Your browser is old and dusty. Try Google Chrome!

Details for slr0240

ORF slr0240
Accession NP_440022.1
Symbol
Category transcriptional regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_5 Forward -305 -286 12.8808 0.247
NP_441061.1_2 Reverse -173 -187 1.27789 0.192
NP_441061.1_2 Reverse -268 -282 0.786239 0.199
NP_440795.1_7 Forward -180 -173 14.6904 0.0123
NP_440795.1_7 Reverse -173 -180 14.6904 0.0123
NP_441418.1_6 Reverse -172 -191 -21.24 0.143
NP_441418.1_6 Forward -181 -162 -30.3848 0.274
NP_441453.1_4 Forward -181 -173 16.539 0.00633
NP_441453.1_4 Reverse -172 -180 7.8859 0.0536
NP_442151.1_6 Forward -181 -167 6.29277 0.24
NP_441818.1_1 Forward -180 -169 12.0545 0.145
NP_441818.1_9 Forward -323 -304 -2.36049 0.203
NP_440226.1_1 Forward -181 -162 6.78429 0.119
NP_442744.1_1 Reverse -255 -274 17.3057 0.096
NP_442173.1_1 Reverse -173 -181 15.4574 0.00633
NP_442173.1_1 Forward -180 -172 8.27922 0.101
NP_442752.1_4 Forward -181 -174 13.8055 0.0199
NP_443027.1_4 Forward -183 -173 11.8781 0.0872
NP_442975.1_10 Reverse -168 -182 3.8339 0.252
NP_440784.1_7 Forward -180 -173 15.9687 0.0123
NP_440784.1_7 Reverse -173 -180 15.9687 0.0123
NP_441054.1_2 Forward -299 -280 9.83255 0.284
NP_442062.1_8 Reverse -172 -182 9.91146 0.0554
NP_442062.1_8 Forward -181 -171 9.41981 0.0625
NP_441859.1_3 Forward -182 -163 4.71854 0.215
NP_440304.1_4 Reverse -170 -180 8.1415 0.0859
NP_440304.1_4 Forward -183 -173 1.84832 0.299
NP_442242.1_4 Forward -180 -173 14.3954 0.0124
NP_442242.1_4 Reverse -173 -180 14.3954 0.0124
NP_442097.1_3 Reverse -337 -356 13.8633 0.269
NP_441208.1_9 Forward -43 -29 6.19444 0.253
NP_441594.1_6 Reverse -175 -194 1.37609 0.268
NP_441594.1_6 Reverse -152 -171 -0.000545616 0.294
NP_440370.1_10 Reverse -163 -182 7.37428 0.258
NP_442276.1_5 Reverse -168 -186 20.0787 0.0643
NP_442367.1_10 Forward -310 -296 12.0943 0.279
NP_442726.1_7 Reverse -374 -392 -1.75081 0.297
NP_441925.1_2 Reverse -235 -254 1.37609 0.278
NP_440856.1_4 Forward -188 -169 0.982764 0.161
NP_440856.1_4 Reverse -265 -284 -1.47551 0.201
NP_440856.1_7 Reverse -326 -345 -2.36049 0.191
NP_441083.1_5 Reverse -172 -182 10.1081 0.0208
NP_441083.1_5 Forward -181 -171 9.61647 0.0243
NP_442827.1_8 Reverse -177 -196 5.60352 0.115
NP_441738.1_2 Reverse -174 -181 15.28 0.0102
NP_441955.1_8 Forward -187 -170 11.8386 0.207
NP_440209.1_1 Forward -181 -173 18.1123 0.00295
NP_440209.1_1 Reverse -172 -180 15.1624 0.00583
NP_442889.1_8 Reverse -343 -357 4.62054 0.26
NP_442889.1_8 Reverse -37 -51 3.53891 0.275
NP_440178.1_7 Forward -182 -163 -21.6334 0.232
NP_442059.1_10 Forward -380 -361 18.879 0.0774
NP_441716.1_1 Forward -181 -167 4.42448 0.256
NP_441327.1_5 Reverse -86 -95 14.651 0.192
NP_442111.1_4 Reverse -171 -185 20.4524 0.00311
NP_440906.1_5 Forward -180 -173 15.8704 0.0124
NP_440906.1_5 Reverse -173 -180 15.8704 0.0124
NP_440747.1_10 Forward -184 -172 7.31547 0.00577
NP_440747.1_10 Reverse -169 -181 -11.7607 0.142
NP_440747.1_10 Forward -161 -149 -12.2524 0.254
NP_441130.1_10 Forward -183 -169 10.7177 0.112
NP_441130.1_10 Reverse -170 -184 10.1277 0.117
NP_442634.1_2 Reverse -323 -342 9.43923 0.144
NP_442634.1_4 Reverse -170 -184 -4.81863 0.22
NP_441265.1_3 Reverse -166 -180 3.63784 0.181
NP_441695.1_7 Reverse -300 -319 10.6192 0.235
NP_441014.1_10 Forward -159 -140 -1.8696 0.267
NP_442848.1_5 Reverse -296 -314 -2.3408 0.285
NP_441012.1_4 Reverse -174 -187 5.62415 0.291
NP_443018.1_3 Forward -180 -173 14.8871 0.0123
NP_443018.1_3 Reverse -173 -180 14.8871 0.0123
NP_441316.1_7 Reverse -170 -185 -2.97003 0.273
NP_441634.1_8 Forward -183 -169 5.21113 0.114
NP_440376.1_1 Forward -181 -172 9.73449 0.0365
NP_440376.1_1 Reverse -172 -181 9.63616 0.0385
NP_440376.1_1 Forward -307 -298 1.96635 0.236
NP_440376.1_1 Reverse -125 -134 1.76968 0.242
NP_441588.1_4 Reverse -42 -52 6.46988 0.193
NP_442687.1_7 Reverse -171 -181 15.8113 0.0125
NP_442687.1_7 Forward -182 -172 6.76487 0.154
NP_441077.1_6 Reverse -8 -24 7.81502 0.224
NP_441077.1_6 Forward -375 -359 2.60905 0.276
NP_440741.1_4 Reverse -172 -191 17.2074 0.11
NP_442658.1_1 Forward -183 -173 17.0891 0.00615
NP_442658.1_1 Reverse -170 -180 15.5158 0.0122
NP_442658.1_1 Forward -337 -327 7.35439 0.214
NP_442658.1_1 Forward -269 -259 5.68278 0.258
NP_440141.1_8 Forward -276 -257 7.47261 0.24
NP_442782.1_7 Forward -189 -170 1.86774 0.193
NP_442205.1_7 Forward -297 -279 23.8152 0.0183
NP_442544.1_6 Forward -188 -169 -6.29373 0.298
NP_441414.1_9 Reverse -172 -191 -6.49039 0.196
NP_441487.1_9 Forward -182 -163 2.45773 0.18
NP_441478.1_10 Forward -152 -134 4.14829 0.289
NP_442321.1_4 Reverse -264 -283 -1.96717 0.27
NP_441958.1_5 Reverse -171 -181 10.6981 0.0112
NP_441958.1_5 Forward -182 -172 3.12662 0.0364
NP_441127.1_1 Forward -270 -256 8.25939 0.3
NP_442605.1_4 Reverse -175 -194 9.24257 0.279
NP_442376.1_2 Reverse -167 -186 -10.0303 0.286
NP_442690.1_1 Reverse -232 -251 -16.6185 0.29
NP_442911.1_2 Forward -191 -172 6.09597 0.03
NP_440153.1_5 Reverse -173 -187 0.786239 0.289
NP_442064.1_4 Forward -168 -149 8.4551 0.232
NP_443055.1_3 Reverse -140 -159 12.2685 0.224
NP_443055.1_6 Reverse -164 -182 18.9962 0.0484
NP_442236.1_3 Reverse -252 -271 18.6823 0.0907
NP_440993.1_2 Forward -186 -170 1.92682 0.272
NP_441129.1_2 Forward -318 -299 20.354 0.044
NP_441129.1_3 Reverse -168 -187 -17.8968 0.296
NP_441099.1_5 Reverse -162 -181 9.24257 0.0328
NP_442002.1_9 Forward -182 -175 10.7572 0.185
NP_441000.1_6 Reverse -171 -185 8.35772 0.0882
NP_441000.1_6 Forward -182 -168 -4.7203 0.251
NP_440147.1_4 Forward -183 -170 10.344 0.0355
NP_440147.1_4 Reverse -170 -183 0.904263 0.244
NP_441175.1_2 Forward -196 -177 7.37428 0.226
NP_441550.1_8 Reverse -170 -180 16.2041 0.0132
NP_441550.1_8 Forward -183 -173 8.82935 0.112
NP_441916.1_7 Reverse -172 -182 10.2065 0.0266
NP_441916.1_7 Forward -181 -171 7.55152 0.0639
NP_440465.1_10 Reverse -169 -188 4.42435 0.228
NP_441041.1_7 Reverse -169 -181 19.2733 0.00407
NP_441041.1_7 Forward -184 -172 13.637 0.0485
NP_441547.1_2 Forward -192 -174 6.31233 0.215
NP_441725.1_4 Forward -186 -172 14.9452 0.0693
NP_441725.1_5 Forward -180 -170 16.7946 0.0247
NP_441725.1_5 Reverse -173 -183 2.04498 0.115
NP_439966.1_7 Forward -183 -173 17.9741 0.00631
NP_439966.1_7 Reverse -170 -180 8.82935 0.13
NP_439966.1_7 Reverse -38 -48 4.99446 0.248
NP_439966.1_9 Reverse -170 -179 9.93116 0.186
NP_439966.1_9 Forward -183 -174 0.884706 0.253
NP_442941.1_3 Reverse -173 -183 10.7964 0.0116
NP_440289.1_2 Reverse -169 -182 13.884 0.0123
NP_440289.1_2 Forward -184 -171 12.704 0.0139
NP_440289.1_2 Reverse -271 -284 -1.94734 0.251
NP_440260.1_7 Forward -104 -85 -5.31042 0.261
NP_442281.1_1 Reverse -167 -181 11.012 0.0511
NP_442281.1_1 Forward -186 -172 10.8154 0.0537
NP_441079.1_7 Reverse -89 -108 -7.27777 0.29
NP_442256.1_2 Reverse -170 -188 0.0191479 0.131
NP_440437.1_1 Reverse -372 -391 -3.04881 0.232
NP_442500.1_8 Forward -375 -361 18.7585 0.103
NP_442012.1_1 Forward -344 -325 6.19431 0.136
NP_442012.1_1 Forward -187 -168 0.0977854 0.248
NP_443030.1_3 Reverse -166 -184 10.7372 0.183
NP_441644.1_6 Forward -181 -171 11.9759 0.0408
NP_441644.1_6 Reverse -172 -182 7.45273 0.124
NP_443049.1_6 Forward -182 -172 11.0554 0.282
NP_442215.1_2 Forward -285 -269 6.35172 0.0719
NP_442247.1_8 Forward -183 -169 11.3077 0.247
NP_440253.1_2 Forward -181 -163 18.2104 0.00943
NP_440253.1_2 Reverse -172 -190 2.77242 0.131
NP_440929.1_8 Forward -181 -172 9.93116 0.0249
NP_440929.1_8 Reverse -172 -181 9.83282 0.0254
NP_442933.1_10 Forward -181 -172 9.04618 0.063
NP_442933.1_10 Reverse -172 -181 8.94785 0.0643
NP_441751.2_8 Reverse -173 -187 -1.5737 0.129
NP_441751.2_8 Forward -180 -166 -6.29359 0.259
NP_442554.1_8 Reverse -173 -183 14.1397 0.0144
NP_442554.1_8 Forward -180 -170 7.45319 0.092
NP_442554.1_8 Reverse -268 -278 4.10993 0.198
NP_441762.1_7 Forward -182 -170 13.8053 0.0142
NP_441762.1_7 Reverse -171 -183 4.07055 0.0572
NP_442142.1_4 Reverse -169 -182 17.1282 0.0264
NP_442142.1_4 Forward -161 -148 6.11523 0.173
NP_442142.1_4 Forward -184 -171 5.23026 0.197
NP_442142.1_4 Reverse -37 -50 4.14862 0.231
NP_442292.1_1 Reverse -173 -182 9.63616 0.0183
NP_442292.1_1 Forward -180 -171 0.688044 0.23
NP_442292.1_5 Forward -352 -333 2.45773 0.257
NP_442476.1_6 Reverse -173 -187 10.3243 0.0704
NP_442381.1_8 Forward -184 -165 -13.8652 0.28
NP_442381.1_8 Reverse -169 -188 -14.5535 0.283
NP_443009.1_5 Reverse -171 -182 10.8746 0.0717
NP_443009.1_5 Reverse -297 -308 4.18809 0.259
NP_441715.1_4 Reverse -173 -183 18.8596 0.00741
NP_441198.1_8 Reverse -170 -180 12.0017 0.167
NP_441198.1_8 Reverse -29 -39 10.3415 0.28
NP_441468.1_1 Forward -180 -173 15.8704 0.0124
NP_441468.1_1 Reverse -173 -180 15.8704 0.0124
NP_441020.2_6 Reverse -170 -187 11.0519 0.13
NP_441020.2_6 Forward -310 -293 6.62702 0.26
NP_441673.1_1 Forward -181 -172 11.1111 0.0121
NP_441673.1_1 Reverse -172 -181 11.0128 0.018
NP_441731.1_3 Forward -189 -170 12.3892 0.159
NP_441731.1_9 Reverse -111 -128 12.3302 0.234
NP_441016.2_6 Forward -167 -148 11.7 0.215
NP_441826.1_2 Forward -187 -173 1.96621 0.137
NP_441826.1_2 Reverse -166 -180 0.982901 0.167
NP_441826.1_5 Forward -341 -322 3.14605 0.271
NP_442811.1_2 Reverse -147 -166 12.0942 0.113
NP_442490.1_9 Reverse -149 -168 5.60432 0.161
NP_441764.1_8 Reverse -85 -95 12.842 0.284
NP_442868.1_6 Reverse -170 -180 16.4996 0.0156
NP_442868.1_6 Forward -183 -173 10.3048 0.038
NP_442719.1_2 Reverse -366 -384 -7.25804 0.232
NP_442808.1_1 Forward -159 -149 13.0576 0.0481
NP_442808.1_1 Reverse -171 -181 9.12434 0.0481
NP_442808.1_1 Forward -182 -172 8.73102 0.0481
NP_440871.1_3 Reverse -43 -57 16.002 0.166
NP_442692.1_10 Reverse -236 -249 15.8434 0.216
NP_440145.1_3 Reverse -162 -181 7.86593 0.0466
NP_440145.1_3 Reverse -139 -158 -5.21209 0.261
NP_442542.1_2 Reverse -170 -183 8.57408 0.154
NP_442542.1_2 Forward -183 -170 7.00078 0.197
NP_442050.1_5 Reverse -170 -180 13.9425 0.0265
NP_442050.1_5 Forward -183 -173 6.96107 0.27
NP_442789.1_4 Reverse -110 -129 -5.01543 0.265
NP_441518.1_3 Reverse -162 -181 -11.3086 0.259
NP_441878.1_6 Reverse -171 -181 10.4031 0.0176
NP_441878.1_6 Forward -182 -172 0.668351 0.139
NP_441878.1_6 Forward -308 -298 -7.29646 0.217
NP_441878.1_6 Reverse -273 -283 -7.49312 0.231
NP_441878.1_6 Reverse -148 -158 -7.68978 0.255
NP_441036.1_3 Reverse -214 -233 -4.13045 0.271
NP_441036.1_8 Forward -182 -172 8.1415 0.176
NP_441036.1_8 Reverse -171 -181 6.07655 0.242
NP_441557.1_5 Forward -181 -172 10.8161 0.00464
NP_441557.1_5 Reverse -172 -181 10.4228 0.00915
NP_441445.1_1 Reverse -140 -159 10.8159 0.0928
NP_442066.2_4 Forward -283 -264 -1.08219 0.182
NP_441433.1_8 Forward -257 -238 0.786102 0.238
NP_442962.1_1 Forward -318 -299 6.78429 0.241
NP_442183.1_1 Forward -181 -167 17.3058 0.0116
NP_441407.1_5 Reverse -162 -181 10.1275 0.147
NP_441574.1_1 Reverse -255 -274 -6.39206 0.277
NP_441467.1_5 Reverse -5 -15 15.9097 0.232
NP_442170.1_5 Forward -181 -162 10.5209 0.0567
NP_442347.1_2 Reverse -173 -182 11.1111 0.056
NP_442645.1_2 Reverse -164 -183 -21.535 0.29
NP_441037.1_4 Reverse -170 -180 9.75413 0.21
NP_441037.1_4 Forward -183 -173 6.92787 0.237
NP_442317.1_6 Forward -186 -167 16.3224 0.0832
NP_442317.1_6 Reverse -26 -45 3.04771 0.264
NP_441633.1_3 Forward -183 -170 15.1623 0.0109
NP_440136.1_2 Forward -180 -173 15.9687 0.0123
NP_440136.1_2 Reverse -173 -180 15.9687 0.0123
NP_442590.1_10 Forward -393 -374 4.62101 0.273
NP_442998.1_10 Reverse -174 -181 15.5754 0.0102
NP_442998.1_10 Forward -179 -172 5.84064 0.235
NP_440299.1_1 Forward -185 -172 9.5568 0.0699
NP_441799.1_1 Reverse -168 -182 10.717 0.0683
NP_442528.1_6 Reverse -358 -377 13.7658 0.211
NP_441007.1_10 Reverse -167 -180 8.9674 0.108
NP_440256.1_1 Forward -327 -308 -9.63698 0.284
NP_441362.1_4 Forward -249 -231 7.4923 0.292
NP_441559.1_8 Forward -186 -172 2.5562 0.143
NP_441270.1_5 Forward -59 -40 10.8472 0.296
NP_440915.1_6 Forward -185 -171 18.6825 0.0113
NP_440915.1_6 Reverse -168 -182 -3.04867 0.29
NP_441179.1_9 Forward -160 -150 15.1225 0.246
NP_442452.1_3 Reverse -204 -223 3.14605 0.267
NP_441464.1_8 Forward -181 -167 9.93102 0.187
NP_441464.1_8 Reverse -298 -312 4.81781 0.263
NP_441464.1_10 Forward -51 -37 15.4376 0.166
NP_442386.1_9 Forward -182 -173 15.7322 0.0144
NP_442386.1_9 Reverse -171 -180 8.35743 0.201
NP_441750.1_1 Forward -276 -257 -8.752 0.3
NP_441750.1_4 Forward -185 -166 9.93088 0.157
NP_441340.1_5 Forward -180 -173 15.6737 0.0124
NP_441340.1_5 Reverse -173 -180 15.6737 0.0124
NP_440168.1_9 Forward -278 -259 -2.75381 0.285
NP_442240.1_1 Forward -189 -170 3.34192 0.29
NP_440161.1_3 Reverse -170 -189 12.8808 0.162
NP_441027.1_1 Reverse -230 -244 12.487 0.27
NP_440586.1_8 Forward -180 -173 13.2151 0.026
NP_440586.1_8 Reverse -173 -180 13.2151 0.026
NP_442251.1_6 Forward -180 -173 15.2804 0.0124
NP_442251.1_6 Reverse -173 -180 15.2804 0.0124
NP_442959.1_5 Forward -254 -235 8.06259 0.229
NP_442959.1_7 Reverse -242 -261 -5.01543 0.295
NP_441262.1_3 Forward -181 -174 14.7888 0.0223
NP_441262.1_3 Reverse -172 -179 6.52896 0.0809
NP_440027.1_3 Reverse -298 -316 3.16499 0.278
NP_443051.1_1 Forward -182 -173 10.4228 0.00754
NP_443051.1_1 Reverse -171 -180 8.65285 0.029
NP_439937.1_8 Reverse -170 -189 -3.24547 0.266
NP_439937.1_9 Reverse -297 -314 1.21811 0.0948
NP_439937.1_9 Reverse -171 -188 -0.748498 0.122
NP_439937.1_9 Forward -42 -25 -10.5815 0.231
NP_439937.1_9 Forward -41 -24 -15.9897 0.287
NP_439937.1_9 Forward -182 -165 -16.678 0.287
NP_442294.1_3 Forward -20 -6 13.372 0.269
NP_442294.1_3 Forward -45 -31 11.9953 0.294
NP_440439.1_1 Forward -184 -171 11.229 0.0339
NP_440372.1_2 Forward -180 -173 16.3621 0.0124
NP_440372.1_2 Reverse -173 -180 16.3621 0.0124
NP_440171.1_3 Reverse -158 -177 11.5042 0.209
NP_441789.1_7 Reverse -305 -324 -4.1312 0.28
NP_440819.1_5 Forward -245 -237 7.8859 0.266
NP_440316.1_10 Forward -182 -172 10.8948 0.218
NP_442488.1_7 Reverse -88 -107 13.7658 0.193
NP_439977.1_5 Forward -187 -168 -1.86883 0.263
NP_440139.1_1 Reverse -166 -185 3.04693 0.218
NP_441572.1_7 Reverse -166 -185 -2.26216 0.193
NP_442384.1_10 Reverse -172 -185 10.2457 0.0465
NP_442114.1_4 Reverse -172 -183 18.0532 0.107
NP_441631.1_6 Reverse -164 -183 15.7324 0.293
NP_442790.1_4 Forward -190 -171 3.34271 0.0729
NP_442262.1_10 Forward -180 -173 14.1988 0.0123
NP_442262.1_10 Reverse -173 -180 14.1988 0.0123
NP_440344.1_10 Reverse -165 -182 6.72535 0.0169
NP_440344.1_10 Forward -188 -171 -7.13932 0.115
NP_440344.1_10 Reverse -290 -307 -13.0392 0.273
NP_440282.1_10 Reverse -160 -179 -6.29373 0.25
NP_440531.1_6 Forward -284 -265 -5.50708 0.299
NP_441965.1_10 Reverse -169 -185 8.515 0.125
NP_442556.1_10 Forward -316 -297 12.173 0.217
NP_440297.1_9 Forward -180 -170 1.06167 0.282
NP_440297.1_9 Reverse -173 -183 -0.118297 0.282
NP_440350.1_5 Forward -85 -66 -6.68705 0.297
NP_443036.1_1 Forward -332 -313 18.4848 0.138
NP_440999.1_9 Forward -185 -171 7.9644 0.0802
NP_440888.1_2 Reverse -172 -186 12.2903 0.0476
NP_440888.1_2 Forward -336 -322 5.40719 0.28
NP_442225.1_10 Forward -177 -158 10.3234 0.206
NP_439969.1_3 Forward -312 -293 -0.787193 0.271
NP_441787.1_1 Forward -296 -277 18.3873 0.167
NP_442033.1_10 Reverse -170 -189 -7.4737 0.186
NP_442033.1_10 Reverse -296 -315 -13.8652 0.291
NP_441917.1_2 Reverse -146 -164 6.60732 0.288
NP_441543.1_2 Reverse -173 -182 18.486 0.00236
NP_441178.1_6 Reverse -371 -390 5.89851 0.268
NP_441469.1_8 Forward -182 -173 16.126 0.00797
NP_441469.1_8 Reverse -171 -180 12.6844 0.0995
NP_442578.1_7 Forward -180 -173 14.5921 0.026
NP_442578.1_7 Reverse -173 -180 14.5921 0.026
NP_441462.1_2 Forward -181 -171 17.8763 0.00406
NP_441462.1_2 Reverse -172 -182 1.74999 0.0811
NP_441621.1_7 Reverse -170 -184 14.3559 0.0266
NP_441621.1_7 Forward -183 -169 -1.8687 0.188
NP_443062.1_1 Reverse -172 -190 11.0811 0.105
NP_443062.1_6 Forward -189 -170 4.81767 0.214
NP_442204.1_1 Forward -185 -174 11.5634 0.0565
NP_441560.1_3 Reverse -268 -286 6.01734 0.283
NP_440544.1_5 Forward -13 -6 14.5681 0.264
NP_440544.1_5 Forward -75 -68 13.8024 0.28
NP_440255.1_7 Forward -358 -341 8.59364 0.277
NP_440516.1_6 Forward -225 -211 7.86545 0.262
NP_440516.1_8 Forward -181 -172 18.9776 0.00442
NP_440516.1_8 Reverse -172 -181 7.07956 0.0867
NP_442768.1_6 Forward -221 -202 18.289 0.234
NP_442428.1_5 Forward -180 -173 15.8704 0.0124
NP_442428.1_5 Reverse -173 -180 15.8704 0.0124
NP_440673.1_2 Reverse -139 -158 8.5361 0.266
NP_440673.1_3 Forward -179 -172 13.1171 0.0426
NP_440673.1_3 Reverse -174 -181 12.4288 0.0426
NP_440865.1_9 Reverse -166 -185 9.73422 0.0539
NP_441052.1_2 Reverse -172 -182 11.0914 0.0285
NP_441052.1_2 Forward -181 -171 0.668351 0.256
NP_442219.1_9 Forward -180 -171 8.84951 0.0681
NP_442219.1_9 Reverse -173 -182 8.35786 0.0681
NP_440436.1_4 Reverse -173 -182 18.1905 0.00233
NP_440436.1_4 Forward -180 -171 6.78414 0.147
NP_441884.1_8 Reverse -171 -190 -5.9004 0.2
NP_441884.1_9 Reverse -169 -188 -25.2716 0.29
NP_442086.1_3 Forward -180 -161 18.1907 0.0584
NP_441321.1_5 Reverse -205 -224 8.55425 0.242
NP_440314.1_9 Forward -180 -161 -0.39387 0.107
NP_440314.1_9 Reverse -82 -101 -5.60541 0.225
NP_441719.1_4 Forward -180 -173 16.3621 0.0124
NP_441719.1_4 Reverse -173 -180 16.3621 0.0124
NP_441733.1_10 Reverse -169 -182 17.8172 0.034
NP_441733.1_10 Forward -184 -171 8.18076 0.14
NP_441004.1_1 Reverse -112 -131 -12.1936 0.245
NP_442366.1_3 Reverse -171 -189 0.117479 0.178
NP_440129.1_10 Forward -188 -174 13.7659 0.0534
NP_442873.1_5 Reverse -374 -393 11.11 0.246
NP_442206.1_1 Reverse -31 -50 -13.2752 0.25
NP_442206.1_10 Reverse -172 -187 9.91133 0.146
NP_440328.1_4 Reverse -119 -138 6.4893 0.129
NP_440728.1_1 Forward -372 -353 13.3716 0.216
NP_443054.1_2 Forward -183 -169 8.06273 0.13
NP_442430.1_2 Forward -168 -149 3.04771 0.268
NP_442430.1_10 Forward -345 -326 10.2251 0.265
NP_441851.1_10 Forward -182 -172 8.53483 0.114
NP_441851.1_10 Reverse -171 -181 8.1415 0.122
NP_442515.1_1 Reverse -30 -44 0.589577 0.187
NP_442515.1_1 Reverse -273 -287 -1.77037 0.263
NP_442515.1_1 Forward -182 -168 -3.147 0.287
NP_441396.1_5 Forward -48 -39 8.75118 0.21
NP_442689.1_8 Forward -95 -78 -7.63097 0.292
NP_441349.1_10 Forward -191 -172 -6.58872 0.233
NP_441349.1_10 Forward -400 -381 -8.65367 0.278
NP_440432.1_9 Forward -180 -165 15.3195 0.0135
NP_442843.1_1 Forward -275 -256 -8.45701 0.255
NP_442843.1_1 Forward -48 -29 -10.7186 0.28
NP_439960.1_10 Forward -188 -170 -3.32411 0.27
NP_442450.1_5 Reverse -170 -180 10.4031 0.115
NP_440588.1_2 Forward -190 -171 14.4541 0.0162
NP_440195.1_5 Reverse -166 -185 7.57094 0.175
NP_442006.1_2 Forward -276 -259 -17.5624 0.279
NP_443047.1_7 Forward -180 -161 13.4708 0.0963
NP_440483.1_1 Forward -186 -167 -7.86702 0.272
NP_441078.1_4 Forward -181 -172 9.93116 0.0203
NP_441078.1_4 Reverse -172 -181 9.83282 0.0226
NP_441078.1_4 Reverse -149 -158 5.99792 0.0932
NP_441078.1_4 Forward -158 -149 -1.96689 0.282
NP_441663.1_8 Forward -187 -168 -1.57384 0.243
NP_442443.1_1 Forward -48 -29 -3.04881 0.264
NP_442443.1_4 Reverse -84 -94 14.4342 0.227
NP_440526.1_3 Forward -180 -169 11.4645 0.0646
NP_441432.1_8 Forward -182 -173 8.25953 0.0755
NP_441432.1_8 Reverse -148 -157 3.14632 0.259
NP_442320.1_8 Forward -187 -173 6.19444 0.029
NP_442320.1_8 Reverse -166 -180 5.70279 0.0334
NP_441732.1_2 Forward -185 -169 -16.1661 0.165
NP_440629.1_4 Forward -386 -367 13.9625 0.217
NP_442815.1_3 Forward -49 -30 11.3075 0.25
NP_440685.1_6 Forward -184 -165 15.8299 0.251
NP_440760.1_1 Forward -181 -162 -20.5517 0.223
NP_440199.1_10 Reverse -146 -156 15.713 0.0861
NP_441945.1_10 Forward -277 -258 8.16093 0.277
NP_441805.1_1 Reverse -62 -81 6.39097 0.082
NP_440913.1_1 Reverse -123 -141 3.3624 0.299
NP_442751.1_2 Forward -159 -140 10.815 0.187
NP_442400.1_10 Reverse -235 -248 9.13351 0.271
NP_442489.1_7 Forward -181 -172 10.4228 0.0151
NP_442489.1_7 Reverse -172 -181 10.3245 0.0193
NP_442489.1_7 Reverse -149 -158 -1.77023 0.247
NP_440757.1_7 Reverse -322 -340 -0.865831 0.269
NP_440386.1_6 Forward -193 -174 2.75194 0.258
NP_442079.1_7 Forward -180 -161 5.70265 0.17
NP_440559.1_1 Forward -180 -171 9.14451 0.0586
NP_440559.1_1 Reverse -173 -182 8.75118 0.0586
NP_441659.2_8 Forward -181 -171 9.81313 0.0269
NP_441659.2_8 Reverse -172 -182 2.43831 0.2
NP_442913.1_10 Reverse -116 -135 -0.39387 0.159
NP_441040.1_2 Forward -189 -170 -10.9153 0.25
NP_442008.1_2 Forward -392 -373 14.0608 0.0814
NP_442008.1_2 Reverse -169 -188 3.14605 0.262
NP_440779.1_5 Forward -181 -164 -13.7275 0.224
NP_442346.1_5 Reverse -171 -181 14.1397 0.0164
NP_442346.1_5 Reverse -148 -158 10.7964 0.0854
NP_440545.1_3 Reverse -168 -185 4.85706 0.0661
NP_441943.1_5 Forward -252 -233 15.509 0.247
NP_441943.1_8 Reverse -57 -76 -12.8819 0.261
NP_440847.1_3 Forward -165 -151 12.3887 0.249
NP_440847.1_3 Reverse -300 -314 11.897 0.254
NP_442603.1_7 Reverse -172 -186 6.19383 0.253
NP_441585.1_2 Forward -310 -291 14.7491 0.254
NP_441888.1_7 Forward -186 -172 23.1074 0.00562
NP_441833.1_4 Forward -180 -173 15.9687 0.0124
NP_441833.1_4 Reverse -173 -180 15.9687 0.0124
NP_442162.1_9 Forward -180 -173 16.2637 0.0124
NP_442162.1_9 Reverse -173 -180 16.2637 0.0124
NP_440671.1_4 Forward -187 -173 11.2093 0.138
NP_440772.1_8 Reverse -166 -185 6.98095 0.297
NP_442140.1_3 Forward -180 -170 16.598 0.0255
NP_442140.1_3 Reverse -173 -183 14.238 0.0486
NP_440875.1_9 Reverse -174 -184 17.327 0.0126
NP_441813.1_5 Forward -183 -173 19.4496 0.00647
NP_441813.1_5 Reverse -170 -180 8.92815 0.0347
NP_440594.1_10 Forward -79 -65 17.7968 0.219
NP_440590.1_4 Reverse -173 -186 6.4108 0.0575
NP_440567.1_1 Forward -180 -166 10.9143 0.0313
NP_440567.1_1 Reverse -173 -187 7.86607 0.0642
NP_442497.1_10 Forward -180 -171 10.8161 0.0087
NP_442497.1_10 Reverse -173 -182 10.4228 0.0087
NP_440821.1_4 Reverse -170 -180 17.188 0.00705
NP_440821.1_4 Forward -183 -173 10.2065 0.0163
NP_441239.1_9 Reverse -170 -182 16.7552 0.0157
NP_441239.1_9 Forward -183 -171 8.20045 0.141
NP_441239.1_9 Forward -269 -257 6.43049 0.189
NP_441239.1_9 Forward -309 -297 4.66053 0.248
NP_441009.1_4 Reverse -172 -191 11.3075 0.257
NP_442044.1_1 Reverse -26 -45 -6.68705 0.21
NP_443035.1_10 Forward -274 -257 6.92201 0.273
NP_441617.1_6 Reverse -235 -254 -6.49039 0.283
NP_440546.1_4 Forward -181 -171 14.0213 0.0459
NP_440546.1_4 Reverse -172 -182 9.17338 0.151
NP_440675.1_1 Forward -286 -267 16.8141 0.177
NP_440462.1_6 Forward -183 -173 17.2863 0.00752
NP_440462.1_6 Reverse -170 -180 9.41981 0.044
NP_442340.1_3 Reverse -260 -279 5.50599 0.113
NP_440868.1_4 Forward -185 -173 10.5604 0.0364
NP_440868.1_4 Reverse -168 -180 1.80894 0.174
NP_440401.1_9 Reverse -37 -44 12.6251 0.287
NP_441249.1_8 Reverse -125 -144 2.26107 0.284
NP_442402.1_4 Reverse -360 -379 -6.49113 0.259
NP_442402.1_10 Reverse -237 -247 12.9592 0.204
NP_442402.1_10 Reverse -57 -67 10.4026 0.29
NP_442923.1_4 Forward -276 -257 0.392778 0.196
NP_442039.1_4 Forward -180 -173 15.1821 0.0124
NP_442039.1_4 Reverse -173 -180 15.1821 0.0124
NP_442039.1_7 Forward -274 -264 15.8113 0.211
NP_442039.1_7 Forward -265 -255 10.7964 0.257
NP_442837.1_3 Forward -180 -173 15.7721 0.0124
NP_442837.1_3 Reverse -173 -180 15.7721 0.0124
NP_440160.1_2 Reverse -297 -316 -8.55534 0.286
NP_439994.1_3 Reverse -29 -48 8.341 0.291
NP_442053.1_1 Forward -181 -172 17.601 0.00138
NP_442053.1_1 Reverse -172 -181 16.2243 0.00451
NP_440505.1_3 Forward -183 -173 15.9097 0.00857
NP_441203.1_1 Reverse -173 -192 -9.83364 0.137
NP_442532.1_4 Forward -252 -234 15.6246 0.16
NP_442532.1_4 Reverse -235 -253 8.2558 0.282
NP_442532.1_7 Forward -181 -167 3.34284 0.201
NP_440914.1_1 Forward -181 -171 7.24882 0.242
NP_440914.1_1 Reverse -172 -182 6.07773 0.297
NP_441011.1_8 Reverse -173 -182 16.9127 0.00602
NP_441011.1_8 Forward -180 -171 12.7828 0.0397
NP_441011.1_8 Forward -48 -39 5.50626 0.256
NP_442533.1_6 Forward -181 -172 7.86621 0.0862
NP_442533.1_6 Reverse -172 -181 7.37455 0.0898
NP_442533.1_6 Forward -134 -125 4.52295 0.179
NP_440263.1_5 Reverse -238 -252 8.75105 0.294
NP_442322.1_4 Forward -142 -125 -8.61494 0.286
NP_441482.1_7 Forward -187 -173 6.88276 0.0257
NP_439944.1_9 Forward -180 -170 8.4365 0.108
NP_441697.1_5 Forward -26 -7 -8.73794 0.268
NP_441028.1_6 Reverse -369 -379 6.86274 0.23
NP_441527.1_4 Reverse -71 -90 -9.02441 0.254
NP_441527.1_4 Forward -374 -355 -12.4621 0.288
NP_440115.1_6 Forward -184 -174 7.64985 0.146
NP_440007.1_9 Forward -185 -171 1.17956 0.29
NP_439965.1_1 Forward -190 -171 -10.3253 0.3
NP_442890.1_1 Forward -190 -171 15.4374 0.194
NP_441972.1_5 Forward -192 -173 -7.96535 0.256
NP_441972.1_5 Reverse -316 -335 -9.93197 0.294
NP_441106.1_1 Forward -182 -173 18.191 0.0028
NP_441286.1_1 Forward -182 -170 13.707 0.00583
NP_440670.1_8 Forward -181 -172 9.04618 0.0606
NP_440670.1_8 Reverse -172 -181 8.75118 0.0606
NP_440886.1_7 Forward -182 -172 16.4991 0.0104
NP_440886.1_7 Reverse -171 -181 8.04271 0.0805
NP_440886.1_7 Reverse -39 -49 6.27276 0.134
NP_441001.1_10 Forward -277 -258 5.11266 0.292
NP_440907.2_8 Forward -180 -170 10.3043 0.103
NP_440907.2_8 Reverse -173 -183 7.94438 0.117
NP_440326.1_9 Forward -97 -78 13.6666 0.274
NP_441463.1_3 Reverse -248 -267 -6.98204 0.253
NP_442893.1_4 Reverse -8 -27 1.17865 0.212
NP_441626.1_2 Forward -180 -173 15.7721 0.0124
NP_441626.1_2 Reverse -173 -180 15.7721 0.0124
NP_442794.1_1 Forward -185 -173 10.4621 0.0721
NP_442615.1_1 Forward -58 -40 -7.06068 0.273
NP_441962.1_4 Reverse -167 -186 -5.50708 0.169
NP_441431.1_2 Forward -184 -170 15.7319 0.045
NP_441431.1_2 Reverse -169 -183 6.58715 0.266
NP_441993.1_1 Reverse -166 -185 7.4043 0.166
NP_440114.1_10 Forward -181 -167 14.7492 0.0346
NP_440766.1_4 Reverse -168 -182 8.25939 0.0871
NP_440766.1_4 Forward -185 -171 8.06273 0.0871
NP_439988.1_7 Forward -339 -325 15.3386 0.292
NP_441237.1_9 Forward -180 -170 16.893 0.01
NP_442743.1_4 Reverse -173 -192 -8.55534 0.296
NP_442930.1_1 Reverse -234 -244 12.3692 0.239
NP_439910.1_2 Reverse -164 -181 -12.5475 0.0894
NP_442867.1_8 Forward -132 -113 5.30933 0.276
NP_440457.1_1 Forward -185 -173 7.61046 0.101
NP_440457.1_1 Forward -311 -299 -0.256015 0.259
NP_442680.1_5 Reverse -1 -20 3.49139 0.23
NP_440054.1_4 Reverse -250 -269 10.1275 0.284
NP_442509.1_9 Forward -181 -171 15.9091 0.00953
NP_442509.1_9 Reverse -172 -182 12.4676 0.09
NP_442587.1_2 Forward -292 -273 17.3057 0.208
NP_440554.1_4 Reverse -173 -183 16.4996 0.0189
NP_441885.1_5 Forward -181 -171 2.24165 0.0822
NP_441885.1_5 Reverse -172 -182 1.65166 0.106
NP_440022.1_4 Forward -104 -85 17.404 0.18
NP_440478.1_4 Forward -393 -374 11.3075 0.259
NP_442341.1_9 Forward -183 -169 10.717 0.133
NP_441756.1_5 Forward -393 -374 1.17943 0.217
NP_441173.1_9 Reverse -264 -272 12.1137 0.21
NP_441173.1_9 Reverse -370 -378 10.9338 0.242
NP_442395.2_4 Reverse -171 -190 12.29 0.08
NP_442395.2_4 Reverse -309 -328 6.78348 0.142
NP_440423.1_6 Reverse -164 -183 -3.24547 0.126
NP_443000.1_7 Forward -183 -173 11.5831 0.0344
NP_440507.2_3 Reverse -320 -339 15.9282 0.0822
NP_440275.1_3 Forward -183 -173 15.418 0.0178
NP_440275.1_3 Reverse -170 -180 10.8948 0.0398
NP_440091.1_1 Reverse -168 -180 3.97222 0.144
NP_441635.1_1 Reverse -7 -26 4.05798 0.275
NP_441207.1_7 Forward -243 -229 11.4821 0.241
NP_439962.1_4 Forward -275 -256 -8.16202 0.292
NP_442495.1_3 Forward -283 -265 9.85225 0.282
NP_441105.1_3 Forward -192 -173 3.73603 0.0873
NP_440216.1_1 Reverse -172 -186 -2.26202 0.0484
NP_440216.1_1 Forward -181 -167 -3.44199 0.082
NP_440172.1_1 Forward -181 -171 17.2863 0.00544
NP_442015.1_10 Forward -185 -172 11.7207 0.0372
NP_442015.1_10 Forward -311 -298 1.39592 0.204
NP_441226.1_7 Forward -180 -173 14.4934 0.0123
NP_441226.1_7 Reverse -173 -180 14.4934 0.0123
NP_441226.1_7 Reverse -299 -306 8.29857 0.205
NP_441111.1_7 Reverse -173 -181 18.7023 0.00294
NP_441111.1_7 Forward -180 -172 8.96754 0.0463
NP_441766.1_2 Reverse -172 -181 18.2893 0.00297
NP_441766.1_2 Forward -181 -172 9.14451 0.0337
NP_442417.1_5 Reverse -172 -186 19.9608 0.0165
NP_442252.1_3 Reverse -165 -183 15.4571 0.0849
NP_440416.1_1 Forward -181 -162 -5.31042 0.153
NP_440416.1_9 Reverse -373 -392 -11.0136 0.148
NP_440416.1_9 Forward -188 -169 -13.2752 0.164
NP_443052.1_8 Reverse -162 -181 -0.4922 0.0697
NP_442116.1_6 Reverse -345 -362 8.8374 0.238
NP_440261.1_5 Reverse -173 -186 -2.63565 0.0924
NP_440261.1_5 Forward -180 -167 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTATACCTGGCGGCGCGCCATGTGGAAAAAGCTCAGAACCAATTGTTAGAGCATTATCCCGGCGACACTCCCGTAGCGGTTTGTTTTCGGGTGGGTTGGCCCGATGAAAAGATTTGGTTAGTGCCCTTGGCAGAAATGGCAGCCTTAAGTTTGCGGGAAAATTTAATCCGCACCACCCTTTACCTGATTAGCCCAGCTTTAAAGACTGATTTACCCCGGCGATCGCGCCTTTATCATCCCGACCATAGCCATTTATTCCGTCCAGTCCGTCCCCTATTGTGACAACCAGTTAAGTCTGAGGATATTTTTGCTTTCATAGCTTGTTTTCTTCCTGAGGGAAGTTAGGATTAGTGATGGGGGTTATTCCCTCCAAAAAGAATTAGTATTTTCTCCTCCCC

CDS

ATGAGCTGGATTCCCCCCTACCGTCCCCAACAATTGTCCCTGGGCCCCCTGGAGCAGGAAATTTTACAAATTATCTGGCAATTGGGCCAGGCCACGGTGAAAGATATCCACGATCGCATTTTGAGCGACCCTGACCGGGAATTGGCCTACTCTTCGGTAACCACGGTGTTAAATCGGCTCACAAAGAAGGGCTGGTTAGTGTGCCATCGCCAGGGCAAAGCCTTTATTTGGACGGCAAGGGTGAGTGCAGACCAGGCCAAAGCGGTGCAGTCCTACGAACAATTACAGCAGTTTTTGGCCATTAGCAATCCCGATGTGGTGGCCGCCTTTGCTGACAGTTTAGACACCGCTAGCATTGACCAGTTAACGGCGATCGCCGATCGTTTGCGGGCGGCCCGACAACAGCGACAGGAGGAGAAATAA

Protein

MSWIPPYRPQQLSLGPLEQEILQIIWQLGQATVKDIHDRILSDPDRELAYSSVTTVLNRLTKKGWLVCHRQGKAFIWTARVSADQAKAVQSYEQLQQFLAISNPDVVAAFADSLDTASIDQLTAIADRLRAARQQRQEEK