Your browser is old and dusty. Try Google Chrome!

Details for slr0216

ORF slr0216
Accession NP_442143.1
Symbol cobP
Category Cobalamin, heme, phycobilin and porphyrin
Definition bifunctional cobalamin biosynthesis protein CobP
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -163 -177 9.73436 0.0698
NP_441061.1_2 Forward -170 -156 7.37441 0.104
NP_441061.1_2 Forward -362 -348 4.12949 0.155
NP_441061.1_2 Reverse -193 -207 -1.77037 0.272
NP_440795.1_7 Forward -170 -163 14.6904 0.0123
NP_440795.1_7 Reverse -163 -170 14.6904 0.0123
NP_440795.1_7 Reverse -18 -25 14.1988 0.0267
NP_440795.1_7 Reverse -382 -389 6.92228 0.26
NP_441418.1_6 Reverse -162 -181 -11.9969 0.0586
NP_441418.1_6 Forward -171 -152 -29.4998 0.228
NP_442291.1_5 Reverse -161 -177 2.12349 0.133
NP_442291.1_5 Forward -172 -156 1.33684 0.148
NP_442291.1_5 Reverse -16 -32 -2.98973 0.232
NP_441453.1_4 Reverse -162 -170 16.539 0.00633
NP_441453.1_4 Forward -171 -163 16.539 0.00633
NP_441453.1_4 Reverse -17 -25 6.80426 0.121
NP_443041.1_7 Reverse -163 -180 3.48043 0.197
NP_441960.1_7 Reverse -290 -309 7.17762 0.275
NP_442151.1_6 Forward -26 -12 6.78443 0.221
NP_442838.1_7 Forward -176 -157 -10.227 0.232
NP_441818.1_1 Reverse -18 -29 16.971 0.0111
NP_441818.1_1 Forward -170 -159 13.1362 0.0861
NP_441818.1_1 Reverse -163 -174 9.69459 0.232
NP_440226.1_1 Reverse -373 -392 5.11266 0.166
NP_440226.1_1 Reverse -17 -36 3.44104 0.225
NP_441465.1_8 Forward -37 -19 10.8356 0.193
NP_441630.1_3 Reverse -154 -173 5.30933 0.143
NP_441630.1_3 Reverse -365 -384 1.67108 0.239
NP_442173.1_1 Forward -170 -162 15.4574 0.00633
NP_442173.1_1 Reverse -163 -171 15.4574 0.00633
NP_442173.1_1 Forward -25 -17 5.72262 0.203
NP_442752.1_4 Forward -171 -164 13.8055 0.0199
NP_442752.1_4 Reverse -162 -169 13.8055 0.0199
NP_442752.1_4 Reverse -373 -380 10.8555 0.0846
NP_442752.1_4 Reverse -192 -199 5.44732 0.202
NP_442752.1_4 Reverse -17 -24 4.26735 0.293
NP_442752.1_4 Forward -396 -389 4.26735 0.293
NP_443027.1_4 Forward -173 -163 14.828 0.0437
NP_443027.1_4 Reverse -160 -170 13.1564 0.0521
NP_441745.1_3 Forward -23 -4 17.5998 0.201
NP_441812.1_3 Reverse -161 -175 9.14437 0.245
NP_442975.1_10 Forward -175 -161 22.615 0.000219
NP_442975.1_10 Forward -400 -386 8.45543 0.0964
NP_442975.1_10 Forward -46 -32 1.47397 0.297
NP_440784.1_7 Forward -170 -163 15.9687 0.0123
NP_440784.1_7 Reverse -163 -170 15.9687 0.0123
NP_440784.1_7 Forward -25 -18 13.2155 0.0365
NP_440784.1_7 Reverse -18 -25 12.1338 0.0604
NP_442909.1_7 Forward -395 -381 10.3237 0.14
NP_440061.1_9 Forward -173 -159 16.9119 0.0201
NP_440061.1_9 Forward -384 -370 7.17714 0.216
NP_440061.1_9 Forward -28 -14 6.78381 0.232
NP_440061.1_9 Forward -238 -224 5.01387 0.298
NP_440110.1_8 Reverse -371 -390 0.0977854 0.216
NP_440110.1_8 Forward -239 -220 -2.16383 0.262
NP_441476.1_5 Forward -176 -157 -2.85214 0.231
NP_441476.1_5 Reverse -187 -206 -4.32711 0.25
NP_441476.1_5 Forward -206 -187 -5.9004 0.271
NP_442062.1_8 Reverse -162 -172 19.4496 0.000558
NP_442062.1_8 Forward -171 -161 17.3846 0.00193
NP_442062.1_8 Reverse -192 -202 13.7464 0.0187
NP_442062.1_8 Reverse -17 -27 6.96153 0.112
NP_442062.1_8 Reverse -387 -397 6.37155 0.127
NP_442826.1_6 Forward -31 -12 14.7491 0.122
NP_440761.1_4 Reverse -343 -362 -12.9802 0.257
NP_440761.1_4 Reverse -349 -368 -13.1769 0.257
NP_441900.1_2 Forward -244 -226 -4.50479 0.288
NP_440304.1_4 Forward -173 -163 10.8948 0.051
NP_440304.1_4 Reverse -160 -170 9.91146 0.051
NP_440304.1_4 Reverse -15 -25 8.53483 0.0756
NP_440304.1_4 Forward -67 -57 2.83163 0.299
NP_442242.1_4 Forward -170 -163 14.3954 0.0124
NP_442242.1_4 Reverse -163 -170 14.3954 0.0124
NP_442242.1_4 Reverse -18 -25 12.0355 0.0521
NP_442242.1_4 Forward -25 -18 11.5438 0.089
NP_440044.1_8 Forward -170 -151 5.99764 0.0957
NP_440044.1_8 Forward -395 -376 -0.983855 0.233
NP_440291.1_1 Forward -194 -175 15.9291 0.278
NP_441208.1_9 Reverse -384 -398 6.19444 0.253
NP_441208.1_9 Reverse -159 -173 5.40779 0.267
NP_442110.1_7 Reverse -162 -176 2.75286 0.222
NP_442110.1_7 Reverse -192 -206 0.786239 0.248
NP_440856.1_4 Forward -389 -370 -2.75381 0.22
NP_440856.1_4 Reverse -155 -174 -4.72043 0.265
NP_441083.1_3 Reverse -197 -207 15.8108 0.123
NP_441083.1_5 Forward -171 -161 20.3345 0.00053
NP_441083.1_5 Reverse -162 -172 11.3864 0.0159
NP_441083.1_5 Reverse -17 -27 8.04317 0.046
NP_441083.1_5 Forward -396 -386 1.25834 0.213
NP_441083.1_5 Forward -26 -16 0.373358 0.231
NP_441083.1_5 Reverse -387 -397 -0.708283 0.276
NP_441083.1_5 Forward -382 -372 -0.806614 0.28
NP_442827.1_8 Reverse -379 -398 2.16195 0.165
NP_441738.1_2 Forward -169 -162 15.28 0.0102
NP_441738.1_2 Reverse -164 -171 15.28 0.0102
NP_441738.1_2 Forward -199 -192 10.2652 0.101
NP_441558.1_5 Forward -365 -346 14.5524 0.0485
NP_441558.1_5 Forward -28 -9 7.57094 0.176
NP_440209.1_1 Reverse -162 -170 18.1123 0.00295
NP_440209.1_1 Forward -171 -163 18.1123 0.00295
NP_440209.1_1 Reverse -17 -25 8.37755 0.0576
NP_440209.1_1 Forward -382 -374 2.1827 0.254
NP_442889.1_1 Reverse -285 -304 -15.1435 0.288
NP_442889.1_8 Reverse -14 -28 13.5686 0.0588
NP_442889.1_8 Forward -174 -160 13.4703 0.0588
NP_440178.1_7 Reverse -161 -180 -22.3217 0.261
NP_440178.1_7 Forward -397 -378 -23.2067 0.298
NP_442570.1_3 Reverse -357 -376 6.88262 0.151
NP_442570.1_3 Reverse -379 -398 -6.68705 0.259
NP_441716.1_1 Forward -171 -157 10.816 0.0936
NP_441716.1_1 Reverse -204 -218 5.60446 0.224
NP_441716.1_1 Reverse -162 -176 3.34284 0.268
NP_441327.1_1 Reverse -57 -76 2.86785 0.279
NP_441598.1_1 Forward -315 -296 8.35759 0.295
NP_442111.1_4 Reverse -161 -175 10.7177 0.0518
NP_442111.1_4 Forward -27 -13 9.2427 0.0619
NP_442111.1_4 Reverse -386 -400 6.48943 0.123
NP_442111.1_4 Forward -172 -158 2.06454 0.291
NP_441163.1_4 Forward -373 -354 12.63 0.284
NP_440906.1_5 Forward -170 -163 15.8704 0.0124
NP_440906.1_5 Reverse -163 -170 15.8704 0.0124
NP_440906.1_5 Forward -25 -18 13.3138 0.0268
NP_440906.1_5 Reverse -18 -25 6.13563 0.241
NP_440747.1_10 Reverse -159 -171 7.4138 0.00422
NP_440747.1_10 Forward -174 -162 -2.02597 0.0196
NP_440747.1_10 Reverse -384 -396 -11.7607 0.142
NP_440747.1_10 Forward -29 -17 -12.1541 0.227
NP_440747.1_10 Forward -385 -373 -12.3507 0.27
NP_441130.1_10 Forward -398 -384 13.3726 0.0684
NP_441130.1_10 Forward -173 -159 11.2093 0.107
NP_441130.1_10 Reverse -160 -174 8.16106 0.14
NP_441130.1_10 Reverse -385 -399 5.1128 0.247
NP_442973.1_5 Forward -180 -161 14.9458 0.125
NP_441486.1_1 Forward -174 -160 13.1759 0.00897
NP_441486.1_1 Reverse -159 -173 2.65453 0.079
NP_441486.1_1 Forward -29 -15 2.35953 0.0844
NP_442634.1_4 Reverse -160 -174 -3.63866 0.161
NP_442634.1_4 Reverse -15 -29 -5.40861 0.253
NP_441265.1_3 Reverse -11 -25 3.44117 0.181
NP_441014.1_10 Reverse -161 -180 6.58682 0.164
NP_442848.1_1 Forward -177 -163 15.9292 0.0143
NP_442848.1_1 Reverse -156 -170 5.50613 0.0828
NP_442848.1_1 Reverse -381 -395 4.52282 0.1
NP_442848.1_1 Forward -32 -18 1.96621 0.198
NP_442848.1_5 Forward -214 -196 -3.52077 0.293
NP_442848.1_9 Reverse -186 -205 4.22769 0.206
NP_443018.1_3 Forward -170 -163 14.8871 0.0123
NP_443018.1_3 Reverse -163 -170 14.8871 0.0123
NP_443018.1_3 Reverse -355 -362 9.38056 0.128
NP_443018.1_3 Reverse -18 -25 5.15232 0.226
NP_443018.1_3 Forward -25 -18 5.05399 0.238
NP_441316.1_7 Forward -173 -158 -3.26502 0.273
NP_441634.1_8 Reverse -160 -174 5.21113 0.114
NP_441634.1_8 Reverse -385 -399 -2.85201 0.295
NP_440376.1_1 Forward -171 -162 19.4693 0.000692
NP_440376.1_1 Reverse -162 -171 19.4693 0.000692
NP_440376.1_1 Reverse -387 -396 7.86621 0.0583
NP_440376.1_1 Reverse -192 -201 3.7363 0.195
NP_440376.1_1 Forward -396 -387 0.589713 0.267
NP_440376.1_1 Forward -26 -17 -0.000272808 0.285
NP_440376.1_1 Reverse -17 -26 -0.000272808 0.285
NP_441588.1_4 Reverse -164 -174 6.96153 0.178
NP_441588.1_4 Forward -169 -159 6.37155 0.2
NP_442687.1_7 Forward -172 -162 15.8113 0.0125
NP_442687.1_7 Forward -397 -387 12.2714 0.0813
NP_442687.1_7 Reverse -161 -171 8.92815 0.0994
NP_442687.1_7 Reverse -242 -252 3.81494 0.286
NP_441846.1_10 Reverse -224 -243 -20.3551 0.256
NP_440642.1_10 Forward -316 -302 4.71887 0.25
NP_441422.1_7 Forward -398 -381 -3.69774 0.235
NP_440533.1_3 Reverse -365 -379 17.6008 0.197
NP_440360.1_10 Forward -380 -366 4.71948 0.227
NP_442658.1_1 Forward -173 -163 15.9091 0.00966
NP_442658.1_1 Reverse -160 -170 9.616 0.147
NP_442658.1_1 Forward -203 -193 8.23937 0.199
NP_442658.1_1 Reverse -15 -25 8.04271 0.199
NP_442658.1_1 Forward -398 -388 5.78111 0.25
NP_442782.1_2 Reverse -6 -20 4.32615 0.256
NP_442205.1_9 Reverse -381 -397 -2.69473 0.272
NP_441414.1_6 Reverse -175 -194 -4.81876 0.27
NP_441414.1_9 Forward -171 -152 10.9142 0.0193
NP_441414.1_9 Reverse -162 -181 -3.73712 0.141
NP_441487.1_6 Reverse -154 -173 -0.000545616 0.259
NP_441256.1_1 Forward -240 -221 -6.68705 0.239
NP_442937.1_5 Reverse -157 -176 10.8159 0.152
NP_442937.1_5 Reverse -349 -368 6.39097 0.28
NP_441958.1_5 Forward -172 -162 12.2714 0.00183
NP_441958.1_5 Reverse -161 -171 12.2714 0.00183
NP_441958.1_5 Reverse -16 -26 1.65166 0.0872
NP_441127.1_1 Reverse -234 -248 12.9793 0.204
NP_441097.1_2 Reverse -356 -373 3.0871 0.293
NP_442911.1_2 Forward -181 -162 14.6508 0.0112
NP_442911.1_2 Reverse -152 -171 11.3075 0.0131
NP_442911.1_2 Reverse -7 -26 6.4893 0.0286
NP_442911.1_2 Forward -211 -192 -2.85214 0.104
NP_440153.1_5 Reverse -163 -177 7.07942 0.173
NP_440153.1_5 Forward -395 -381 2.16287 0.237
NP_440153.1_8 Forward -363 -350 3.46087 0.21
NP_441591.1_10 Forward -398 -379 5.11266 0.297
NP_442064.1_4 Forward -238 -219 6.09517 0.257
NP_440993.1_2 Forward -176 -160 7.33503 0.178
NP_440993.1_2 Reverse -157 -173 2.8118 0.262
NP_440827.1_3 Forward -212 -193 11.7992 0.268
NP_440138.1_6 Forward -170 -151 6.98015 0.217
NP_441099.1_5 Reverse -7 -26 -4.6221 0.147
NP_441099.1_5 Reverse -152 -171 -5.60541 0.152
NP_441099.1_5 Forward -36 -17 -12.0953 0.294
NP_442002.1_1 Reverse -183 -201 -6.86402 0.249
NP_442002.1_9 Reverse -372 -379 14.1004 0.074
NP_442002.1_9 Reverse -16 -23 14.1004 0.074
NP_442002.1_9 Forward -172 -165 10.7572 0.185
NP_441294.1_7 Forward -175 -161 15.9698 0.0176
NP_441294.1_7 Forward -400 -386 12.1303 0.113
NP_441294.1_7 Forward -30 -16 9.15464 0.256
NP_441646.1_1 Reverse -155 -174 6.68596 0.173
NP_441646.1_1 Reverse -10 -29 5.70265 0.176
NP_441646.1_1 Reverse -380 -399 3.14605 0.208
NP_441646.1_1 Reverse -278 -297 -0.590531 0.269
NP_442438.1_10 Reverse -382 -396 10.3243 0.0547
NP_442438.1_10 Forward -176 -162 8.35772 0.0782
NP_442438.1_10 Forward -206 -192 7.86607 0.0859
NP_442438.1_10 Reverse -193 -207 5.01447 0.14
NP_442438.1_10 Reverse -157 -171 4.12949 0.152
NP_442438.1_10 Forward -31 -17 0.392915 0.229
NP_442431.1_10 Reverse -228 -246 1.10079 0.26
NP_441000.1_6 Reverse -16 -30 1.96621 0.156
NP_441000.1_6 Reverse -161 -175 -3.44199 0.221
NP_441000.1_6 Forward -172 -158 -5.01529 0.257
NP_442771.1_1 Forward -28 -10 0.117479 0.1
NP_442771.1_1 Reverse -190 -208 -0.275845 0.105
NP_442771.1_1 Forward -173 -155 -7.25734 0.17
NP_440147.1_4 Forward -173 -160 12.8023 0.0326
NP_440147.1_4 Reverse -160 -173 0.805932 0.244
NP_441175.1_7 Forward -201 -182 4.81767 0.296
NP_441550.1_8 Reverse -160 -170 16.7941 0.00906
NP_441550.1_8 Reverse -15 -25 14.7292 0.0132
NP_441550.1_8 Reverse -385 -395 6.96107 0.183
NP_441550.1_8 Forward -28 -18 6.56775 0.201
NP_441550.1_8 Forward -173 -163 6.0761 0.214
NP_441916.1_7 Reverse -162 -172 18.4663 0.00144
NP_441916.1_7 Forward -171 -161 10.3048 0.0261
NP_441916.1_10 Forward -208 -189 -0.000545616 0.294
NP_441041.1_4 Reverse -348 -367 -5.99873 0.162
NP_441041.1_4 Forward -294 -275 -6.09707 0.163
NP_441041.1_4 Reverse -162 -181 -9.63698 0.219
NP_441041.1_4 Reverse -354 -373 -10.6203 0.235
NP_441041.1_7 Forward -174 -162 10.916 0.0864
NP_442642.1_9 Reverse -155 -172 2.98877 0.192
NP_442396.1_5 Reverse -158 -171 10.934 0.106
NP_442004.1_6 Forward -382 -368 7.57108 0.159
NP_441725.1_5 Reverse -163 -173 11.2881 0.0247
NP_441725.1_5 Forward -170 -160 9.02648 0.0553
NP_441725.1_5 Forward -25 -15 8.92815 0.0553
NP_441725.1_5 Reverse -18 -28 0.275027 0.192
NP_441725.1_5 Forward -381 -371 -0.806614 0.271
NP_441725.1_5 Reverse -193 -203 -1.29827 0.299
NP_439966.1_7 Forward -173 -163 18.4657 0.00473
NP_439966.1_7 Reverse -160 -170 14.8275 0.0177
NP_439966.1_7 Forward -203 -193 9.51767 0.109
NP_439966.1_7 Forward -384 -374 6.66608 0.173
NP_439966.1_9 Forward -173 -164 0.983037 0.253
NP_439966.1_9 Reverse -160 -169 0.884706 0.253
NP_442941.1_3 Reverse -163 -173 11.4848 0.0116
NP_442941.1_3 Forward -170 -160 10.9931 0.0116
NP_442941.1_3 Reverse -18 -28 7.94484 0.0486
NP_440289.1_2 Forward -174 -161 21.3571 0.00262
NP_440289.1_2 Forward -29 -16 -2.53732 0.259
NP_440289.1_2 Reverse -159 -172 -4.60227 0.29
NP_440983.1_5 Forward -243 -224 -8.85033 0.298
NP_440260.1_8 Reverse -153 -171 -7.35568 0.295
NP_442281.1_1 Forward -176 -162 20.3534 0.00192
NP_442281.1_1 Forward -206 -192 3.73557 0.221
NP_442281.1_1 Reverse -349 -363 2.5556 0.263
NP_442847.1_7 Reverse -372 -391 14.5524 0.251
NP_440177.1_9 Reverse -154 -173 12.1925 0.238
NP_442256.1_2 Reverse -160 -178 -9.51896 0.274
NP_001035871.2_7 Forward -286 -276 14.533 0.187
NP_440437.1_1 Forward -388 -369 7.7676 0.0622
NP_440437.1_1 Forward -177 -158 0.982764 0.16
NP_442012.1_1 Reverse -381 -400 -1.27885 0.282
NP_441644.1_6 Forward -171 -161 17.3841 0.00127
NP_441644.1_6 Reverse -17 -27 11.6809 0.0448
NP_441644.1_6 Reverse -162 -172 10.1076 0.0628
NP_441644.1_6 Reverse -354 -364 5.87944 0.174
NP_442215.1_2 Reverse -160 -176 4.58176 0.0832
NP_442029.1_6 Reverse -187 -206 5.30933 0.253
NP_440253.1_2 Reverse -162 -180 11.3272 0.0322
NP_440253.1_2 Forward -171 -153 8.47561 0.0565
NP_440929.1_8 Forward -171 -162 19.2726 0.000701
NP_440929.1_8 Reverse -162 -171 19.2726 0.000701
NP_440929.1_8 Reverse -17 -26 7.66954 0.0624
NP_440929.1_8 Forward -26 -17 7.57121 0.0706
NP_440929.1_8 Forward -396 -387 6.68623 0.0887
NP_440566.1_2 Forward -235 -216 18.7807 0.0438
NP_442933.1_10 Forward -171 -162 17.601 0.00325
NP_442933.1_10 Reverse -162 -171 17.601 0.00325
NP_442933.1_10 Forward -26 -17 5.3096 0.203
NP_442933.1_10 Forward -396 -387 4.52295 0.24
NP_441751.2_8 Forward -170 -156 6.58777 0.0348
NP_441751.2_8 Forward -381 -367 -0.0987402 0.125
NP_441751.2_8 Reverse -163 -177 -2.55701 0.132
NP_441751.2_8 Reverse -18 -32 -4.32697 0.17
NP_441751.2_8 Forward -25 -11 -5.40861 0.206
NP_442926.1_3 Reverse -379 -398 4.916 0.248
NP_442926.1_5 Reverse -187 -206 8.71699 0.296
NP_442554.1_8 Forward -170 -160 18.0729 0.00543
NP_442554.1_8 Reverse -163 -173 13.8447 0.0145
NP_442554.1_8 Forward -362 -352 13.5497 0.018
NP_442554.1_8 Forward -25 -15 7.45319 0.092
NP_442554.1_8 Reverse -18 -28 2.83163 0.253
NP_441762.1_7 Forward -172 -160 11.8387 0.0142
NP_441762.1_7 Reverse -161 -173 2.89058 0.0676
NP_441762.1_7 Reverse -372 -384 -5.95921 0.258
NP_441762.1_7 Reverse -386 -398 -6.84419 0.284
NP_441762.1_7 Forward -397 -385 -7.43418 0.29
NP_442313.1_3 Reverse -274 -293 11.7008 0.224
NP_442142.1_4 Forward -174 -161 15.85 0.0264
NP_442142.1_4 Reverse -159 -172 6.80355 0.154
NP_442292.1_1 Forward -170 -161 18.486 0.00229
NP_442292.1_1 Reverse -163 -172 9.63616 0.0183
NP_442292.1_1 Reverse -18 -27 8.1612 0.0478
NP_442292.1_1 Forward -25 -16 0.0980582 0.239
NP_442292.1_1 Forward -395 -386 -0.393597 0.245
NP_440122.1_2 Forward -221 -202 0.196116 0.265
NP_442476.1_6 Forward -170 -156 8.55439 0.0993
NP_442476.1_6 Forward -381 -367 0.0979218 0.274
NP_442476.1_6 Forward -25 -11 -0.295402 0.294
NP_442381.1_8 Reverse -370 -389 -4.52377 0.137
NP_442381.1_8 Forward -174 -155 -6.09707 0.152
NP_442381.1_8 Reverse -6 -25 -14.5535 0.283
NP_441711.1_4 Forward -163 -144 6.88262 0.144
NP_443009.1_5 Reverse -161 -172 18.3477 0.00265
NP_443009.1_5 Reverse -191 -202 13.6278 0.0301
NP_441715.1_4 Reverse -163 -173 16.303 0.0117
NP_441715.1_4 Forward -170 -160 7.84651 0.107
NP_441715.1_4 Reverse -18 -28 5.68323 0.189
NP_441448.1_1 Forward -230 -211 8.94757 0.198
NP_441198.1_5 Forward -169 -156 17.5216 0.206
NP_441198.1_8 Reverse -15 -25 12.5877 0.12
NP_441758.1_7 Forward -25 -11 16.6169 0.281
NP_441468.1_1 Forward -170 -163 15.8704 0.0124
NP_441468.1_1 Reverse -163 -170 15.8704 0.0124
NP_441468.1_1 Forward -25 -18 6.3323 0.202
NP_441468.1_1 Reverse -18 -25 6.13563 0.209
NP_441020.2_6 Reverse -160 -177 17.0501 0.0221
NP_441020.2_6 Forward -173 -156 11.2486 0.124
NP_441020.2_6 Reverse -371 -388 6.23369 0.27
NP_441015.1_10 Reverse -349 -368 -1.37718 0.172
NP_441015.1_10 Reverse -229 -248 -10.3253 0.284
NP_441015.1_10 Reverse -223 -242 -11.4069 0.296
NP_441673.1_1 Forward -171 -162 20.8459 0.000698
NP_441673.1_1 Reverse -162 -171 20.8459 0.000698
NP_441673.1_1 Forward -396 -387 1.57302 0.0764
NP_441673.1_1 Reverse -387 -396 1.57302 0.0764
NP_441673.1_1 Reverse -17 -26 1.37636 0.114
NP_441673.1_1 Forward -26 -17 1.1797 0.163
NP_441876.1_9 Forward -247 -237 13.8442 0.267
NP_441826.1_2 Forward -177 -163 18.1908 0.0127
NP_441826.1_2 Reverse -156 -170 2.75286 0.12
NP_441826.1_2 Forward -32 -18 -0.295402 0.208
NP_442490.1_9 Reverse -361 -380 -1.86883 0.201
NP_442490.1_9 Reverse -5 -24 -9.047 0.299
NP_442868.1_6 Reverse -160 -170 17.4829 0.012
NP_442868.1_6 Reverse -15 -25 7.25653 0.0829
NP_442868.1_6 Reverse -371 -381 4.10993 0.186
NP_442868.1_6 Forward -173 -163 0.963343 0.205
NP_442719.1_2 Forward -51 -33 3.26332 0.158
NP_442677.1_3 Reverse -60 -79 -4.72043 0.287
NP_441612.1_2 Forward -171 -161 8.54929 0.21
NP_442559.1_3 Forward -298 -279 12.1925 0.209
NP_442227.1_2 Forward -235 -216 2.3594 0.233
NP_442361.1_3 Forward -177 -164 13.9823 0.129
NP_442808.1_1 Forward -172 -162 18.4657 0.00201
NP_442808.1_1 Forward -383 -373 15.0242 0.0285
NP_442808.1_1 Reverse -161 -171 8.63269 0.0481
NP_442808.1_1 Forward -397 -387 7.55106 0.0756
NP_442775.1_6 Reverse -349 -368 11.5042 0.277
NP_440031.1_10 Forward -195 -176 6.78429 0.237
NP_442692.1_8 Reverse -250 -268 20.472 0.145
NP_442820.1_4 Forward -224 -207 11.0519 0.271
NP_442542.1_2 Reverse -160 -173 4.54251 0.3
NP_442050.1_1 Reverse -191 -210 10.9142 0.233
NP_442050.1_1 Forward -230 -211 7.17762 0.275
NP_442050.1_5 Reverse -160 -170 15.6142 0.01
NP_442050.1_5 Forward -173 -163 9.12434 0.193
NP_441114.1_3 Reverse -349 -358 8.65285 0.231
NP_440558.1_2 Forward -216 -197 -0.000545616 0.197
NP_440558.1_2 Forward -399 -380 -6.98204 0.284
NP_441518.1_3 Reverse -152 -171 -13.2752 0.264
NP_442792.1_6 Reverse -223 -242 8.55425 0.192
NP_441878.1_6 Forward -172 -162 10.4031 0.0176
NP_441878.1_6 Reverse -161 -171 10.4031 0.0176
NP_441878.1_6 Reverse -16 -26 0.766681 0.134
NP_441878.1_6 Reverse -191 -201 -7.49312 0.231
NP_441036.1_8 Forward -172 -162 17.7779 0.000554
NP_441036.1_8 Reverse -161 -171 8.33817 0.174
NP_441036.1_8 Forward -383 -373 5.28991 0.295
NP_442650.1_2 Reverse -192 -206 5.01447 0.156
NP_441557.1_5 Forward -171 -162 19.9609 0.000699
NP_441557.1_5 Reverse -162 -171 19.9609 0.000699
NP_441557.1_5 Forward -26 -17 7.57121 0.049
NP_441557.1_5 Reverse -17 -26 1.08137 0.0794
NP_441557.1_5 Forward -396 -387 0.688044 0.128
NP_441557.1_5 Reverse -387 -396 0.688044 0.128
NP_441445.1_1 Forward -216 -197 0.687771 0.27
NP_441590.1_4 Forward -390 -371 5.30853 0.279
NP_442066.2_4 Forward -237 -218 -7.76869 0.286
NP_442066.2_9 Reverse -158 -171 10.344 0.154
NP_442066.2_9 Reverse -369 -382 6.80412 0.267
NP_441308.1_8 Forward -173 -163 10.1081 0.22
NP_440101.1_3 Forward -224 -205 0.786102 0.292
NP_440101.1_10 Reverse -348 -367 4.52268 0.208
NP_441458.1_10 Forward -180 -161 3.14605 0.255
NP_442183.1_1 Reverse -162 -176 21.2391 0.00376
NP_442183.1_1 Reverse -192 -206 12.291 0.0616
NP_442183.1_1 Forward -171 -157 10.7177 0.0807
NP_442397.1_9 Reverse -192 -211 8.16093 0.246
NP_441549.1_7 Forward -306 -287 13.47 0.247
NP_442347.1_2 Forward -170 -161 12.4878 0.056
NP_442347.1_2 Reverse -163 -172 11.1111 0.056
NP_442347.1_2 Forward -395 -386 10.5211 0.058
NP_442347.1_2 Forward -25 -16 5.60459 0.229
NP_442347.1_2 Reverse -18 -27 3.7363 0.284
NP_442645.1_2 Reverse -379 -398 -20.4534 0.288
NP_442645.1_2 Reverse -154 -173 -20.5517 0.288
NP_442888.1_9 Forward -243 -224 12.9791 0.295
NP_441037.1_4 Reverse -160 -170 9.55921 0.21
NP_441037.1_4 Reverse -15 -25 9.46176 0.214
NP_441037.1_4 Reverse -371 -381 7.61007 0.237
NP_441037.1_4 Forward -173 -163 7.02532 0.237
NP_441037.1_8 Forward -224 -205 18.9773 0.208
NP_442594.1_8 Reverse -225 -244 10.5209 0.178
NP_442594.1_8 Reverse -365 -384 1.67108 0.298
NP_441633.1_3 Forward -28 -15 12.704 0.0202
NP_441633.1_3 Forward -173 -160 6.01747 0.0481
NP_441633.1_3 Reverse -160 -173 1.29759 0.109
NP_441633.1_3 Reverse -385 -398 -0.669033 0.148
NP_441633.1_3 Forward -384 -371 -1.849 0.165
NP_441633.1_3 Forward -203 -190 -2.93064 0.177
NP_441633.1_3 Forward -398 -385 -5.68391 0.236
NP_440136.1_2 Forward -170 -163 15.9687 0.0123
NP_440136.1_2 Reverse -163 -170 15.9687 0.0123
NP_440136.1_2 Reverse -193 -200 11.1505 0.0519
NP_440136.1_2 Forward -25 -18 6.43063 0.154
NP_440136.1_2 Reverse -18 -25 6.23397 0.171
NP_442590.1_10 Forward -219 -200 5.89931 0.257
NP_442998.1_10 Forward -169 -162 15.5754 0.0102
NP_442998.1_10 Reverse -164 -171 15.5754 0.0102
NP_442998.1_10 Forward -380 -373 6.0373 0.205
NP_442998.1_10 Forward -24 -17 5.93897 0.206
NP_440299.1_1 Reverse -158 -171 18.5049 0.00393
NP_440299.1_1 Forward -175 -162 11.9167 0.0427
NP_441799.1_1 Reverse -158 -172 14.1586 0.0264
NP_441799.1_1 Reverse -383 -397 9.93039 0.082
NP_441799.1_1 Reverse -13 -27 6.39049 0.174
NP_441007.1_10 Reverse -157 -170 8.67241 0.112
NP_441007.1_10 Reverse -12 -25 1.49425 0.203
NP_441007.1_10 Reverse -368 -381 1.39592 0.203
NP_441007.1_10 Reverse -232 -245 -0.767364 0.293
NP_442334.1_2 Reverse -233 -250 -6.64766 0.264
NP_440256.1_1 Reverse -159 -178 0.786102 0.0805
NP_440256.1_1 Forward -174 -155 -5.31042 0.18
NP_440521.1_6 Reverse -303 -322 14.7491 0.251
NP_441559.1_8 Forward -206 -192 -4.32697 0.222
NP_441559.1_8 Forward -386 -372 -5.31028 0.259
NP_441559.1_8 Forward -176 -162 -6.19526 0.275
NP_441559.1_8 Reverse -167 -181 -6.88358 0.281
NP_440915.1_6 Reverse -158 -172 10.3243 0.0322
NP_440915.1_6 Forward -175 -161 6.3911 0.0826
NP_442069.1_6 Forward -293 -274 3.93269 0.3
NP_442452.1_10 Reverse -210 -229 11.8975 0.297
NP_442866.1_1 Reverse -157 -176 1.76941 0.158
NP_441464.1_8 Forward -171 -157 5.01447 0.26
NP_441464.1_10 Reverse -283 -297 12.9793 0.201
NP_441199.1_1 Forward -335 -316 17.6007 0.153
NP_441199.1_6 Forward -386 -367 14.7491 0.0389
NP_441199.1_6 Forward -175 -156 2.3594 0.198
NP_442993.1_1 Reverse -162 -178 -7.51295 0.146
NP_442386.1_9 Forward -172 -163 15.7322 0.0144
NP_442386.1_9 Reverse -161 -170 13.8639 0.0289
NP_442386.1_9 Forward -202 -193 7.96411 0.213
NP_442386.1_9 Reverse -353 -362 6.48915 0.219
NP_442386.1_9 Forward -383 -374 6.39082 0.219
NP_441750.1_1 Reverse -228 -247 4.62101 0.124
NP_441291.1_3 Forward -212 -193 19.6656 0.0988
NP_441340.1_5 Forward -170 -163 15.6737 0.0124
NP_441340.1_5 Reverse -163 -170 15.6737 0.0124
NP_441340.1_5 Reverse -18 -25 5.93897 0.198
NP_441340.1_5 Forward -25 -18 5.84064 0.208
NP_440168.1_8 Reverse -222 -241 5.01433 0.216
NP_442240.1_2 Forward -395 -376 -17.7001 0.271
NP_440586.1_8 Forward -170 -163 13.2151 0.026
NP_440586.1_8 Reverse -163 -170 13.2151 0.026
NP_440586.1_8 Reverse -18 -25 11.1501 0.0845
NP_442251.1_6 Forward -170 -163 15.2804 0.0124
NP_442251.1_6 Reverse -163 -170 15.2804 0.0124
NP_442251.1_6 Reverse -18 -25 13.7071 0.0268
NP_440192.1_5 Reverse -353 -372 7.47261 0.21
NP_440684.1_9 Forward -177 -163 8.35772 0.233
NP_441262.1_3 Reverse -162 -169 14.7888 0.0223
NP_441262.1_3 Forward -171 -164 14.7888 0.0223
NP_440027.1_3 Forward -181 -163 1.88669 0.295
NP_443051.1_1 Reverse -161 -170 10.4228 0.00754
NP_443051.1_1 Forward -172 -163 10.4228 0.00754
NP_443051.1_1 Reverse -16 -25 8.35786 0.0371
NP_441232.1_10 Forward -37 -18 12.9791 0.0698
NP_441232.1_10 Reverse -6 -25 4.22769 0.201
NP_441232.1_10 Reverse -151 -170 3.6377 0.22
NP_439984.1_3 Reverse -366 -380 13.6669 0.219
NP_439937.1_9 Forward -172 -155 -6.64833 0.157
NP_441595.1_2 Forward -145 -132 10.8524 0.277
NP_440408.1_7 Forward -219 -200 11.7008 0.218
NP_440439.1_1 Reverse -159 -172 1.29759 0.157
NP_440439.1_1 Forward -174 -161 1.19926 0.159
NP_440439.1_1 Forward -385 -372 1.00259 0.164
NP_439943.1_1 Reverse -348 -367 -10.9153 0.29
NP_440372.1_2 Forward -170 -163 16.3621 0.0124
NP_440372.1_2 Reverse -163 -170 16.3621 0.0124
NP_440372.1_2 Reverse -18 -25 6.62729 0.151
NP_440372.1_2 Forward -25 -18 6.52896 0.188
NP_441789.1_7 Forward -391 -372 2.85027 0.219
NP_441789.1_7 Forward -20 -1 -4.32786 0.28
NP_440316.1_10 Reverse -227 -237 5.97822 0.275
NP_439977.1_5 Reverse -156 -175 2.65439 0.17
NP_440139.1_1 Reverse -11 -30 9.7334 0.095
NP_440139.1_1 Reverse -156 -175 7.96345 0.12
NP_440267.1_2 Forward -31 -17 6.58715 0.228
NP_442384.1_10 Forward -171 -158 10.639 0.0428
NP_442384.1_10 Reverse -162 -175 8.37742 0.0656
NP_442384.1_10 Forward -396 -383 7.49244 0.0807
NP_442384.1_10 Forward -26 -13 1.19926 0.267
NP_441877.1_7 Forward -176 -157 -0.689632 0.295
NP_441018.1_7 Reverse -188 -207 10.6192 0.201
NP_441018.1_7 Reverse -275 -294 8.06259 0.256
NP_441018.1_7 Reverse -158 -177 7.07928 0.277
NP_442790.1_4 Reverse -153 -172 -11.6036 0.231
NP_442790.1_4 Forward -180 -161 -13.7669 0.268
NP_442262.1_10 Forward -170 -163 14.1988 0.0123
NP_442262.1_10 Reverse -163 -170 14.1988 0.0123
NP_442262.1_10 Reverse -355 -362 9.47889 0.187
NP_441689.1_5 Forward -173 -163 8.53436 0.132
NP_441689.1_5 Reverse -160 -170 5.87944 0.197
NP_440163.1_10 Forward -174 -164 15.2213 0.0762
NP_440163.1_10 Forward -360 -350 8.53483 0.271
NP_440344.1_10 Forward -178 -161 11.9369 0.006
NP_440344.1_10 Reverse -155 -172 -3.50107 0.0833
NP_442910.1_1 Forward -33 -14 -7.86702 0.269
NP_441965.1_3 Reverse -152 -171 1.76941 0.219
NP_442065.1_5 Reverse -146 -165 5.01433 0.16
NP_440297.1_9 Reverse -163 -173 9.32148 0.0917
NP_440297.1_9 Reverse -18 -28 -0.118297 0.282
NP_440297.1_9 Forward -170 -160 -0.216628 0.282
NP_440297.1_9 Forward -25 -15 -0.314959 0.282
NP_440350.1_5 Reverse -271 -290 1.76941 0.158
NP_442280.1_10 Reverse -275 -293 4.77262 0.294
NP_442553.1_8 Reverse -75 -94 19.1859 0.236
NP_440999.1_9 Forward -400 -386 14.5526 0.0277
NP_440999.1_9 Forward -175 -161 14.1593 0.0277
NP_440999.1_9 Reverse -386 -400 -0.885388 0.22
NP_440999.1_9 Forward -205 -191 -1.5737 0.242
NP_440888.1_2 Forward -171 -157 18.7801 0.00187
NP_440888.1_2 Reverse -162 -176 17.2068 0.00437
NP_440888.1_2 Forward -396 -382 7.3738 0.198
NP_440600.1_4 Reverse -154 -172 -8.14232 0.297
NP_442033.1_10 Forward -398 -379 -14.3569 0.298
NP_441543.1_2 Reverse -163 -172 18.486 0.00236
NP_441543.1_2 Forward -170 -161 16.9127 0.00359
NP_441543.1_2 Reverse -388 -397 5.89959 0.169
NP_441543.1_2 Reverse -18 -27 4.32629 0.26
NP_442845.1_2 Forward -369 -355 6.19444 0.215
NP_442845.1_2 Reverse -156 -170 5.60446 0.228
NP_442845.1_2 Forward -396 -382 4.52282 0.258
NP_441469.1_4 Reverse -188 -207 6.98095 0.282
NP_441469.1_8 Forward -172 -163 16.126 0.00797
NP_441469.1_8 Forward -202 -193 13.7661 0.0719
NP_441469.1_8 Reverse -16 -25 10.1278 0.227
NP_441469.1_8 Reverse -161 -170 6.48957 0.227
NP_443064.1_6 Forward -171 -161 12.5669 0.0796
NP_443064.1_6 Forward -382 -372 9.65817 0.205
NP_442578.1_7 Forward -170 -163 14.5921 0.026
NP_442578.1_7 Reverse -163 -170 14.5921 0.026
NP_442578.1_7 Reverse -18 -25 12.5271 0.0544
NP_442578.1_7 Reverse -374 -381 5.25066 0.251
NP_440710.1_1 Reverse -154 -172 -6.86402 0.228
NP_440071.1_6 Reverse -300 -314 13.9988 0.251
NP_441462.1_2 Forward -171 -161 11.5831 0.00406
NP_441462.1_2 Reverse -162 -172 11.5831 0.00406
NP_441462.1_2 Forward -26 -16 0.471689 0.148
NP_441621.1_7 Forward -173 -159 -3.147 0.188
NP_441621.1_7 Reverse -160 -174 -3.44199 0.188
NP_441621.1_7 Reverse -371 -385 -3.63866 0.192
NP_441929.1_3 Forward -322 -303 4.42435 0.266
NP_443062.1_1 Reverse -162 -180 7.57085 0.172
NP_443062.1_1 Reverse -354 -372 5.6207 0.224
NP_443062.1_6 Forward -179 -160 8.75091 0.138
NP_442204.1_1 Forward -175 -164 0.353664 0.281
NP_442204.1_5 Forward -181 -162 7.86593 0.125
NP_441560.1_10 Forward -179 -160 5.01433 0.298
NP_440516.1_8 Forward -171 -162 16.9127 0.00442
NP_440516.1_8 Reverse -162 -171 16.9127 0.00442
NP_440516.1_8 Reverse -373 -382 0.688044 0.136
NP_440516.1_8 Reverse -17 -26 -0.196935 0.185
NP_441785.1_1 Reverse -162 -176 17.974 0.06
NP_442428.1_5 Forward -170 -163 15.8704 0.0124
NP_442428.1_5 Reverse -163 -170 15.8704 0.0124
NP_442428.1_5 Forward -25 -18 13.1171 0.038
NP_442428.1_5 Reverse -18 -25 6.23397 0.201
NP_442428.1_5 Forward -395 -388 3.67736 0.298
NP_441443.1_1 Forward -130 -111 -5.40875 0.298
NP_441664.1_9 Forward -251 -232 14.1591 0.23
NP_442859.1_2 Forward -200 -181 7.47261 0.199
NP_442859.1_2 Forward -395 -376 5.70265 0.201
NP_441867.1_2 Reverse -225 -244 -20.2567 0.291
NP_440673.1_2 Reverse -67 -86 8.24345 0.275
NP_440673.1_3 Forward -169 -162 12.4288 0.0426
NP_440673.1_3 Reverse -164 -171 12.4288 0.0426
NP_440673.1_3 Forward -24 -17 10.1672 0.149
NP_440673.1_3 Forward -313 -306 6.23397 0.283
NP_441714.1_3 Reverse -155 -173 14.2763 0.191
NP_440865.1_9 Reverse -367 -386 -5.31042 0.213
NP_441052.1_2 Forward -171 -161 19.9412 0.00106
NP_441052.1_2 Reverse -162 -172 10.5014 0.0285
NP_441052.1_2 Forward -396 -386 8.23984 0.0482
NP_441052.1_2 Reverse -17 -27 7.15819 0.0797
NP_441052.1_2 Forward -26 -16 -0.41329 0.277
NP_442219.1_9 Forward -170 -161 17.7976 0.00718
NP_442219.1_9 Reverse -163 -172 8.35786 0.0681
NP_442219.1_9 Forward -395 -386 5.11294 0.186
NP_442219.1_9 Forward -25 -16 5.01461 0.193
NP_440436.1_4 Reverse -163 -172 18.1905 0.00233
NP_440436.1_4 Forward -170 -161 17.2072 0.00233
NP_440436.1_4 Forward -25 -16 6.09583 0.172
NP_441884.1_9 Forward -174 -155 -4.52377 0.0594
NP_441884.1_9 Forward -399 -380 -21.83 0.266
NP_442414.1_10 Reverse -349 -368 17.1082 0.103
NP_441719.1_4 Forward -170 -163 16.3621 0.0124
NP_441719.1_4 Reverse -163 -170 16.3621 0.0124
NP_441719.1_4 Reverse -18 -25 6.62729 0.151
NP_441719.1_4 Forward -25 -18 6.52896 0.188
NP_441719.1_6 Forward -247 -228 12.9783 0.26
NP_441733.1_10 Reverse -159 -172 16.9322 0.0382
NP_441733.1_10 Reverse -370 -383 14.7689 0.0692
NP_441004.1_1 Reverse -367 -386 -2.16383 0.14
NP_441004.1_1 Reverse -186 -205 -4.03212 0.167
NP_441004.1_1 Reverse -187 -206 -11.8003 0.242
NP_441004.1_1 Reverse -228 -247 -12.6852 0.25
NP_441004.1_4 Reverse -303 -313 9.32148 0.259
NP_441004.1_5 Reverse -369 -383 9.14437 0.262
NP_442813.1_2 Forward -324 -305 -3.24547 0.273
NP_442813.1_4 Reverse -352 -371 -5.99873 0.299
NP_442813.1_5 Forward -212 -193 9.53756 0.154
NP_442366.1_3 Reverse -161 -179 8.7706 0.0625
NP_442366.1_3 Reverse -191 -209 2.0841 0.135
NP_440129.1_10 Forward -178 -164 3.8345 0.189
NP_442873.1_5 Forward -244 -225 6.68515 0.299
NP_441115.1_4 Forward -172 -154 7.88485 0.269
NP_442206.1_10 Reverse -162 -177 1.74985 0.219
NP_440328.1_4 Forward -388 -369 4.03102 0.17
NP_443054.1_2 Reverse -160 -174 3.34284 0.24
NP_443054.1_2 Forward -173 -159 3.14618 0.24
NP_442308.1_4 Reverse -156 -175 0.0977854 0.282
NP_441851.1_10 Forward -172 -162 16.008 0.00552
NP_441851.1_10 Reverse -161 -171 15.8113 0.00552
NP_441851.1_10 Reverse -191 -201 14.3364 0.0179
NP_441851.1_10 Reverse -16 -26 7.94484 0.127
NP_441851.1_10 Forward -224 -214 6.37155 0.172
NP_441851.1_10 Forward -27 -17 4.89658 0.24
NP_441851.1_10 Reverse -372 -382 4.20827 0.282
NP_441851.1_10 Forward -397 -387 4.10993 0.287
NP_442622.1_3 Forward -211 -192 -3.04881 0.223
NP_442011.1_1 Forward -172 -153 -2.65548 0.279
NP_442515.1_1 Forward -172 -158 4.81781 0.107
NP_442515.1_1 Reverse -16 -30 -0.688726 0.231
NP_442515.1_1 Forward -27 -13 -3.24533 0.289
NP_442515.1_1 Reverse -161 -175 -4.91696 0.298
NP_441396.1_5 Forward -129 -120 8.55452 0.21
NP_440593.1_3 Reverse -193 -212 -5.80207 0.266
NP_440593.1_10 Forward -273 -254 11.3075 0.243
NP_440165.1_5 Forward -172 -153 7.17762 0.0804
NP_440940.1_7 Forward -181 -163 21.6511 0.0167
NP_440940.1_7 Reverse -7 -25 15.8496 0.0644
NP_441349.1_10 Reverse -152 -171 6.88262 0.0342
NP_441349.1_10 Forward -36 -17 -8.45701 0.275
NP_441349.1_10 Forward -181 -162 -9.047 0.281
NP_440432.1_9 Forward -170 -155 0.471552 0.159
NP_440432.1_9 Forward -25 -10 -1.29841 0.167
NP_440432.1_9 Reverse -163 -178 -3.36336 0.179
NP_442843.1_1 Forward -227 -208 -12.0953 0.298
NP_439960.1_10 Reverse -212 -230 1.39578 0.198
NP_440474.1_8 Forward -170 -156 7.76712 0.199
NP_440474.1_8 Reverse -18 -32 5.30886 0.251
NP_441124.1_5 Forward -142 -132 15.8729 0.188
NP_442450.1_5 Forward -173 -163 9.32148 0.115
NP_442450.1_5 Reverse -371 -381 5.09324 0.263
NP_442450.1_10 Forward -386 -367 5.50519 0.235
NP_442168.1_5 Forward -170 -151 1.57275 0.241
NP_440588.1_2 Forward -210 -191 -1.47551 0.155
NP_440954.1_1 Reverse -354 -373 -11.9969 0.295
NP_440943.1_5 Reverse -136 -150 11.2093 0.273
NP_442006.1_2 Reverse -219 -236 -15.8908 0.23
NP_442006.1_2 Reverse -297 -314 -17.5624 0.279
NP_441003.1_9 Forward -372 -353 3.73603 0.291
NP_441570.1_1 Reverse -17 -35 11.5239 0.00743
NP_441570.1_1 Forward -396 -378 1.00246 0.034
NP_441570.1_1 Forward -171 -153 -6.76569 0.0818
NP_441570.1_1 Reverse -162 -180 -7.84733 0.0968
NP_441570.1_1 Reverse -367 -385 -17.1888 0.267
NP_440078.1_10 Reverse -192 -211 5.211 0.229
NP_441078.1_4 Forward -171 -162 19.6659 0.0007
NP_441078.1_4 Reverse -162 -171 19.6659 0.0007
NP_441078.1_4 Reverse -387 -396 0.589713 0.174
NP_441078.1_4 Reverse -17 -26 0.393051 0.205
NP_441078.1_4 Forward -396 -387 0.393051 0.205
NP_441078.1_4 Forward -26 -17 -0.000272808 0.205
NP_441078.1_4 Forward -201 -192 -1.96689 0.282
NP_442729.1_8 Reverse -158 -171 10.4424 0.125
NP_442729.1_8 Forward -175 -162 8.18076 0.125
NP_442729.1_8 Reverse -13 -26 7.39411 0.153
NP_441663.1_8 Forward -388 -369 8.06259 0.0936
NP_440707.1_8 Forward -245 -226 15.2408 0.27
NP_440526.1_3 Forward -170 -159 10.7762 0.0646
NP_440526.1_3 Reverse -163 -174 1.92649 0.267
NP_440526.1_3 Forward -25 -14 1.6315 0.267
NP_440526.1_3 Forward -362 -351 1.04151 0.267
NP_441432.1_8 Reverse -161 -170 16.8143 0.00595
NP_441432.1_8 Reverse -386 -395 11.0128 0.0629
NP_441432.1_8 Forward -172 -163 8.25953 0.0755
NP_441432.1_8 Reverse -16 -25 5.3096 0.17
NP_442320.1_8 Forward -177 -163 13.2743 0.0144
NP_442320.1_8 Reverse -156 -170 4.42448 0.0504
NP_442320.1_8 Forward -32 -18 -5.9986 0.261
NP_441732.1_2 Forward -175 -159 3.00846 0.0141
NP_441732.1_2 Forward -400 -384 -5.25134 0.0476
NP_440497.1_6 Forward -368 -349 -6.29373 0.264
NP_440629.1_1 Reverse -42 -60 1.19912 0.256
NP_440760.1_1 Forward -201 -182 -4.6221 0.0452
NP_440760.1_1 Forward -26 -7 -12.8819 0.0954
NP_440760.1_1 Forward -382 -363 -14.9469 0.138
NP_440760.1_1 Reverse -162 -181 -22.3217 0.253
NP_440199.1_10 Forward -174 -164 14.533 0.0861
NP_439900.1_9 Forward -375 -356 16.2232 0.171
NP_440913.1_1 Reverse -352 -370 7.39397 0.202
NP_440913.1_1 Reverse -226 -244 6.50899 0.224
NP_440913.1_1 Reverse -160 -178 5.82068 0.234
NP_440713.1_4 Reverse -377 -396 13.5691 0.0973
NP_442489.1_7 Forward -171 -162 20.1576 0.000695
NP_442489.1_7 Reverse -162 -171 20.1576 0.000695
NP_442489.1_7 Forward -396 -387 0.884706 0.145
NP_442489.1_7 Reverse -387 -396 0.884706 0.145
NP_442489.1_7 Reverse -17 -26 0.688044 0.152
NP_442489.1_7 Forward -26 -17 0.491382 0.178
NP_442489.1_7 Reverse -192 -201 -1.86856 0.259
NP_440386.1_1 Reverse -156 -175 0.982764 0.096
NP_442079.1_7 Forward -170 -151 3.93269 0.204
NP_440559.1_1 Forward -170 -161 17.4043 0.00658
NP_440559.1_1 Reverse -163 -172 8.75118 0.0586
NP_440559.1_1 Forward -25 -16 7.47288 0.108
NP_440559.1_1 Reverse -18 -27 6.78456 0.128
NP_440559.1_1 Forward -200 -191 4.22796 0.292
NP_441659.2_8 Forward -171 -161 18.1713 0.00133
NP_441659.2_8 Reverse -162 -172 11.9764 0.0147
NP_441659.2_8 Reverse -17 -27 5.09324 0.117
NP_441659.2_8 Forward -207 -197 -0.0199663 0.282
NP_441659.2_8 Forward -26 -16 -0.0199663 0.282
NP_440860.1_10 Forward -376 -357 12.4875 0.286
NP_440708.1_6 Forward -390 -371 -7.27704 0.248
NP_441185.1_7 Forward -164 -145 14.0608 0.279
NP_442346.1_5 Reverse -161 -171 16.6963 0.00248
NP_442346.1_5 Reverse -16 -26 13.353 0.0261
NP_442346.1_5 Forward -172 -162 9.02648 0.118
NP_442346.1_5 Reverse -353 -363 4.40493 0.29
NP_440352.1_5 Forward -132 -113 11.585 0.254
NP_440545.1_3 Reverse -383 -400 7.217 0.0518
NP_440545.1_3 Reverse -158 -175 5.84037 0.059
NP_440545.1_3 Forward -211 -194 -1.23946 0.165
NP_440545.1_5 Forward -217 -200 9.67528 0.21
NP_442603.1_7 Forward -171 -157 8.3571 0.176
NP_441233.1_9 Forward -175 -156 15.0441 0.217
NP_441888.1_7 Forward -176 -162 12.0943 0.0743
NP_441833.1_4 Forward -170 -163 15.9687 0.0124
NP_441833.1_4 Reverse -163 -170 15.9687 0.0124
NP_441833.1_4 Forward -25 -18 6.3323 0.134
NP_441833.1_4 Reverse -18 -25 6.23397 0.163
NP_441329.1_1 Forward -60 -41 20.1006 0.0847
NP_442162.1_9 Forward -170 -163 16.2637 0.0124
NP_442162.1_9 Reverse -163 -170 16.2637 0.0124
NP_442162.1_9 Reverse -18 -25 6.52896 0.178
NP_442162.1_9 Forward -25 -18 6.43063 0.208
NP_440671.1_4 Forward -177 -163 18.4858 0.0133
NP_440671.1_4 Forward -32 -18 8.84938 0.188
NP_442821.1_2 Forward -322 -303 6.29264 0.177
NP_442140.1_3 Forward -170 -160 13.5497 0.0542
NP_442140.1_3 Reverse -163 -173 8.33817 0.119
NP_442140.1_3 Forward -25 -15 4.99491 0.232
NP_440875.1_9 Reverse -164 -174 8.37203 0.233
NP_441813.1_5 Forward -173 -163 17.188 0.00979
NP_441813.1_5 Reverse -160 -170 8.73149 0.0367
NP_441813.1_5 Forward -28 -18 5.28991 0.138
NP_441813.1_5 Forward -384 -374 0.0783647 0.222
NP_441813.1_5 Reverse -15 -25 -0.806614 0.285
NP_440594.1_8 Forward -64 -51 9.65513 0.183
NP_440590.1_4 Reverse -163 -176 6.01747 0.0583
NP_440590.1_4 Forward -170 -157 2.57589 0.0845
NP_440590.1_4 Forward -362 -349 1.10092 0.133
NP_440567.1_1 Forward -170 -156 16.3225 0.0166
NP_440567.1_1 Forward -25 -11 9.5377 0.0434
NP_440567.1_1 Reverse -163 -177 4.81781 0.111
NP_440567.1_1 Forward -381 -367 2.06454 0.184
NP_442839.1_10 Forward -19 -5 12.1926 0.288
NP_442497.1_8 Reverse -309 -328 16.8132 0.231
NP_442497.1_10 Forward -170 -161 10.4228 0.0087
NP_442497.1_10 Reverse -163 -172 10.4228 0.0087
NP_442497.1_10 Forward -25 -16 10.0295 0.0222
NP_442497.1_10 Forward -381 -372 0.29472 0.199
NP_442497.1_10 Forward -200 -191 0.29472 0.199
NP_442497.1_10 Reverse -18 -27 -1.18024 0.256
NP_440821.1_4 Forward -173 -163 19.0562 0.00399
NP_440821.1_4 Reverse -160 -170 17.9746 0.00497
NP_440821.1_4 Reverse -15 -25 9.81313 0.0246
NP_440821.1_4 Forward -28 -18 8.04317 0.0557
NP_440821.1_4 Reverse -371 -381 -0.0199663 0.217
NP_440821.1_4 Forward -398 -388 -0.314959 0.251
NP_441239.1_9 Forward -173 -161 13.3137 0.037
NP_441239.1_9 Reverse -160 -172 9.67541 0.0987
NP_441239.1_9 Forward -203 -191 5.15219 0.227
NP_441239.1_9 Forward -384 -372 4.26721 0.256
NP_441239.1_9 Forward -216 -204 3.38223 0.285
NP_441951.1_4 Reverse -156 -175 2.65439 0.283
NP_441951.1_4 Reverse -348 -367 1.17943 0.287
NP_440156.1_3 Reverse -150 -169 7.7676 0.228
NP_440400.1_1 Forward -210 -191 1.6703 0.263
NP_440604.1_6 Forward -171 -152 3.83436 0.131
NP_442044.1_9 Reverse -162 -181 4.62101 0.224
NP_441017.1_6 Forward -175 -161 16.4202 0.0651
NP_440876.1_5 Forward -380 -361 5.70265 0.283
NP_440949.1_7 Forward -179 -160 10.6184 0.233
NP_440354.1_7 Reverse -156 -174 9.16393 0.229
NP_442052.1_8 Forward -209 -199 13.5497 0.253
NP_442809.1_6 Forward -213 -194 1.86774 0.269
NP_440546.1_4 Reverse -162 -172 11.8882 0.0679
NP_440546.1_4 Reverse -354 -364 10.3369 0.109
NP_440546.1_4 Forward -171 -161 10.046 0.109
NP_440546.1_4 Forward -363 -353 9.56122 0.131
NP_440462.1_6 Forward -173 -163 15.418 0.0142
NP_440462.1_6 Reverse -160 -170 10.3048 0.0396
NP_440462.1_6 Forward -384 -374 4.89658 0.18
NP_440868.1_4 Reverse -158 -170 7.4138 0.0691
NP_440868.1_4 Forward -386 -374 7.31547 0.0718
NP_440868.1_4 Forward -175 -163 1.7106 0.174
NP_441474.1_1 Forward -392 -373 -3.04956 0.29
NP_442402.1_4 Reverse -166 -185 -8.85106 0.284
NP_442402.1_9 Reverse -194 -213 14.5524 0.18
NP_441084.1_6 Forward -365 -351 16.5189 0.0654
NP_440696.1_3 Forward -396 -378 -4.11075 0.296
NP_442039.1_4 Forward -170 -163 15.1821 0.0124
NP_442039.1_4 Reverse -163 -170 15.1821 0.0124
NP_441811.1_4 Forward -173 -154 -0.39387 0.295
NP_441811.1_8 Reverse -367 -381 9.5377 0.227
NP_441811.1_8 Reverse -11 -25 6.3911 0.273
NP_441811.1_8 Reverse -186 -200 5.89945 0.289
NP_442380.1_10 Reverse -344 -362 10.7372 0.242
NP_442696.1_6 Forward -207 -188 -11.5053 0.235
NP_442837.1_3 Forward -170 -163 15.7721 0.0124
NP_442837.1_3 Reverse -163 -170 15.7721 0.0124
NP_442837.1_3 Forward -25 -18 13.5105 0.0268
NP_442837.1_3 Forward -381 -374 9.18389 0.144
NP_442837.1_3 Reverse -18 -25 6.13563 0.25
NP_442053.1_1 Forward -171 -162 18.3876 0.0007
NP_442053.1_1 Reverse -162 -171 18.3876 0.0007
NP_442053.1_1 Forward -382 -373 10.8161 0.0481
NP_442053.1_1 Reverse -387 -396 5.40793 0.187
NP_440505.1_3 Reverse -160 -170 16.598 0.00683
NP_440505.1_3 Forward -173 -163 13.8447 0.0247
NP_440520.1_10 Forward -69 -50 14.8466 0.157
NP_441203.1_1 Reverse -163 -182 -11.0136 0.137
NP_441203.1_1 Reverse -193 -212 -19.8634 0.297
NP_441408.2_7 Forward -371 -352 -0.39387 0.234
NP_440914.1_1 Forward -171 -161 17.5935 0.000537
NP_440914.1_1 Reverse -17 -27 13.4947 0.0297
NP_440914.1_1 Reverse -162 -172 8.6151 0.186
NP_441011.1_8 Reverse -163 -172 16.9127 0.00602
NP_441011.1_8 Forward -25 -16 11.6028 0.0754
NP_441011.1_8 Forward -170 -161 8.25953 0.144
NP_442533.1_1 Reverse -175 -194 -11.9969 0.236
NP_442533.1_6 Forward -171 -162 17.2076 0.00137
NP_442533.1_6 Reverse -162 -171 17.2076 0.00137
NP_442533.1_6 Reverse -354 -363 11.5045 0.0432
NP_442533.1_6 Reverse -387 -396 5.3096 0.145
NP_442533.1_6 Reverse -17 -26 5.3096 0.145
NP_442533.1_6 Reverse -210 -219 1.96635 0.28
NP_442533.1_6 Reverse -205 -214 1.86802 0.284
NP_442541.1_10 Reverse -204 -218 2.26061 0.263
NP_442232.1_3 Reverse -379 -398 -0.0988766 0.147
NP_442232.1_3 Reverse -154 -173 -12.3902 0.282
NP_442232.1_3 Reverse -365 -384 -12.6852 0.282
NP_442232.1_3 Reverse -369 -388 -15.7335 0.296
NP_442322.1_4 Forward -371 -354 -4.19006 0.256
NP_442229.1_1 Reverse -160 -174 8.94708 0.184
NP_441219.1_4 Reverse -286 -305 6.58763 0.217
NP_441482.1_7 Forward -177 -163 8.35772 0.0173
NP_441482.1_7 Reverse -186 -200 -1.5737 0.0755
NP_441482.1_7 Reverse -11 -25 -10.9151 0.222
NP_439944.1_9 Forward -170 -160 19.1546 0.00329
NP_439944.1_9 Reverse -163 -173 10.3048 0.0887
NP_439944.1_9 Forward -25 -15 7.64985 0.134
NP_439944.1_9 Reverse -18 -28 7.15819 0.153
NP_441028.1_6 Forward -40 -30 10.6976 0.197
NP_441028.1_6 Forward -248 -238 6.0761 0.232
NP_441028.1_6 Reverse -316 -326 5.19112 0.265
NP_442202.1_4 Reverse -385 -399 12.9322 0.273
NP_440115.1_6 Reverse -159 -169 9.7148 0.115
NP_440115.1_6 Reverse -370 -380 8.4365 0.13
NP_440115.1_6 Reverse -14 -24 7.15819 0.158
NP_440115.1_6 Reverse -384 -394 5.5849 0.236
NP_440007.1_9 Forward -175 -161 4.03116 0.267
NP_439965.1_2 Reverse -354 -373 9.43923 0.214
NP_441680.1_4 Forward -293 -274 1.17943 0.246
NP_441602.1_3 Reverse -157 -176 -3.44213 0.246
NP_441106.1_1 Forward -172 -163 18.191 0.0028
NP_441106.1_1 Reverse -161 -170 9.63616 0.0311
NP_439903.1_6 Reverse -159 -178 -0.39464 0.282
NP_442588.1_6 Forward -225 -206 -2.55715 0.294
NP_442306.1_10 Reverse -197 -216 -20.65 0.219
NP_441286.1_1 Reverse -161 -173 14.4936 0.00418
NP_441286.1_1 Forward -27 -15 13.117 0.00815
NP_441286.1_1 Forward -172 -160 12.1337 0.0104
NP_441286.1_1 Reverse -386 -398 -4.48425 0.161
NP_441286.1_1 Reverse -16 -28 -6.94252 0.288
NP_440670.1_8 Forward -171 -162 18.3876 0.000699
NP_440670.1_8 Reverse -162 -171 18.3876 0.000699
NP_440670.1_8 Reverse -17 -26 6.78456 0.099
NP_440670.1_8 Forward -26 -17 5.3096 0.167
NP_440670.1_8 Reverse -192 -201 3.34298 0.275
NP_440886.1_7 Forward -172 -162 17.7774 0.0011
NP_440886.1_7 Reverse -161 -171 7.94438 0.0805
NP_440886.1_7 Forward -244 -234 4.89613 0.213
NP_440886.1_7 Forward -202 -192 3.71617 0.267
NP_440083.1_9 Reverse -29 -48 10.8738 0.281
NP_439995.1_5 Reverse -152 -171 11.1109 0.197
NP_442072.1_9 Reverse -161 -179 -5.88071 0.0706
NP_442213.1_6 Forward -390 -371 4.916 0.285
NP_441753.1_10 Forward -372 -353 1.0811 0.277
NP_440907.2_8 Forward -170 -160 10.8943 0.0969
NP_440907.2_8 Forward -25 -15 9.81266 0.103
NP_440907.2_8 Reverse -163 -173 7.84605 0.117
NP_440907.2_8 Forward -381 -371 7.0594 0.132
NP_440907.2_8 Forward -200 -190 5.68278 0.191
NP_441021.1_1 Forward -206 -187 -4.81876 0.172
NP_441021.1_1 Forward -25 -6 -12.6852 0.293
NP_442459.1_7 Forward -64 -45 0.0977854 0.272
NP_441463.1_3 Forward -36 -17 12.3892 0.0403
NP_441463.1_3 Reverse -152 -171 5.89931 0.0683
NP_441463.1_6 Forward -173 -159 8.63851 0.25
NP_441626.1_2 Forward -170 -163 15.7721 0.0124
NP_441626.1_2 Reverse -163 -170 15.7721 0.0124
NP_441626.1_2 Reverse -18 -25 6.0373 0.212
NP_441626.1_2 Forward -25 -18 5.93897 0.231
NP_442365.1_5 Forward -170 -151 7.66927 0.25
NP_442365.1_7 Forward -175 -156 9.93088 0.0723
NP_442362.1_7 Reverse -224 -242 14.8671 0.22
NP_442615.1_1 Reverse -153 -171 7.09898 0.0327
NP_441962.1_4 Reverse -157 -176 5.60432 0.0932
NP_441962.1_4 Reverse -229 -248 -5.99873 0.175
NP_441962.1_4 Reverse -12 -31 -6.39206 0.176
NP_441962.1_4 Forward -176 -157 -8.55534 0.203
NP_441962.1_4 Forward -242 -223 -13.5702 0.275
NP_440387.1_1 Forward -171 -155 15.8898 0.005
NP_440387.1_1 Reverse -162 -178 14.5132 0.00649
NP_440387.1_1 Forward -399 -383 0.746852 0.12
NP_440387.1_1 Forward -26 -10 -3.28472 0.157
NP_440387.1_1 Reverse -192 -208 -5.25134 0.222
NP_440387.1_1 Forward -396 -380 -6.33298 0.279
NP_441431.1_2 Forward -174 -160 5.70218 0.291
NP_441488.1_7 Reverse -367 -386 5.50599 0.157
NP_441488.1_7 Reverse -156 -175 1.27776 0.296
NP_440467.1_3 Forward -76 -57 12.4282 0.24
NP_440114.1_5 Forward -164 -145 9.63589 0.213
NP_440114.1_10 Reverse -162 -176 7.27608 0.239
NP_442323.1_7 Forward -374 -355 4.32522 0.217
NP_441510.2_7 Forward -177 -163 13.9619 0.28
NP_441552.1_3 Reverse -155 -174 12.1917 0.292
NP_440293.1_3 Reverse -358 -377 -6.29373 0.288
NP_440766.1_4 Forward -175 -161 8.55439 0.0871
NP_440766.1_4 Reverse -230 -244 0.982901 0.259
NP_440766.1_5 Forward -326 -314 11.9529 0.25
NP_441237.1_9 Forward -170 -160 14.9263 0.0242
NP_441237.1_9 Forward -381 -371 13.8447 0.062
NP_442930.1_1 Reverse -131 -141 13.4509 0.239
NP_439910.1_2 Forward -179 -162 -3.8944 0.0691
NP_442867.1_8 Forward -235 -216 6.39097 0.262
NP_440457.1_1 Reverse -13 -25 8.00379 0.101
NP_440457.1_1 Reverse -158 -170 7.90546 0.101
NP_440457.1_1 Forward -175 -163 7.02048 0.105
NP_442297.1_4 Forward -175 -156 13.9886 0.214
NP_442509.1_9 Reverse -162 -172 16.2041 0.00739
NP_442509.1_9 Forward -26 -16 13.2542 0.0598
NP_442509.1_9 Forward -201 -191 9.616 0.192
NP_442509.1_9 Forward -171 -161 8.14104 0.192
NP_442509.1_9 Forward -396 -386 7.64939 0.21
NP_440554.1_4 Reverse -163 -173 14.6313 0.02
NP_440554.1_4 Forward -170 -160 6.37155 0.123
NP_440554.1_4 Reverse -355 -365 2.53664 0.261
NP_441885.1_5 Forward -171 -161 20.9245 0.000538
NP_441885.1_5 Reverse -162 -172 11.4848 0.00668
NP_441885.1_5 Reverse -17 -27 2.33998 0.0799
NP_441885.1_5 Forward -396 -386 1.65166 0.106
NP_442341.1_7 Reverse -161 -175 19.7641 0.00702
NP_442341.1_7 Reverse -386 -400 11.2093 0.0567
NP_442341.1_7 Forward -172 -158 9.93102 0.0692
NP_442341.1_7 Forward -383 -369 4.91614 0.175
NP_441173.1_9 Reverse -317 -325 11.7204 0.226
NP_442395.2_4 Forward -172 -153 3.73524 0.197
NP_440750.1_5 Reverse -46 -60 10.4227 0.197
NP_440423.1_6 Reverse -365 -384 -12.1936 0.188
NP_443000.1_7 Reverse -160 -170 10.4031 0.0345
NP_443000.1_7 Forward -173 -163 8.73149 0.0437
NP_443000.1_7 Forward -28 -18 5.19158 0.144
NP_443000.1_7 Reverse -385 -395 4.99491 0.153
NP_440507.2_3 Reverse -153 -172 9.93006 0.213
NP_441842.1_10 Reverse -155 -169 14.7492 0.0531
NP_440275.1_3 Reverse -160 -170 17.6796 0.0102
NP_440275.1_3 Reverse -15 -25 9.81313 0.0507
NP_440275.1_3 Forward -173 -163 8.4365 0.0602
NP_440091.1_1 Reverse -158 -170 10.8554 0.0429
NP_440091.1_1 Forward -175 -163 10.7571 0.0429
NP_440091.1_1 Forward -30 -18 8.20045 0.0676
NP_440091.1_1 Reverse -383 -395 5.15219 0.128
NP_440091.1_1 Reverse -13 -25 0.333971 0.254
NP_443060.1_1 Forward -305 -286 7.76679 0.3
NP_443010.1_10 Forward -174 -157 15.2366 0.0567
NP_442451.1_2 Forward -179 -160 -2.65548 0.187
NP_442451.1_2 Forward -209 -190 -4.72043 0.213
NP_439962.1_4 Forward -236 -217 -5.01543 0.272
NP_442495.1_4 Forward -215 -205 14.4347 0.16
NP_442495.1_5 Forward -212 -193 8.35759 0.291
NP_440149.1_8 Reverse -162 -181 -0.295539 0.146
NP_441105.1_3 Forward -218 -199 2.94938 0.0949
NP_441105.1_3 Reverse -181 -200 -6.49039 0.236
NP_441105.1_3 Reverse -151 -170 -7.4737 0.254
NP_440216.1_1 Forward -171 -157 -1.5737 0.034
NP_440216.1_1 Reverse -162 -176 -1.5737 0.034
NP_440216.1_1 Reverse -373 -387 -4.03198 0.096
NP_440172.1_1 Forward -171 -161 15.0247 0.00945
NP_440172.1_1 Reverse -162 -172 8.73149 0.0586
NP_440172.1_1 Reverse -17 -27 5.5849 0.14
NP_440172.1_1 Reverse -354 -364 4.50326 0.184
NP_440172.1_1 Forward -65 -55 1.94665 0.29
NP_442371.1_1 Forward -143 -133 11.5826 0.295
NP_442015.1_10 Forward -175 -162 10.639 0.0391
NP_442015.1_10 Forward -400 -387 7.78743 0.0782
NP_442015.1_10 Forward -205 -192 2.08423 0.202
NP_442015.1_10 Forward -30 -17 0.314277 0.231
NP_441226.1_7 Forward -170 -163 14.4934 0.0123
NP_441226.1_7 Reverse -163 -170 14.4934 0.0123
NP_442446.1_3 Reverse -198 -217 9.0459 0.294
NP_442446.1_5 Forward -24 -5 5.11266 0.261
NP_441111.1_7 Forward -170 -162 18.7023 0.00294
NP_441111.1_7 Reverse -163 -171 18.7023 0.00294
NP_441111.1_7 Forward -25 -17 8.86921 0.0589
NP_441111.1_7 Forward -395 -387 -0.570565 0.233
NP_441111.1_7 Reverse -388 -396 -0.570565 0.233
NP_442379.1_10 Reverse -155 -172 -0.747806 0.223
NP_441766.1_2 Forward -171 -162 17.5026 0.00297
NP_441766.1_2 Reverse -162 -171 17.5026 0.00297
NP_441766.1_2 Forward -26 -17 6.39124 0.0993
NP_442417.1_5 Reverse -162 -176 13.3726 0.0786
NP_440416.1_9 Forward -208 -189 -12.6852 0.159
NP_440416.1_9 Reverse -155 -174 -16.7168 0.22
NP_440416.1_9 Reverse -203 -222 -18.6834 0.262
NP_440416.1_9 Reverse -353 -372 -21.1417 0.291
NP_443052.1_8 Forward -181 -162 -3.93378 0.109
NP_443052.1_8 Reverse -7 -26 -12.6852 0.259
NP_443052.1_9 Forward -397 -378 -7.17871 0.294
NP_442154.1_1 Forward -222 -204 -19.0571 0.289
NP_442226.1_1 Reverse -296 -315 10.4225 0.281
NP_440261.1_5 Forward -170 -157 -10.5021 0.201
NP_440261.1_5 Forward -25 -12 -10.6005 0.201
NP_440261.1_5 Forward -381 -368 -10.7971 0.21
NP_440988.1_4 Forward -229 -210 6.98095 0.295
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGCGGTGAACGCCACCCCTGGATCGCCCCAACCTAAAGCCATGGGCACTGCTTTTAAATGGGCTGTACTACTAATGGGTAGAAATTCCGTTGCCCCCTGAATAAAGCCCAACACAAAGGCTTGGAACAGATTAATGGATATGCCATTAGATATTACCCCCGTCTCCACTGCCTCGCTGGGAAGGATGGGCTGGGCCACTGCAATCCCCCAAGCTTGATGATAAACAACGGCGATCGCCACACTGAGACTAAAGGCACTGAGAAAATTTAATTGGCGGGGGGACATTAACTGTCGATGATAATCGGGACTCAAAGATCCTAGCCTATAGTGGCAGAGCAATTTCTTGAAACGTTTTTAAACTGTCCCCTAGAATTGTGATCGCCCCACCGTTGCAACTCC

CDS

ATGGCTTTTCCTATCCTCGTCACCGGCCCCAGTCGTTCAGGTAAAAGTGAATGGGCCGAACATCTTGCAGCGCAAAACCATCCATCCGTTATCTACATTGCCACTGGCAAGGAAAATGCCGCGGACGTAGACTGGCAAAATCGCATTCAACAACATCGCGATCGCCGTCCGTCCCATTGGCAAACGTTATGCGTAGACCAGAATTTGACTGACACTCTAGAAACCCTACCGGCGGGAAGTTGTGCCTTAGTGGACTCCCTGGGAGGGTGGGTAGCCAATACCCTAGAGCTATCTCCAGAGCAATGGCAAACTAAACAAAGGGAATTGATCACTTTTGCGACACAGGGGCAAAATACTCCCATAACTATTATCTTTGTGGCCGAAGAAACGGGGTGGGGGGTGATTCCAGTCTATGCCTTAGGACGCATTTTTCGGGACCGTTTGGGCGCCCTCACTCGTCAACTGGGGGGACTTTGTGGTCAAGTTTACCTCGTGACCGGCGGTTATGCAGTGGATTTGCGCCGATGGGGAGAACCCCTACCGCCACCAAGGGATTGA

Protein

MAFPILVTGPSRSGKSEWAEHLAAQNHPSVIYIATGKENAADVDWQNRIQQHRDRRPSHWQTLCVDQNLTDTLETLPAGSCALVDSLGGWVANTLELSPEQWQTKQRELITFATQGQNTPITIIFVAEETGWGVIPVYALGRIFRDRLGALTRQLGGLCGQVYLVTGGYAVDLRRWGEPLPPPRD