7.6106 0.119
NP_441626.1_2 Reverse -213 -220 6.52896 0.137
NP_441626.1_2 Forward -313 -306 6.0373 0.212
NP_441626.1_2 Reverse -306 -313 6.0373 0.212
NP_441626.1_2 Forward -220 -213 5.93897 0.231
NP_441460.1_2 Forward -389 -376 13.2934 0.289
NP_442794.1_1 Reverse -208 -220 17.4436 0.0205
NP_442615.1_1 Reverse -36 -54 6.11567 0.0364
NP_441962.1_4 Forward -33 -14 -14.9469 0.296
NP_440387.1_1 Reverse -45 -61 5.95839 0.0297
NP_440387.1_1 Forward -54 -38 5.56507 0.0315
NP_441431.1_2 Forward -57 -43 9.93039 0.172
NP_441431.1_2 Reverse -25 -39 7.96378 0.23
NP_441431.1_2 Forward -102 -88 7.17714 0.247
NP_441431.1_2 Reverse -209 -223 6.98048 0.255
NP_441431.1_2 Reverse -42 -56 5.99717 0.281
NP_441431.1_2 Reverse -374 -388 5.50552 0.298
NP_441488.1_8 Reverse -207 -221 8.94708 0.17
NP_441836.1_1 Reverse -250 -269 11.9863 0.277
NP_440634.1_1 Forward -348 -329 13.4708 0.26
NP_441993.1_1 Forward -285 -266 6.91701 0.177
NP_441993.1_1 Reverse -159 -178 1.55686 0.274
NP_441993.1_1 Reverse -45 -64 0.484826 0.298
NP_440814.1_4 Reverse -36 -55 -3.3438 0.144
NP_440814.1_4 Forward -63 -44 -11.7019 0.228
NP_440114.1_5 Reverse -28 -47 13.0775 0.212
NP_440114.1_10 Forward -54 -40 14.1593 0.0429
NP_440114.1_10 Forward -314 -300 13.8643 0.0481
NP_440114.1_10 Reverse -45 -59 13.5693 0.0531
NP_440114.1_10 Reverse -212 -226 10.9143 0.13
NP_440114.1_10 Reverse -38 -52 10.4227 0.148
NP_441510.2_7 Forward -25 -11 18.6818 0.163
NP_440287.1_6 Forward -56 -37 11.1109 0.129
NP_440287.1_6 Reverse -36 -55 3.04771 0.226
NP_440287.1_6 Reverse -303 -322 2.65439 0.232
NP_441272.1_7 Forward -132 -122 13.648 0.257
NP_440293.1_3 Reverse -157 -176 7.07928 0.184
NP_440293.1_9 Reverse -159 -173 15.0163 0.178
NP_440293.1_9 Reverse -201 -215 10.9577 0.261
NP_440293.1_10 Forward -194 -175 -2.65548 0.274
NP_440766.1_4 Forward -58 -44 8.25939 0.0871
NP_440766.1_4 Reverse -301 -315 3.53951 0.146
NP_441421.1_6 Forward -369 -352 10.4608 0.279
NP_442743.1_4 Forward -220 -201 -1.7705 0.203
NP_440643.1_6 Forward -220 -201 2.16274 0.262
NP_442103.1_2 Forward -117 -99 23.9127 0.0282
NP_442930.1_1 Forward -358 -348 10.501 0.276
NP_439910.1_2 Forward -62 -45 -2.3211 0.0305
NP_439910.1_2 Reverse -37 -54 -3.8944 0.0691
NP_442867.1_8 Forward -385 -366 13.3725 0.171
NP_442867.1_8 Reverse -152 -171 4.916 0.277
NP_440457.1_1 Reverse -208 -220 5.05386 0.149
NP_440457.1_1 Reverse -41 -53 0.825626 0.25
NP_440457.1_1 Forward -58 -46 -0.0593532 0.25
NP_440798.1_6 Forward -53 -40 14.5723 0.0423
NP_440798.1_6 Reverse -39 -52 4.44418 0.145
NP_440798.1_6 Reverse -213 -226 3.46087 0.151
NP_440801.1_9 Reverse -162 -176 12.4475 0.288
NP_441984.1_6 Forward -344 -332 20.3935 0.048
NP_440473.1_1 Reverse -209 -228 14.8245 0.135
NP_440473.1_9 Forward -65 -46 -9.24366 0.26
NP_442509.1_9 Forward -54 -44 16.2041 0.00739
NP_442509.1_9 Reverse -45 -55 16.2041 0.00739
NP_442514.1_5 Reverse -322 -341 -7.6711 0.279
NP_440554.1_4 Reverse -46 -56 14.6313 0.02
NP_440554.1_4 Forward -313 -303 7.84651 0.0928
NP_440554.1_4 Forward -53 -43 7.35486 0.103
NP_440554.1_4 Forward -46 -36 7.25653 0.106
NP_440554.1_4 Forward -220 -210 5.97822 0.128
NP_441885.1_5 Forward -54 -44 11.4848 0.00668
NP_441885.1_5 Reverse -45 -55 11.4848 0.00668
NP_441885.1_5 Forward -221 -211 1.84832 0.0957
NP_440478.1_9 Forward -342 -323 7.66927 0.287
NP_440478.1_10 Forward -223 -209 6.58777 0.288
NP_442341.1_7 Reverse -44 -58 16.0275 0.0189
NP_442341.1_7 Forward -55 -41 10.0294 0.0682
NP_442341.1_9 Reverse -43 -57 7.76712 0.187
NP_442341.1_9 Forward -56 -42 6.39049 0.228
NP_442341.1_9 Reverse -102 -116 5.40719 0.271
NP_441756.1_5 Reverse -326 -345 -3.14714 0.288
NP_441173.1_9 Forward -361 -353 11.8187 0.222
NP_442534.1_7 Forward -55 -36 9.93088 0.221
NP_440423.1_6 Forward -62 -43 -16.4218 0.232
NP_443000.1_7 Reverse -210 -220 10.2065 0.0355
NP_443000.1_7 Forward -56 -46 8.73149 0.0437
NP_443000.1_7 Reverse -43 -53 1.94665 0.226
NP_440275.1_3 Forward -56 -46 8.4365 0.0602
NP_440275.1_3 Reverse -43 -53 8.33817 0.0602
NP_440275.1_3 Reverse -210 -220 5.38824 0.153
NP_440275.1_3 Reverse -36 -46 2.14332 0.271
NP_440091.1_1 Reverse -41 -53 12.6253 0.0353
NP_440091.1_1 Forward -58 -46 10.7571 0.0429
NP_443060.1_5 Reverse -109 -128 5.89851 0.252
NP_442275.1_1 Reverse -277 -296 5.211 0.267
NP_440679.1_10 Reverse -12 -31 -20.7484 0.286
NP_443010.1_7 Reverse -171 -190 10.6184 0.278
NP_443010.1_10 Reverse -42 -59 6.05634 0.193
NP_441122.1_1 Forward -130 -115 10.7963 0.225
NP_441122.1_1 Reverse -112 -127 3.32315 0.281
NP_439962.1_4 Reverse -329 -348 -3.73712 0.257
NP_439962.1_4 Forward -387 -368 -7.27704 0.288
NP_439962.1_4 Forward -30 -11 -7.76869 0.29
NP_442214.1_1 Reverse -152 -171 6.98095 0.298
NP_442214.1_7 Forward -98 -79 17.2346 0.219
NP_441105.1_3 Reverse -201 -220 12.3892 0.0343
NP_441105.1_3 Forward -344 -325 -1.7705 0.151
NP_440216.1_1 Forward -54 -40 17.5025 0.00188
NP_440216.1_1 Reverse -45 -59 -1.47537 0.0328
NP_440216.1_1 Forward -47 -33 -3.83532 0.09
NP_440216.1_1 Reverse -38 -52 -11.4068 0.184
NP_440216.1_1 Reverse -212 -226 -12.6851 0.296
NP_440216.1_1 Reverse -201 -215 -12.6851 0.296
NP_440216.1_9 Forward -213 -204 8.25953 0.286
NP_440172.1_1 Forward -54 -44 8.73149 0.0586
NP_440172.1_1 Reverse -45 -55 8.73149 0.0586
NP_440172.1_1 Forward -47 -37 7.05986 0.0929
NP_440172.1_1 Reverse -212 -222 6.96153 0.0959
NP_442418.1_4 Forward -367 -349 11.5565 0.259
NP_442015.1_10 Reverse -208 -221 8.86907 0.0585
NP_442015.1_10 Forward -225 -212 3.85419 0.178
NP_442015.1_10 Reverse -41 -54 1.88757 0.204
NP_442015.1_10 Forward -58 -45 0.805932 0.218
NP_441226.1_7 Forward -53 -46 14.4934 0.0123
NP_441226.1_7 Reverse -46 -53 14.4934 0.0123
NP_441226.1_7 Forward -220 -213 14.1984 0.024
NP_441111.1_7 Forward -53 -45 18.7023 0.00294
NP_441111.1_7 Reverse -46 -54 18.7023 0.00294
NP_441111.1_7 Forward -220 -212 8.86921 0.0589
NP_441766.1_2 Forward -54 -45 17.5026 0.00297
NP_441766.1_2 Reverse -45 -54 17.5026 0.00297
NP_441766.1_2 Forward -221 -212 6.39124 0.0993
NP_441766.1_2 Forward -47 -38 4.52295 0.179
NP_441766.1_9 Forward -386 -367 -2.95047 0.29
NP_440416.1_9 Reverse -205 -224 -5.99873 0.0854
NP_440416.1_9 Reverse -38 -57 -18.6834 0.262
NP_443052.1_8 Reverse -35 -54 -9.24366 0.187
NP_442564.1_10 Forward -379 -365 8.16106 0.296
NP_440261.1_5 Reverse -46 -59 -2.93064 0.0983
NP_440261.1_5 Reverse -213 -226 -6.07724 0.193
NP_440261.1_5 Forward -53 -40 -10.5021 0.201
NP_440261.1_5 Forward -36 -23 -10.5021 0.201
NP_440261.1_5 Forward -220 -207 -12.4687 0.297
NP_440988.1_10 Forward -217 -203 10.1267 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCCCCAACAATTGTCCCTGGGCCCCCTGGAGCAGGAAATTTTACAAATTATCTGGCAATTGGGCCAGGCCACGGTGAAAGATATCCACGATCGCATTTTGAGCGACCCTGACCGGGAATTGGCCTACTCTTCGGTAACCACGGTGTTAAATCGGCTCACAAAGAAGGGCTGGTTAGTGTGCCATCGCCAGGGCAAAGCCTTTATTTGGACGGCAAGGGTGAGTGCAGACCAGGCCAAAGCGGTGCAGTCCTACGAACAATTACAGCAGTTTTTGGCCATTAGCAATCCCGATGTGGTGGCCGCCTTTGCTGACAGTTTAGACACCGCTAGCATTGACCAGTTAACGGCGATCGCCGATCGTTTGCGGGCGGCCCGACAACAGCGACAGGAGGAGAAATA

CDS

ATGCACAGTATTTTGTTTGCCATTGCAGTTTTAATTGCCTTTGGCCTGCGTTGGGCCATTCGTTGCTGGCCGGGCGGATTATCTTGGTCCATAGCGTTAGGCTTTTTTGCCCTTCCCCCCCTACTGTTGATTACCACTAGCATGGCGATCGCCTGGATGGGCTGTGGTTGGATGTTTGGCTTCCCCGCTAGCATGGGCAGTCACTTTCTCGCTTGGCTATTTTTGCTCTGGACAGCAGTTTGTGTTGCCAACCTTACCTGGCAAACTTGGCAAACGTTGGCGGCGGTAAAAGTTCATCCGTTGGCCGATTGGCAAGGACAAAAAATTCGTCTTTTGGATACTCCTTTTCCCTACAGCGCCCAGGTGGGATTATGGTCACCGGAACTGGTAGTAAGTCAGGGTTTATTGAAATTGCTGTCTCCGGAACAGGTAAATGCGGTCTTAGCCCATGAAAATGCCCATCGTTTTTACCGGGATACTTGGACGTTTTTCTGGTTAGGATGCCTGCGTCGCCTAACTTTTTGGCTACCGGAAACGGAATCTTTATGGCAGGAATTACTGTGGCAGAGGGAATGTCGAGCCGATCGCCATGGGGCAAAAAACTGTGATCCCTTGCTCCTGGCGGAAGCCCTGGCCCTAGTGTCCCAAAATTCCATCGTTGCCAATCCCATTCCTTTGGCAGTGCCCTTTTCTGGTCAACAAGACCGCTTACTAGCCCGCATTGACCATTTACTAGGTTTTTCCATTACCCCGGATTCCCACCGTTTAGCTAGCTGGGTTGGATCTTTCCTTCTCCTGGTGATCGCCATTTTGCCCCTGATTTTGATTCCTTTACATATAAAGTAA

Protein

MHSILFAIAVLIAFGLRWAIRCWPGGLSWSIALGFFALPPLLLITTSMAIAWMGCGWMFGFPASMGSHFLAWLFLLWTAVCVANLTWQTWQTLAAVKVHPLADWQGQKIRLLDTPFPYSAQVGLWSPELVVSQGLLKLLSPEQVNAVLAHENAHRFYRDTWTFFWLGCLRRLTFWLPETESLWQELLWQRECRADRHGAKNCDPLLLAEALALVSQNSIVANPIPLAVPFSGQQDRLLARIDHLLGFSITPDSHRLASWVGSFLLLVIAILPLILIPLHIK