Your browser is old and dusty. Try Google Chrome!

Details for slr0232

ORF slr0232
Accession NP_442167.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -111 -125 -0.492064 0.231
NP_440795.1_7 Forward -118 -111 14.6904 0.0123
NP_440795.1_7 Reverse -111 -118 14.6904 0.0123
NP_441418.1_6 Reverse -110 -129 -13.3736 0.0761
NP_440815.1_5 Reverse -326 -345 6.68596 0.273
NP_441605.1_1 Reverse -289 -308 13.6675 0.19
NP_442291.1_5 Forward -120 -104 -2.20308 0.212
NP_441453.1_4 Forward -119 -111 16.539 0.00633
NP_441453.1_4 Reverse -110 -118 7.8859 0.0536
NP_441453.1_7 Forward -371 -364 12.9205 0.23
NP_441623.1_1 Forward -167 -149 6.01734 0.156
NP_441623.1_1 Forward -168 -150 -1.84914 0.241
NP_442151.1_6 Forward -119 -105 8.94771 0.162
NP_442151.1_6 Reverse -110 -124 8.35772 0.175
NP_442838.1_7 Forward -192 -173 -11.4069 0.277
NP_441818.1_1 Reverse -179 -190 9.79292 0.232
NP_441818.1_1 Reverse -111 -122 9.30127 0.246
NP_440226.1_1 Forward -119 -100 20.354 0.0102
NP_440226.1_1 Reverse -110 -129 11.0125 0.0571
NP_442169.1_1 Reverse -140 -159 -1.86883 0.271
NP_442173.1_1 Reverse -111 -119 15.4574 0.00633
NP_442173.1_1 Forward -118 -110 14.1791 0.0165
NP_442752.1_4 Forward -119 -112 13.8055 0.0199
NP_442752.1_4 Reverse -319 -326 5.44732 0.202
NP_443027.1_4 Reverse -108 -118 16.303 0.0437
NP_443027.1_4 Forward -121 -111 14.828 0.0437
NP_441812.1_3 Forward -120 -106 11.6026 0.21
NP_442975.1_10 Forward -123 -109 10.0287 0.0598
NP_442975.1_10 Reverse -106 -120 2.75226 0.269
NP_440784.1_7 Forward -118 -111 15.9687 0.0123
NP_440784.1_7 Reverse -111 -118 15.9687 0.0123
NP_442909.1_7 Reverse -111 -125 5.99717 0.258
NP_441054.1_2 Reverse -133 -152 11.0125 0.277
NP_441054.1_4 Forward -129 -111 4.54237 0.151
NP_442062.1_3 Forward -28 -9 0.884433 0.23
NP_442062.1_8 Reverse -319 -329 10.2065 0.0504
NP_442062.1_8 Reverse -110 -120 9.91146 0.0554
NP_442062.1_8 Forward -119 -109 9.61647 0.0587
NP_442062.1_8 Forward -99 -89 4.3066 0.221
NP_442062.1_8 Reverse -178 -188 3.12662 0.285
NP_440304.1_4 Forward -121 -111 10.8948 0.051
NP_440304.1_4 Reverse -108 -118 9.12481 0.0626
NP_440304.1_4 Forward -189 -179 6.17489 0.174
NP_442242.1_4 Forward -118 -111 14.3954 0.0124
NP_442242.1_4 Reverse -111 -118 14.3954 0.0124
NP_440044.1_8 Forward -118 -99 -2.95047 0.274
NP_440011.1_1 Reverse -293 -312 12.0942 0.265
NP_441594.1_6 Reverse -198 -217 0.196116 0.291
NP_440370.1_10 Reverse -101 -120 17.8957 0.0586
NP_442110.1_7 Forward -119 -105 9.34103 0.0755
NP_441083.1_5 Reverse -110 -120 2.04498 0.195
NP_441083.1_5 Forward -119 -109 1.55333 0.204
NP_441083.1_5 Forward -328 -318 -1.00328 0.289
NP_442827.1_8 Forward -127 -108 3.14526 0.151
NP_442827.1_8 Reverse -102 -121 1.6703 0.173
NP_441434.1_7 Reverse -180 -194 3.34284 0.249
NP_441738.1_2 Reverse -112 -119 15.28 0.0102
NP_441738.1_2 Forward -117 -110 11.5435 0.084
NP_441738.1_2 Forward -326 -319 10.2652 0.101
NP_441738.1_2 Forward -185 -178 6.52862 0.261
NP_441558.1_5 Reverse -108 -127 5.70265 0.242
NP_441558.1_5 Forward -121 -102 4.71934 0.271
NP_441942.1_6 Reverse -312 -331 13.1133 0.296
NP_440209.1_1 Forward -119 -111 18.1123 0.00295
NP_440209.1_1 Reverse -110 -118 8.47588 0.0457
NP_442889.1_1 Reverse -83 -102 -15.3402 0.289
NP_440447.1_5 Forward -170 -160 15.9097 0.277
NP_440178.1_7 Forward -120 -101 7.47261 0.0112
NP_440538.1_10 Forward -75 -56 10.1275 0.279
NP_442111.1_4 Reverse -109 -123 5.01447 0.181
NP_441387.1_7 Forward -115 -96 6.19431 0.209
NP_440906.1_5 Forward -118 -111 15.8704 0.0124
NP_440906.1_5 Reverse -111 -118 15.8704 0.0124
NP_440438.2_8 Reverse -11 -30 0.392778 0.299
NP_440747.1_10 Forward -122 -110 -11.7607 0.142
NP_440747.1_10 Reverse -107 -119 -11.7607 0.142
NP_441130.1_10 Forward -121 -107 20.5508 0.00768
NP_441486.1_1 Reverse -107 -121 0.0979218 0.145
NP_441486.1_1 Forward -122 -108 -3.24533 0.177
NP_441486.1_9 Reverse -119 -138 12.0942 0.254
NP_442634.1_4 Forward -121 -107 -3.54032 0.161
NP_442634.1_4 Reverse -108 -122 -4.32697 0.195
NP_441639.1_3 Forward -120 -101 5.80098 0.264
NP_440842.1_4 Reverse -11 -30 11.3538 0.0742
NP_442848.1_1 Reverse -104 -118 4.03116 0.115
NP_442848.1_1 Forward -125 -111 -1.18038 0.263
NP_443018.1_3 Forward -118 -111 14.8871 0.0123
NP_443018.1_3 Reverse -111 -118 14.8871 0.0123
NP_443018.1_3 Forward -98 -91 7.6106 0.156
NP_441316.1_7 Forward -121 -106 7.05973 0.107
NP_441634.1_8 Forward -121 -107 3.34284 0.154
NP_441634.1_8 Reverse -381 -395 -3.83532 0.295
NP_440376.1_1 Forward -119 -110 9.73449 0.0365
NP_440376.1_1 Reverse -110 -119 9.63616 0.0385
NP_440376.1_1 Reverse -319 -328 3.83464 0.19
NP_440376.1_1 Reverse -178 -187 3.63797 0.2
NP_442687.1_7 Forward -120 -110 6.76487 0.154
NP_440066.1_5 Forward -168 -149 14.9449 0.194
NP_441846.1_10 Reverse -142 -161 -13.0786 0.197
NP_441846.1_10 Reverse -179 -198 -22.5183 0.261
NP_441846.1_10 Reverse -372 -391 -22.715 0.264
NP_441846.1_10 Reverse -357 -376 -23.5016 0.289
NP_442958.1_3 Reverse -141 -160 3.53937 0.253
NP_441422.1_7 Forward -121 -104 15.5751 0.0565
NP_441763.1_10 Forward -130 -111 5.2102 0.294
NP_440887.1_10 Forward -121 -102 14.2574 0.24
NP_442658.1_1 Forward -121 -111 15.9091 0.00966
NP_442658.1_1 Reverse -108 -118 14.0409 0.0273
NP_442658.1_1 Forward -189 -179 11.8776 0.0697
NP_442658.1_1 Forward -65 -55 4.7978 0.297
NP_442205.1_9 Reverse -104 -120 7.92501 0.105
NP_442205.1_9 Forward -125 -109 -3.67804 0.291
NP_440184.1_1 Reverse -12 -31 4.79023 0.22
NP_441487.1_9 Forward -120 -101 13.4708 0.0488
NP_442937.1_2 Forward -203 -184 12.585 0.293
NP_442937.1_5 Reverse -144 -163 10.6192 0.157
NP_442321.1_1 Reverse -354 -373 -5.11376 0.216
NP_441958.1_5 Reverse -109 -119 11.3864 0.0074
NP_441958.1_5 Forward -120 -110 3.12662 0.0364
NP_440651.1_1 Reverse -353 -372 8.45592 0.282
NP_441127.1_1 Reverse -261 -275 10.6193 0.244
NP_439905.1_1 Reverse -111 -124 13.0973 0.178
NP_440984.1_7 Forward -124 -110 5.40779 0.257
NP_439990.1_5 Forward -104 -91 8.67241 0.166
NP_442911.1_2 Reverse -168 -187 3.53937 0.0428
NP_442911.1_2 Forward -129 -110 1.27776 0.0601
NP_442911.1_2 Reverse -100 -119 -2.65548 0.1
NP_441580.1_6 Forward -198 -179 -0.983855 0.181
NP_440153.1_5 Reverse -111 -125 11.996 0.0699
NP_440153.1_5 Forward -118 -104 10.521 0.0979
NP_443055.1_6 Forward -119 -101 4.54162 0.181
NP_440993.1_2 Reverse -105 -121 2.61514 0.263
NP_442002.1_9 Forward -188 -181 12.4288 0.185
NP_442002.1_9 Forward -120 -113 10.7572 0.185
NP_441646.1_1 Forward -211 -192 0.786102 0.243
NP_442438.1_10 Reverse -105 -119 4.81781 0.142
NP_442438.1_10 Forward -124 -110 1.96621 0.188
NP_441000.1_6 Forward -120 -106 2.45787 0.139
NP_441000.1_6 Reverse -109 -123 -3.34366 0.221
NP_440147.1_4 Reverse -88 -101 5.91914 0.109
NP_440147.1_4 Forward -121 -108 2.87088 0.202
NP_441550.1_8 Reverse -108 -118 14.2375 0.0168
NP_441550.1_8 Forward -121 -111 6.0761 0.214
NP_441916.1_7 Reverse -110 -120 10.2065 0.0266
NP_441916.1_7 Forward -119 -109 9.61647 0.0333
NP_441041.1_1 Reverse -146 -165 11.7008 0.198
NP_441041.1_4 Forward -263 -244 -4.6221 0.14
NP_441041.1_4 Forward -125 -106 -12.9802 0.278
NP_441041.1_4 Reverse -90 -109 -13.9635 0.299
NP_441041.1_7 Forward -190 -178 7.80631 0.159
NP_441041.1_7 Reverse -107 -119 7.12607 0.176
NP_442396.1_5 Reverse -315 -328 13.7856 0.0913
NP_442004.1_6 Forward -257 -243 2.06454 0.274
NP_441725.1_5 Reverse -111 -121 11.2881 0.0247
NP_441725.1_5 Forward -118 -108 7.64985 0.0904
NP_441725.1_5 Reverse -179 -189 7.45319 0.0965
NP_441725.1_5 Forward -186 -176 0.373358 0.182
NP_439966.1_7 Forward -121 -111 18.4657 0.00473
NP_439966.1_7 Reverse -108 -118 11.2876 0.0688
NP_439966.1_9 Reverse -108 -117 9.24284 0.253
NP_439966.1_9 Forward -121 -112 0.983037 0.253
NP_440736.1_3 Reverse -310 -329 0.884433 0.282
NP_442941.1_3 Reverse -111 -121 11.4848 0.0116
NP_442941.1_3 Forward -118 -108 1.55333 0.15
NP_440289.1_2 Forward -122 -109 -4.11062 0.28
NP_440289.1_2 Forward -190 -177 -4.9956 0.294
NP_440260.1_8 Forward -255 -237 -4.20908 0.267
NP_442281.1_1 Forward -192 -178 9.43874 0.0703
NP_442281.1_1 Forward -124 -110 8.65209 0.0783
NP_441334.1_7 Reverse -108 -127 -21.3384 0.296
NP_442256.1_2 Reverse -108 -126 -7.65067 0.214
NP_440437.1_1 Forward -374 -355 -3.44213 0.236
NP_440498.1_1 Reverse -101 -119 14.0805 0.04
NP_440498.1_1 Forward -128 -110 0.609134 0.214
NP_442982.1_5 Reverse -100 -119 -3.14714 0.296
NP_440375.1_8 Forward -98 -79 -1.7705 0.293
NP_441644.1_6 Forward -119 -109 16.5975 0.00319
NP_442215.1_2 Forward -331 -315 1.73016 0.128
NP_442029.1_1 Reverse -183 -202 -19.8634 0.297
NP_442029.1_10 Forward -378 -359 5.30933 0.287
NP_440929.1_8 Forward -119 -110 17.4043 0.00289
NP_440929.1_8 Reverse -110 -119 17.4043 0.00289
NP_442933.1_10 Forward -119 -110 9.04618 0.063
NP_442933.1_10 Reverse -110 -119 8.94785 0.0643
NP_440430.1_4 Forward -129 -110 15.4366 0.214
NP_442926.1_1 Reverse -356 -375 3.34271 0.151
NP_442554.1_8 Forward -118 -108 15.8113 0.00783
NP_442554.1_8 Reverse -111 -121 13.8447 0.0145
NP_442554.1_8 Reverse -91 -101 5.48657 0.146
NP_442167.1_4 Forward -62 -45 23.3433 0.00738
NP_442167.1_5 Forward -37 -18 21.3152 0.039
NP_442167.1_6 Forward -171 -155 19.724 0.125
NP_442167.1_8 Forward -374 -360 20.5501 0.255
NP_441762.1_7 Forward -120 -108 4.36554 0.0504
NP_441762.1_7 Reverse -109 -121 -4.48425 0.175
NP_442313.1_4 Reverse -123 -142 5.80098 0.288
NP_442142.1_1 Reverse -158 -177 13.3725 0.259
NP_442142.1_4 Forward -102 -89 2.18201 0.299
NP_442292.1_1 Forward -118 -109 16.9127 0.00594
NP_442292.1_1 Reverse -111 -120 9.63616 0.0183
NP_442476.1_6 Reverse -111 -125 13.7659 0.0401
NP_442476.1_6 Forward -118 -104 2.5562 0.179
NP_442476.1_6 Reverse -179 -193 0.392915 0.262
NP_443009.1_5 Forward -188 -177 14.6111 0.02
NP_443009.1_5 Reverse -109 -120 9.89126 0.0866
NP_443009.1_5 Forward -120 -109 6.74468 0.15
NP_441715.1_4 Reverse -111 -121 16.303 0.0117
NP_440357.1_3 Reverse -88 -107 1.17943 0.275
NP_441198.1_8 Forward -189 -179 15.4199 0.0427
NP_441198.1_8 Reverse -108 -118 13.955 0.101
NP_441468.1_1 Forward -118 -111 15.8704 0.0124
NP_441468.1_1 Reverse -111 -118 15.8704 0.0124
NP_441015.1_10 Reverse -105 -124 2.75272 0.146
NP_441673.1_1 Forward -119 -110 11.1111 0.0121
NP_441673.1_1 Reverse -110 -119 11.0128 0.018
NP_441826.1_2 Forward -125 -111 10.1277 0.051
NP_441826.1_5 Reverse -374 -393 3.83436 0.259
NP_442490.1_9 Forward -251 -232 -1.67217 0.196
NP_441764.1_4 Forward -30 -13 19.7218 0.0453
NP_442868.1_6 Forward -189 -179 10.5998 0.038
NP_442868.1_6 Forward -121 -111 0.963343 0.205
NP_442868.1_6 Reverse -108 -118 -0.314959 0.284
NP_441612.1_2 Reverse -242 -252 8.25885 0.228
NP_443058.1_7 Forward -100 -81 9.0459 0.206
NP_442427.1_3 Reverse -105 -123 5.32902 0.171
NP_442808.1_1 Forward -120 -110 8.73102 0.0481
NP_442808.1_1 Reverse -325 -335 1.94622 0.281
NP_440145.1_3 Reverse -100 -119 3.04771 0.11
NP_442113.1_5 Forward -65 -46 5.80018 0.294
NP_442113.1_10 Forward -325 -306 -8.06369 0.278
NP_442050.1_5 Reverse -108 -118 16.5975 0.00812
NP_442050.1_5 Forward -189 -179 9.51767 0.193
NP_442050.1_5 Forward -121 -111 9.12434 0.193
NP_441114.1_3 Reverse -328 -337 7.66954 0.231
NP_441518.1_3 Reverse -100 -119 -14.9469 0.284
NP_441878.1_6 Forward -120 -110 0.668351 0.139
NP_441878.1_6 Reverse -109 -119 0.668351 0.139
NP_441878.1_6 Forward -336 -326 -6.8048 0.196
NP_441878.1_6 Reverse -177 -187 -7.59145 0.245
NP_441878.1_6 Reverse -194 -204 -7.68978 0.255
NP_441036.1_3 Reverse -165 -184 6.19431 0.133
NP_441036.1_8 Reverse -109 -119 14.7297 0.0187
NP_441036.1_8 Forward -120 -110 8.1415 0.176
NP_442650.1_2 Forward -119 -105 4.71948 0.163
NP_441557.1_5 Reverse -110 -119 17.4043 0.0023
NP_441557.1_5 Forward -119 -110 10.8161 0.00464
NP_441557.1_8 Forward -379 -369 11.9759 0.236
NP_441433.1_8 Forward -98 -79 -4.32711 0.294
NP_441308.1_8 Reverse -108 -118 10.9931 0.22
NP_441308.1_8 Forward -121 -111 10.1081 0.22
NP_441308.1_8 Reverse -103 -113 9.32148 0.226
NP_440101.1_3 Reverse -295 -314 9.14423 0.142
NP_440101.1_3 Reverse -105 -124 0.884433 0.289
NP_441458.1_8 Reverse -6 -25 3.44544 0.273
NP_441458.1_8 Reverse -13 -32 2.0038 0.295
NP_442183.1_1 Forward -119 -105 14.1593 0.036
NP_442183.1_1 Forward -187 -173 11.111 0.0757
NP_441549.1_9 Forward -123 -105 -0.275845 0.137
NP_442347.1_2 Reverse -111 -120 11.1111 0.056
NP_442347.1_2 Forward -327 -318 5.80125 0.219
NP_442645.1_2 Reverse -56 -75 -14.6519 0.177
NP_442645.1_2 Forward -259 -240 -16.7168 0.24
NP_442645.1_2 Forward -140 -121 -18.6834 0.278
NP_442645.1_2 Reverse -102 -121 -19.7651 0.288
NP_441037.1_4 Reverse -108 -118 15.5041 0.028
NP_441037.1_4 Forward -189 -179 7.02532 0.237
NP_441037.1_4 Forward -121 -111 7.02532 0.237
NP_442594.1_7 Forward -130 -111 5.99684 0.222
NP_441633.1_3 Forward -121 -108 -3.81562 0.177
NP_441633.1_3 Reverse -108 -121 -4.11062 0.181
NP_440136.1_2 Forward -118 -111 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 15.9687 0.0123
NP_440136.1_2 Reverse -179 -186 11.1505 0.0519
NP_442998.1_10 Reverse -112 -119 15.5754 0.0102
NP_442998.1_10 Forward -117 -110 5.84064 0.235
NP_440899.1_1 Reverse -117 -136 16.1172 0.0867
NP_440299.1_1 Forward -77 -64 2.18201 0.294
NP_441799.1_1 Forward -123 -109 13.6669 0.0311
NP_441799.1_1 Reverse -106 -120 8.75042 0.106
NP_440640.1_6 Forward -131 -112 -0.39387 0.285
NP_441007.1_10 Reverse -105 -118 12.3107 0.0506
NP_441007.1_10 Forward -124 -111 1.9859 0.202
NP_441007.1_10 Forward -192 -179 0.707601 0.219
NP_440256.1_1 Reverse -107 -126 -6.88371 0.223
NP_440709.1_1 Reverse -9 -28 0.490334 0.259
NP_441179.1_1 Forward -122 -103 1.37609 0.267
NP_440717.1_1 Reverse -179 -198 10.9142 0.217
NP_442785.1_7 Reverse -252 -266 9.2427 0.27
NP_442452.1_8 Forward -312 -298 11.7987 0.273
NP_440537.1_4 Forward -205 -186 16.4207 0.271
NP_441464.1_8 Forward -119 -105 13.2743 0.148
NP_441464.1_8 Forward -187 -173 5.80112 0.251
NP_441838.1_9 Reverse -311 -330 15.1424 0.254
NP_442993.1_1 Forward -119 -103 -9.47957 0.186
NP_442386.1_9 Forward -120 -111 15.7322 0.0144
NP_442386.1_9 Reverse -109 -118 5.11253 0.266
NP_442386.1_9 Forward -153 -144 4.52254 0.297
NP_441340.1_5 Forward -118 -111 15.6737 0.0124
NP_441340.1_5 Reverse -111 -118 15.6737 0.0124
NP_440168.1_9 Reverse -177 -196 -5.60541 0.296
NP_442714.1_5 Reverse -144 -163 -1.08219 0.3
NP_441160.1_5 Reverse -372 -391 -5.99873 0.288
NP_440586.1_4 Reverse -135 -153 14.6705 0.25
NP_440586.1_8 Forward -118 -111 13.2151 0.026
NP_440586.1_8 Reverse -111 -118 13.2151 0.026
NP_442251.1_6 Forward -118 -111 15.2804 0.0124
NP_442251.1_6 Reverse -111 -118 15.2804 0.0124
NP_441262.1_3 Reverse -110 -117 14.8871 0.0223
NP_441262.1_3 Forward -119 -112 14.7888 0.0223
NP_440027.1_3 Reverse -248 -266 12.703 0.156
NP_443051.1_1 Reverse -109 -118 17.5026 0.0066
NP_443051.1_1 Forward -120 -111 10.4228 0.00754
NP_439937.1_9 Forward -153 -136 -12.0565 0.269
NP_442294.1_3 Forward -385 -371 12.2903 0.29
NP_440926.1_9 Reverse -372 -391 8.65258 0.275
NP_440398.1_6 Reverse -79 -98 4.03102 0.29
NP_440439.1_1 Reverse -107 -120 9.95071 0.0413
NP_440439.1_1 Forward -122 -109 9.36073 0.0465
NP_442239.1_8 Forward -273 -254 6.09597 0.266
NP_440372.1_2 Forward -118 -111 16.3621 0.0124
NP_440372.1_2 Reverse -111 -118 16.3621 0.0124
NP_441789.1_7 Forward -387 -368 -5.01617 0.293
NP_441789.1_7 Forward -198 -179 -5.60616 0.299
NP_440316.1_10 Reverse -361 -371 6.27322 0.264
NP_442384.1_10 Reverse -110 -123 6.50913 0.0995
NP_442114.1_4 Reverse -110 -121 8.81013 0.182
NP_440364.1_10 Reverse -281 -300 15.4374 0.256
NP_441604.1_4 Forward -373 -354 -6.58872 0.293
NP_441604.1_9 Reverse -225 -244 13.0775 0.254
NP_440476.1_1 Forward -50 -31 17.6155 0.228
NP_442262.1_10 Forward -118 -111 14.1988 0.0123
NP_442262.1_10 Reverse -111 -118 14.1988 0.0123
NP_442262.1_10 Forward -98 -91 8.8889 0.219
NP_441689.1_5 Forward -121 -111 8.53436 0.132
NP_440163.1_10 Reverse -93 -103 9.12481 0.247
NP_440282.1_10 Reverse -238 -257 0.294447 0.196
NP_440531.1_6 Forward -107 -88 -3.73712 0.27
NP_440531.1_8 Reverse -295 -314 6.98095 0.23
NP_441060.1_1 Reverse -286 -305 15.2005 0.233
NP_441965.1_10 Reverse -107 -123 7.2367 0.151
NP_440297.1_8 Reverse -319 -337 15.2604 0.182
NP_440297.1_9 Reverse -111 -121 9.32148 0.0917
NP_440297.1_9 Forward -151 -141 6.66654 0.178
NP_440297.1_9 Forward -186 -176 1.06167 0.282
NP_440297.1_9 Forward -118 -108 -0.0199663 0.282
NP_441592.1_4 Forward -335 -316 -1.96717 0.26
NP_441896.1_3 Reverse -101 -120 3.83436 0.161
NP_441896.1_3 Forward -128 -109 -1.18052 0.253
NP_440937.1_5 Reverse -116 -135 7.57094 0.295
NP_440834.1_2 Forward -255 -236 11.7 0.275
NP_442067.1_4 Reverse -332 -351 2.45773 0.295
NP_440999.1_9 Forward -123 -109 -3.147 0.287
NP_440888.1_2 Reverse -110 -124 6.78381 0.22
NP_440888.1_2 Forward -119 -105 5.60385 0.272
NP_440600.1_1 Reverse -12 -31 15.135 0.206
NP_440600.1_9 Reverse -9 -28 15.135 0.198
NP_439969.1_1 Forward -377 -358 -6.58872 0.288
NP_439969.1_9 Forward -298 -286 19.8035 0.117
NP_442033.1_10 Forward -121 -102 -7.57203 0.186
NP_442033.1_10 Forward -297 -278 -12.3902 0.269
NP_441759.1_8 Forward -376 -357 7.96345 0.23
NP_441543.1_2 Reverse -111 -120 18.486 0.00236
NP_441543.1_2 Forward -118 -109 6.39124 0.153
NP_441543.1_2 Reverse -208 -217 5.21127 0.209
NP_442845.1_2 Reverse -242 -256 5.99778 0.219
NP_442845.1_2 Forward -263 -249 4.22782 0.264
NP_441304.1_10 Forward -190 -181 13.1761 0.255
NP_441551.1_5 Forward -123 -107 9.30094 0.21
NP_441319.1_8 Forward -125 -107 6.41066 0.27
NP_441469.1_8 Forward -120 -111 16.126 0.00797
NP_441469.1_8 Forward -188 -179 10.6195 0.206
NP_441469.1_8 Reverse -109 -118 6.98123 0.227
NP_442315.1_2 Reverse -190 -202 10.8554 0.291
NP_442315.1_5 Reverse -192 -202 17.0896 0.277
NP_443064.1_6 Forward -328 -318 9.65817 0.205
NP_442337.1_8 Reverse -225 -244 7.27595 0.193
NP_442578.1_7 Forward -118 -111 14.5921 0.026
NP_442578.1_7 Reverse -111 -118 14.5921 0.026
NP_441462.1_2 Forward -119 -109 11.3864 0.00425
NP_441462.1_2 Reverse -110 -120 1.74999 0.0811
NP_441621.1_7 Reverse -108 -122 -2.65535 0.188
NP_441621.1_7 Forward -121 -107 -3.54032 0.19
NP_440519.1_8 Reverse -356 -372 7.2367 0.205
NP_442204.1_5 Forward -129 -110 5.50599 0.156
NP_440516.1_6 Forward -161 -147 8.25877 0.247
NP_440516.1_8 Forward -119 -110 9.53783 0.0136
NP_440516.1_8 Reverse -110 -119 7.07956 0.0867
NP_442428.1_5 Forward -118 -111 15.8704 0.0124
NP_442428.1_5 Reverse -111 -118 15.8704 0.0124
NP_440618.1_1 Reverse -148 -167 -4.13045 0.198
NP_441867.1_2 Reverse -132 -151 -16.2252 0.291
NP_440673.1_3 Reverse -112 -119 12.4288 0.0426
NP_440673.1_3 Forward -97 -90 10.5605 0.123
NP_440673.1_3 Forward -117 -110 5.34899 0.298
NP_441052.1_2 Reverse -110 -120 1.94665 0.221
NP_441052.1_2 Forward -119 -109 0.668351 0.256
NP_442219.1_8 Reverse -316 -335 6.52434 0.294
NP_442219.1_9 Reverse -111 -120 8.35786 0.0681
NP_440436.1_4 Reverse -111 -120 18.1905 0.00233
NP_441884.1_8 Forward -120 -101 -2.75381 0.141
NP_441719.1_4 Forward -118 -111 16.3621 0.0124
NP_441719.1_4 Reverse -111 -118 16.3621 0.0124
NP_441733.1_10 Reverse -107 -120 9.16406 0.124
NP_441004.1_1 Reverse -161 -180 0.982764 0.111
NP_441004.1_2 Reverse -156 -175 3.44104 0.204
NP_441004.1_2 Forward -198 -179 -0.295539 0.256
NP_441004.1_2 Reverse -381 -400 -3.73712 0.283
NP_442873.1_9 Forward -214 -195 5.70185 0.259
NP_441115.1_4 Reverse -109 -127 15.2596 0.042
NP_442694.1_4 Forward -336 -327 12.2911 0.253
NP_442206.1_4 Forward -118 -99 5.89931 0.293
NP_440328.1_4 Forward -125 -106 10.3242 0.0866
NP_440094.1_3 Forward -57 -38 18.1907 0.00801
NP_443054.1_2 Reverse -176 -190 7.9644 0.134
NP_441851.1_10 Forward -120 -110 15.8113 0.00552
NP_441851.1_10 Reverse -177 -187 12.9597 0.0391
NP_441851.1_10 Reverse -194 -204 11.9764 0.0583
NP_441851.1_10 Reverse -318 -328 8.92815 0.114
NP_441851.1_10 Reverse -109 -119 6.96153 0.151
NP_441851.1_10 Forward -188 -178 5.68323 0.203
NP_442208.1_5 Forward -272 -253 1.27776 0.248
NP_442208.1_5 Reverse -152 -171 -4.52377 0.258
NP_442515.1_1 Forward -188 -174 9.34103 0.063
NP_442515.1_1 Forward -120 -106 1.96621 0.145
NP_442515.1_1 Forward -329 -315 -1.77037 0.263
NP_441396.1_5 Reverse -384 -393 7.66954 0.241
NP_441683.1_5 Forward -390 -371 8.45592 0.248
NP_440593.1_3 Forward -159 -140 -7.4737 0.295
NP_441409.1_6 Forward -125 -106 -8.45701 0.168
NP_441394.1_4 Reverse -83 -102 11.3075 0.2
NP_440432.1_9 Reverse -179 -194 -3.65835 0.187
NP_442843.1_1 Reverse -161 -180 -4.52377 0.239
NP_439960.1_10 Reverse -184 -202 -1.84914 0.246
NP_440474.1_8 Forward -118 -104 10.717 0.128
NP_440474.1_8 Reverse -111 -125 4.91554 0.263
NP_442450.1_5 Forward -121 -111 9.32148 0.115
NP_442168.1_5 Forward -118 -99 -0.197208 0.264
NP_440195.1_4 Forward -131 -112 17.7974 0.0452
NP_442006.1_2 Reverse -362 -379 -5.95935 0.149
NP_441570.1_1 Forward -119 -101 0.412472 0.0394
NP_440078.1_10 Forward -263 -244 3.73603 0.26
NP_441078.1_4 Forward -119 -110 9.93116 0.0203
NP_441078.1_4 Reverse -110 -119 9.83282 0.0226
NP_441078.1_4 Forward -187 -178 -1.86856 0.272
NP_441078.1_4 Forward -328 -319 -1.96689 0.282
NP_442729.1_5 Reverse -382 -392 10.4031 0.235
NP_442729.1_8 Forward -123 -110 6.4108 0.197
NP_442388.1_3 Forward -269 -250 5.01433 0.282
NP_440526.1_3 Reverse -179 -190 1.13984 0.267
NP_440526.1_3 Forward -118 -107 0.746521 0.271
NP_441432.1_8 Forward -120 -111 8.25953 0.0755
NP_441432.1_8 Reverse -109 -118 6.98123 0.112
NP_442320.1_8 Forward -125 -111 -3.73699 0.131
NP_442344.1_7 Forward -118 -99 -4.91709 0.168
NP_442344.1_7 Reverse -111 -130 -8.45701 0.215
NP_441732.1_2 Forward -123 -107 -7.61128 0.0861
NP_441732.1_2 Reverse -106 -122 -16.2644 0.165
NP_440629.1_6 Reverse -104 -123 16.0187 0.105
NP_440760.1_1 Forward -119 -100 -11.0136 0.0851
NP_440760.1_7 Forward -213 -194 6.98015 0.192
NP_442797.1_1 Forward -65 -46 -4.81876 0.286
NP_440199.1_10 Forward -122 -112 13.2547 0.108
NP_441945.1_10 Reverse -178 -197 9.43923 0.267
NP_442353.1_4 Forward -79 -60 10.52 0.106
NP_442353.1_4 Reverse -117 -136 -0.689632 0.29
NP_440913.1_1 Reverse -150 -168 9.55725 0.178
NP_442010.1_9 Forward -205 -191 14.3553 0.175
NP_442489.1_2 Forward -130 -111 1.86774 0.283
NP_442489.1_7 Forward -119 -110 10.4228 0.0151
NP_442489.1_7 Reverse -110 -119 10.3245 0.0193
NP_442489.1_7 Reverse -319 -328 -1.86856 0.259
NP_442489.1_7 Reverse -178 -187 -1.96689 0.28
NP_440386.1_3 Reverse -168 -187 5.30933 0.112
NP_440559.1_1 Reverse -111 -120 8.75118 0.0586
NP_440559.1_1 Forward -118 -109 7.76787 0.0918
NP_442763.1_10 Forward -166 -147 6.09597 0.26
NP_441659.2_8 Forward -119 -109 17.5813 0.0024
NP_441659.2_8 Reverse -110 -120 2.43831 0.2
NP_440363.1_8 Reverse -46 -65 10.9142 0.288
NP_442913.1_10 Reverse -101 -120 10.0292 0.0425
NP_440442.1_9 Reverse -101 -120 20.4523 0.051
NP_442346.1_5 Forward -120 -110 7.74818 0.159
NP_442346.1_5 Reverse -109 -119 6.8632 0.188
NP_442346.1_5 Forward -188 -178 4.3066 0.291
NP_440545.1_3 Reverse -106 -123 19.1151 0.00893
NP_440486.1_6 Reverse -152 -171 5.211 0.3
NP_440459.1_2 Reverse -186 -203 9.67528 0.224
NP_442311.1_5 Forward -181 -162 0.58944 0.274
NP_442875.1_2 Forward -247 -228 14.3558 0.151
NP_442603.1_10 Reverse -131 -148 14.9404 0.297
NP_441888.1_7 Forward -143 -129 1.67122 0.241
NP_441948.1_4 Forward -126 -108 -3.02911 0.181
NP_441047.1_2 Reverse -358 -377 -3.54046 0.298
NP_441833.1_4 Forward -118 -111 15.9687 0.0124
NP_441833.1_4 Reverse -111 -118 15.9687 0.0124
NP_441329.1_1 Reverse -9 -28 5.68135 0.265
NP_442162.1_9 Forward -118 -111 16.2637 0.0124
NP_442162.1_9 Reverse -111 -118 16.2637 0.0124
NP_440671.1_4 Forward -131 -117 5.80112 0.271
NP_440772.1_10 Forward -24 -5 10.7772 0.275
NP_442140.1_3 Forward -118 -108 8.92815 0.117
NP_442140.1_3 Reverse -111 -121 8.33817 0.119
NP_441671.1_10 Reverse -99 -118 2.45773 0.252
NP_440875.1_9 Forward -117 -107 12.9469 0.0911
NP_440875.1_9 Reverse -250 -260 6.81464 0.297
NP_441813.1_5 Forward -121 -111 17.188 0.00979
NP_441813.1_5 Reverse -108 -118 7.94484 0.0517
NP_440590.1_4 Reverse -111 -124 3.65753 0.0702
NP_440590.1_4 Reverse -91 -104 -5.09393 0.274
NP_440567.1_1 Reverse -111 -125 7.9644 0.0637
NP_442497.1_10 Forward -118 -109 15.7327 0.0087
NP_442497.1_10 Reverse -111 -120 10.4228 0.0087
NP_442497.1_10 Reverse -179 -188 0.29472 0.199
NP_440821.1_4 Forward -121 -111 19.0562 0.00399
NP_440821.1_4 Reverse -108 -118 10.2065 0.0163
NP_440821.1_4 Reverse -176 -186 6.27322 0.0921
NP_440821.1_4 Forward -189 -179 -0.0199663 0.217
NP_441239.1_9 Reverse -108 -120 17.4436 0.0146
NP_441239.1_9 Forward -121 -109 9.18376 0.113
NP_441239.1_9 Forward -374 -362 5.54551 0.217
NP_441951.1_9 Reverse -256 -275 6.09597 0.254
NP_440706.1_1 Reverse -106 -125 7.7676 0.0818
NP_441892.1_1 Forward -266 -249 2.79211 0.135
NP_441892.1_1 Forward -374 -357 1.90713 0.147
NP_441892.1_1 Reverse -186 -203 -0.846137 0.192
NP_441892.1_1 Forward -196 -179 -4.77938 0.268
NP_440665.1_2 Forward -196 -177 -3.04881 0.244
NP_442044.1_1 Reverse -105 -124 -13.8652 0.28
NP_441769.1_3 Forward -185 -166 -5.21283 0.245
NP_441541.1_1 Forward -29 -11 6.30445 0.153
NP_441541.1_1 Reverse -10 -28 -0.379982 0.237
NP_442216.1_4 Forward -173 -165 8.08217 0.255
NP_441526.1_6 Reverse -93 -112 3.83436 0.271
NP_440354.1_7 Reverse -104 -122 10.8356 0.224
NP_442809.1_6 Reverse -195 -214 4.71934 0.256
NP_440546.1_4 Forward -257 -247 7.62206 0.23
NP_440546.1_4 Forward -119 -109 6.65249 0.288
NP_441230.1_5 Reverse -105 -124 5.40766 0.182
NP_440462.1_6 Forward -121 -111 15.418 0.0142
NP_440462.1_6 Reverse -108 -118 10.7964 0.0396
NP_440868.1_4 Forward -123 -111 20.2952 0.00865
NP_440868.1_4 Reverse -106 -118 8.6921 0.0582
NP_441497.1_1 Forward -28 -14 21.9274 0.0303
NP_442499.1_3 Forward -120 -102 5.13236 0.284
NP_441474.1_1 Forward -153 -134 1.57197 0.247
NP_442402.1_2 Forward -177 -163 14.2569 0.263
NP_442402.1_4 Forward -212 -193 -7.76943 0.278
NP_442402.1_6 Reverse -162 -171 15.7327 0.241
NP_442402.1_10 Forward -251 -241 10.1076 0.3
NP_442460.1_9 Forward -167 -148 15.0441 0.247
NP_440696.1_3 Reverse -54 -72 0.314141 0.233
NP_442039.1_4 Forward -118 -111 15.1821 0.0124
NP_442039.1_4 Reverse -111 -118 15.1821 0.0124
NP_441811.1_1 Forward -381 -362 7.07928 0.28
NP_442837.1_3 Forward -118 -111 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 15.7721 0.0124
NP_440160.1_1 Forward -32 -13 17.5198 0.0544
NP_440160.1_2 Reverse -128 -147 -9.34199 0.293
NP_439994.1_1 Forward -257 -238 12.0942 0.14
NP_442053.1_1 Forward -119 -110 9.34117 0.0666
NP_442053.1_1 Reverse -110 -119 8.84951 0.072
NP_440505.1_3 Forward -121 -111 13.8447 0.0247
NP_440505.1_3 Reverse -108 -118 5.5849 0.222
NP_441102.1_1 Reverse -111 -130 10.0292 0.154
NP_441536.1_10 Reverse -134 -153 15.2408 0.265
NP_441252.1_6 Forward -76 -69 11.6422 0.288
NP_441203.1_1 Forward -327 -308 -17.0118 0.273
NP_442532.1_7 Forward -119 -105 22.3207 0.0421
NP_440914.1_1 Forward -119 -109 14.0802 0.0188
NP_440914.1_1 Reverse -90 -100 9.00547 0.186
NP_440914.1_1 Reverse -327 -337 7.5416 0.232
NP_440914.1_1 Reverse -195 -205 6.85846 0.263
NP_441011.1_8 Reverse -111 -120 16.9127 0.00602
NP_441011.1_8 Forward -118 -109 8.94785 0.141
NP_442533.1_1 Reverse -374 -393 -12.2919 0.236
NP_442533.1_1 Reverse -149 -168 -16.5201 0.271
NP_442533.1_1 Reverse -150 -169 -17.7985 0.295
NP_442533.1_6 Forward -119 -110 7.86621 0.0862
NP_442533.1_6 Reverse -110 -119 7.37455 0.0898
NP_442533.1_6 Forward -99 -90 3.24465 0.219
NP_442533.1_6 Forward -365 -356 2.35967 0.259
NP_442232.1_3 Reverse -102 -121 -13.1769 0.282
NP_442322.1_4 Forward -154 -137 -9.49991 0.295
NP_442229.1_1 Forward -101 -87 5.89884 0.246
NP_441482.1_7 Forward -125 -111 -9.04686 0.193
NP_441482.1_7 Reverse -104 -118 -10.8168 0.216
NP_439944.1_9 Forward -118 -108 15.5163 0.0177
NP_439944.1_9 Reverse -111 -121 10.3048 0.0887
NP_441697.1_5 Forward -33 -14 -9.2154 0.268
NP_441028.1_6 Forward -377 -367 8.23937 0.216
NP_441028.1_6 Forward -173 -163 5.19112 0.265
NP_439945.1_2 Forward -28 -11 12.9618 0.237
NP_440116.1_8 Reverse -111 -130 -9.047 0.267
NP_441527.1_4 Forward -36 -17 -12.0802 0.285
NP_441527.1_4 Reverse -154 -173 -12.7486 0.293
NP_440115.1_6 Reverse -107 -117 6.76487 0.167
NP_440115.1_6 Forward -190 -180 6.46988 0.181
NP_440007.1_9 Forward -123 -109 1.86788 0.282
NP_441347.1_9 Forward -28 -15 10.5412 0.249
NP_441602.1_3 Forward -124 -105 -3.04881 0.241
NP_441106.1_1 Forward -120 -111 18.191 0.0028
NP_441106.1_1 Reverse -109 -118 9.34117 0.0333
NP_442306.1_10 Forward -124 -105 -19.4701 0.197
NP_441286.1_1 Reverse -109 -121 3.77555 0.0435
NP_441286.1_1 Forward -120 -108 -3.99259 0.148
NP_441286.1_1 Reverse -177 -189 -6.05754 0.245
NP_442674.1_3 Forward -195 -176 7.07848 0.222
NP_440670.1_8 Forward -119 -110 16.3227 0.00291
NP_440670.1_8 Reverse -110 -119 15.1427 0.00768
NP_441886.1_1 Reverse -175 -194 5.70265 0.159
NP_440886.1_7 Forward -120 -110 8.53436 0.0805
NP_440886.1_7 Forward -393 -383 5.87944 0.158
NP_442614.1_2 Reverse -194 -208 9.63603 0.242
NP_442072.1_9 Reverse -109 -127 -23.482 0.297
NP_442401.1_2 Forward -74 -55 15.0432 0.109
NP_440907.2_8 Forward -118 -108 17.2858 0.00883
NP_440907.2_8 Reverse -111 -121 7.84605 0.117
NP_440907.2_8 Reverse -179 -189 6.66608 0.157
NP_442264.1_1 Forward -265 -246 18.879 0.159
NP_441463.1_3 Reverse -100 -119 -9.14533 0.277
NP_441463.1_3 Forward -109 -90 -10.6203 0.299
NP_441463.1_5 Forward -120 -106 12.291 0.19
NP_441626.1_2 Forward -118 -111 15.7721 0.0124
NP_441626.1_2 Reverse -111 -118 15.7721 0.0124
NP_442365.1_7 Forward -123 -104 4.03102 0.153
NP_440387.1_1 Forward -119 -103 5.46674 0.0322
NP_440387.1_1 Reverse -110 -126 -6.33298 0.279
NP_441431.1_2 Forward -102 -88 5.80051 0.288
NP_441836.1_2 Reverse -84 -103 0.0977854 0.208
NP_441174.1_2 Forward -122 -108 12.291 0.258
NP_442805.1_4 Reverse -346 -364 22.0453 0.0569
NP_440114.1_10 Forward -119 -105 17.1092 0.0122
NP_442323.1_7 Forward -181 -162 3.04693 0.252
NP_441510.2_7 Forward -125 -111 10.9137 0.28
NP_440287.1_6 Reverse -108 -127 3.14605 0.226
NP_441720.1_2 Reverse -106 -125 10.815 0.213
NP_440766.1_4 Reverse -106 -120 8.65272 0.0871
NP_441237.1_9 Reverse -179 -189 13.7464 0.0687
NP_441237.1_9 Reverse -320 -330 11.5831 0.17
NP_442635.1_3 Reverse -68 -87 7.27595 0.299
NP_442930.1_1 Reverse -220 -230 16.4008 0.19
NP_442930.1_1 Forward -176 -166 9.02601 0.299
NP_439910.1_2 Reverse -199 -216 -22.184 0.215
NP_442867.1_8 Forward -202 -183 17.994 0.122
NP_442867.1_8 Forward -379 -360 9.43923 0.224
NP_440457.1_1 Forward -123 -111 1.80894 0.223
NP_440987.1_6 Forward -26 -7 9.19359 0.281
NP_440798.1_6 Forward -118 -105 9.85238 0.0874
NP_440798.1_6 Reverse -111 -124 6.1158 0.14
NP_441801.1_4 Forward -172 -162 2.53664 0.292
NP_441436.1_8 Reverse -294 -313 7.96426 0.293
NP_440473.1_9 Reverse -47 -66 -6.68705 0.236
NP_442509.1_9 Reverse -110 -120 12.1726 0.101
NP_442509.1_9 Forward -187 -177 9.91099 0.192
NP_442509.1_9 Forward -352 -342 6.46942 0.268
NP_440554.1_4 Forward -118 -108 16.6963 0.0189
NP_440554.1_4 Reverse -111 -121 14.6313 0.02
NP_442862.1_3 Reverse -123 -140 6.62702 0.263
NP_441885.1_5 Forward -119 -109 2.24165 0.0822
NP_441885.1_5 Reverse -110 -120 1.65166 0.106
NP_441885.1_5 Forward -328 -318 -0.314959 0.195
NP_441428.1_8 Forward -127 -108 8.55425 0.206
NP_442341.1_7 Forward -217 -203 6.98109 0.113
NP_442341.1_7 Forward -329 -315 2.65453 0.249
NP_441173.1_9 Forward -355 -347 11.0321 0.228
NP_440409.1_10 Reverse -127 -146 7.66927 0.29
NP_443000.1_7 Forward -121 -111 8.73149 0.0437
NP_443000.1_7 Reverse -108 -118 1.74999 0.229
NP_440507.2_3 Reverse -101 -120 11.11 0.195
NP_440507.2_3 Forward -108 -89 8.06178 0.261
NP_440552.1_8 Forward -26 -9 10.2698 0.269
NP_442513.1_5 Reverse -102 -121 11.11 0.266
NP_441842.1_10 Forward -126 -112 9.34103 0.192
NP_440275.1_3 Reverse -108 -118 18.7612 0.0082
NP_440275.1_3 Forward -121 -111 8.4365 0.0602
NP_440091.1_1 Forward -123 -111 8.29878 0.0653
NP_440091.1_1 Reverse -106 -118 8.10212 0.0696
NP_441307.1_6 Reverse -139 -158 3.83436 0.296
NP_440679.1_10 Reverse -145 -164 -18.5851 0.279
NP_442451.1_2 Forward -390 -371 -6.68705 0.232
NP_442451.1_2 Forward -127 -108 -7.86702 0.24
NP_442451.1_2 Forward -195 -176 -11.1119 0.287
NP_441389.1_5 Reverse -152 -171 12.9791 0.25
NP_439962.1_4 Forward -204 -185 -2.55715 0.231
NP_440149.1_8 Reverse -110 -129 3.93269 0.0884
NP_440149.1_8 Reverse -373 -392 -7.96535 0.296
NP_441105.1_3 Forward -110 -91 -8.55534 0.274
NP_441730.1_3 Forward -41 -23 13.8793 0.224
NP_440216.1_1 Reverse -110 -124 -1.27871 0.0303
NP_440216.1_1 Forward -119 -105 -3.44199 0.082
NP_440172.1_1 Forward -119 -109 10.9931 0.0445
NP_442015.1_10 Forward -123 -110 0.0192843 0.245
NP_442015.1_10 Forward -313 -300 -0.275709 0.259
NP_441226.1_7 Forward -118 -111 14.4934 0.0123
NP_441226.1_7 Reverse -111 -118 14.4934 0.0123
NP_441226.1_7 Forward -57 -50 6.52862 0.253
NP_442222.1_3 Forward -267 -248 13.0775 0.228
NP_441111.1_7 Reverse -111 -119 18.7023 0.00294
NP_441111.1_7 Forward -118 -110 8.96754 0.0463
NP_441766.1_2 Reverse -110 -119 16.2243 0.0047
NP_441766.1_2 Forward -119 -110 9.14451 0.0337
NP_440416.1_1 Forward -119 -100 -3.14714 0.116
NP_440416.1_9 Forward -106 -87 -20.5517 0.286
NP_443052.1_8 Reverse -100 -119 -5.80207 0.136
NP_443052.1_9 Forward -399 -380 -3.44213 0.25
NP_442154.1_1 Reverse -56 -74 -7.94566 0.151
NP_442564.1_9 Forward -119 -105 13.6387 0.275
NP_440261.1_5 Reverse -111 -124 6.80412 0.0316
NP_440261.1_5 Reverse -179 -192 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTATGTCCCCCACCGCTAGAACTTTCCCCCCCTGGGCCGTCCATTTTTGCAAACCGCCTAACTGGGCTTTGGTCAATCCCCATAAGCCTCCCTGAACATCCCGCCATAATTCCCTGGCATCCATGTTGTTAAAGCCGCCGGAGGGCATGGTTTTCACCGGGCCAATCAAGAGAATATTTAAACGTCGATAACTGTTGCCTTCCCCCACTAGGGGCAATCCCACTAATATTTCCCCAGGCTCCATTCCCGCCAACTCACTCCAAGCCTGGCCAATACTGACGGCGATCGCATCCTCTCCGTGCCCATTGCTGAGCAGTAGAATCTTCGGCAACATCCAACACTCCCATCCGTTACACTGAAAATAAGCAGAGTATTAAGAATTATTAAATAAGTATCACC

CDS

ATGGGTTGGGAATTTTTTTCGCTAGAGACATTGCAGGAATTGGCCCGCCAATATGGTTACGGAGCCGTATTCTTTGGCATTGCCTTGGAAAATGCAGGCATTCCCATCCCTGGAGAAACCATAACCCTGTTGGGGGGCTTTTTGGCCGGCAGTGGAGATTTAAGTTATGGCGGGGTATTAATCGCGGCGATCGCCGGGGCCGTGTTGGGGGACAGTTGTGGTTACTGGGTGGGACGCTGGGGCGGTTGGCCCTTACTAACCAGGGCGGCCCAACTGTTCAACATTCCCCAGGAAAAACTAGACCAAGCCCGGCATAAATTTAGTCAGAATGGGGCGGCCGCAGTGTTTTTTGGTCGTTTTGTTACCCTGTTACGAATTTTTGCGGGGCCCATGGCCGGCATTGTCCGCATGCCCTACGGCAAATTCCTGTTGTACAACATCGGCGGTGCCTCCGTCTGGGCTGCCATCACCGTTAGTTTGGCTTACTTTTTGGGGCGGGTGGTCACCATCGAGCAAATTATTGCCTGGACGACCCAATTCAGTTGGTTTGCCCTAGCAGCAGTGGTGGGCATGGTGGGCATTTACTTTGTCTTTCACTTCCTGCAAAAGCGTTTTGATCAAACCATTGAGTCGACCATAGGCGATCGCCCCCAATAA

Protein

MGWEFFSLETLQELARQYGYGAVFFGIALENAGIPIPGETITLLGGFLAGSGDLSYGGVLIAAIAGAVLGDSCGYWVGRWGGWPLLTRAAQLFNIPQEKLDQARHKFSQNGAAAVFFGRFVTLLRIFAGPMAGIVRMPYGKFLLYNIGGASVWAAITVSLAYFLGRVVTIEQIIAWTTQFSWFALAAVVGMVGIYFVFHFLQKRFDQTIESTIGDRPQ