Your browser is old and dusty. Try Google Chrome!

Details for slr0214

ORF slr0214
Accession NP_442141.1
Symbol
Category cytosine-specific methyltransferase(5'-CGATCG-3')
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -177 -163 9.34103 0.0754
NP_441061.1_2 Forward -309 -295 -0.983719 0.246
NP_441418.1_6 Forward -219 -200 -22.715 0.184
NP_442151.1_6 Reverse -168 -182 8.84938 0.164
NP_442173.1_1 Reverse -169 -177 5.0343 0.24
NP_442861.1_1 Forward -336 -317 10.9142 0.295
NP_441476.1_5 Forward -234 -215 -6.68705 0.275
NP_440044.1_8 Forward -41 -22 0.58944 0.195
NP_440044.1_8 Forward -225 -206 -1.86883 0.254
NP_441581.1_9 Forward -31 -12 12.3658 0.261
NP_441208.1_9 Reverse -271 -285 5.80112 0.262
NP_442367.1_1 Reverse -111 -130 -7.67036 0.26
NP_441713.1_1 Reverse -192 -211 -12.0953 0.242
NP_441713.1_8 Reverse -39 -57 7.68896 0.294
NP_441624.1_7 Forward -114 -100 10.9143 0.217
NP_441209.1_8 Forward -77 -59 9.32249 0.24
NP_441012.1_4 Reverse -332 -345 8.86907 0.272
NP_440376.1_1 Forward -150 -141 3.44131 0.203
NP_441002.1_5 Reverse -48 -67 16.5191 0.135
NP_442687.1_7 Reverse -209 -219 3.81494 0.286
NP_441846.1_10 Forward -303 -284 -21.4367 0.256
NP_442296.1_9 Forward -183 -164 -5.01543 0.282
NP_440360.1_10 Reverse -285 -299 3.34284 0.239
NP_442658.1_1 Forward -284 -274 9.616 0.147
NP_442198.1_3 Reverse -1 -20 8.55425 0.249
NP_440141.1_8 Forward -301 -282 8.16093 0.232
NP_440141.1_8 Forward -300 -281 6.88262 0.252
NP_442544.1_2 Reverse -350 -364 -0.0987402 0.217
NP_441256.1_1 Reverse -283 -302 -7.4737 0.239
NP_442321.1_4 Forward -181 -162 -6.58872 0.284
NP_440450.1_10 Forward -65 -46 25.3527 0.00866
NP_439905.1_1 Reverse -284 -297 7.59077 0.255
NP_441162.1_3 Reverse -285 -304 12.0942 0.198
NP_441162.1_3 Reverse -291 -310 7.86593 0.275
NP_442376.1_2 Forward -111 -92 -12.7836 0.286
NP_442064.1_4 Forward -349 -330 12.7816 0.147
NP_443055.1_6 Reverse -376 -394 -2.34152 0.294
NP_442566.1_2 Forward -203 -184 2.75272 0.289
NP_440377.1_1 Forward -64 -47 10.5006 0.294
NP_441000.1_6 Reverse -209 -223 4.22782 0.0964
NP_441041.1_4 Reverse -169 -188 4.32602 0.0588
NP_441725.1_4 Reverse -137 -151 5.80051 0.278
NP_440202.1_8 Forward -129 -110 9.80632 0.297
NP_441079.1_7 Forward -65 -46 8.35677 0.107
NP_443030.1_4 Forward -178 -159 -6.58872 0.288
NP_441644.1_6 Reverse -283 -293 3.8145 0.261
NP_442215.1_2 Reverse -160 -176 -3.57971 0.218
NP_442075.1_1 Reverse -230 -249 11.9958 0.176
NP_442476.1_6 Forward -206 -192 6.58777 0.123
NP_442476.1_6 Reverse -199 -213 -0.295402 0.294
NP_439989.1_6 Forward -228 -209 6.39097 0.296
NP_443009.1_5 Forward -283 -272 3.5981 0.286
NP_441015.1_10 Forward -297 -278 -9.73531 0.282
NP_441393.1_2 Forward -296 -277 13.0637 0.272
NP_441393.1_5 Reverse -2 -21 15.4374 0.214
NP_441637.1_9 Reverse -58 -76 -3.42244 0.296
NP_442719.1_2 Reverse -275 -293 -10.1096 0.269
NP_441612.1_2 Forward -19 -9 13.3899 0.21
NP_442227.1_2 Reverse -285 -304 8.75091 0.171
NP_443058.1_1 Reverse -78 -97 18.9765 0.0766
NP_442808.1_1 Forward -122 -112 1.5529 0.282
NP_441114.1_3 Forward -272 -263 6.5879 0.262
NP_440558.1_2 Forward -187 -168 6.88262 0.127
NP_440558.1_2 Reverse -159 -178 -5.40875 0.258
NP_440558.1_2 Reverse -171 -190 -6.88371 0.283
NP_442576.1_2 Reverse -320 -339 6.39097 0.289
NP_440111.2_2 Reverse -290 -309 8.84924 0.167
NP_441557.1_4 Forward -80 -66 11.406 0.291
NP_441557.1_8 Forward -309 -299 12.6642 0.236
NP_441445.1_1 Forward -228 -209 0.392778 0.275
NP_442192.1_7 Reverse -208 -226 14.9655 0.299
NP_442594.1_8 Forward -301 -282 10.8159 0.175
NP_442594.1_8 Forward -294 -275 2.45773 0.295
NP_441633.1_3 Forward -272 -259 2.87088 0.0834
NP_442590.1_10 Forward -316 -297 2.94938 0.299
NP_441799.1_1 Reverse -171 -185 5.40719 0.21
NP_440977.1_5 Reverse -334 -347 16.7349 0.18
NP_442802.1_2 Forward -175 -156 16.3215 0.203
NP_441559.1_8 Reverse -136 -150 -5.01529 0.245
NP_441559.1_8 Forward -188 -174 -5.80194 0.27
NP_441559.1_8 Forward -212 -198 -6.98191 0.281
NP_441270.1_5 Reverse -228 -247 15.7268 0.191
NP_440915.1_6 Forward -304 -290 1.17956 0.145
NP_440915.1_6 Forward -223 -209 -2.36035 0.268
NP_440748.1_5 Forward -181 -162 -0.787193 0.26
NP_441494.1_6 Forward -189 -176 12.0157 0.225
NP_442386.1_9 Reverse -197 -206 8.45576 0.197
NP_442386.1_9 Reverse -383 -392 6.19416 0.23
NP_440570.1_5 Forward -118 -99 1.96607 0.234
NP_442484.1_2 Forward -119 -100 -0.983855 0.281
NP_442240.1_2 Forward -105 -86 -18.7818 0.295
NP_440523.1_4 Reverse -275 -294 20.4523 0.0468
NP_440027.1_8 Reverse -287 -306 7.17681 0.269
NP_440451.1_10 Reverse -87 -106 13.8633 0.188
NP_439937.1_9 Reverse -272 -289 -16.7764 0.287
NP_440408.1_7 Reverse -99 -118 7.7676 0.284
NP_440171.1_3 Forward -296 -277 4.42435 0.284
NP_440316.1_10 Forward -293 -283 7.15819 0.251
NP_442556.1_10 Reverse -4 -23 9.9767 0.273
NP_440297.1_9 Forward -113 -103 -0.0199663 0.282
NP_440350.1_5 Reverse -2 -21 0.0977854 0.167
NP_440350.1_7 Forward -230 -211 16.1257 0.21
NP_442280.1_10 Reverse -71 -89 5.55182 0.283
NP_440999.1_2 Reverse -209 -228 16.8141 0.128
NP_442147.1_7 Forward -294 -275 19.469 0.0993
NP_440491.1_1 Forward -229 -210 7.89159 0.256
NP_442033.1_10 Forward -108 -89 -12.4886 0.271
NP_441918.1_7 Forward -340 -321 0.392778 0.292
NP_442337.1_8 Reverse -3 -22 -0.0988766 0.263
NP_443062.1_1 Forward -189 -171 5.13317 0.238
NP_443062.1_1 Reverse -210 -228 3.76806 0.285
NP_442204.1_1 Forward -160 -149 2.12362 0.266
NP_442204.1_1 Reverse -93 -104 1.04198 0.281
NP_440544.1_5 Reverse -12 -19 13.8024 0.28
NP_442872.1_1 Reverse -368 -387 -8.55534 0.241
NP_440516.1_8 Forward -219 -210 7.07956 0.0867
NP_441785.1_1 Reverse -68 -82 14.0957 0.17
NP_441867.1_2 Forward -301 -282 -12.7836 0.27
NP_440673.1_3 Reverse -38 -45 5.54565 0.288
NP_440673.1_7 Forward -224 -205 1.27776 0.253
NP_441052.1_2 Forward -247 -237 2.14332 0.216
NP_442219.1_9 Forward -206 -197 3.04799 0.206
NP_441884.1_9 Forward -222 -203 -22.42 0.278
NP_442864.1_2 Forward -246 -227 10.7175 0.26
NP_441719.1_6 Reverse -280 -299 5.89851 0.288
NP_441733.1_10 Reverse -195 -208 5.91914 0.203
NP_441004.1_1 Reverse -106 -125 -9.63698 0.21
NP_441004.1_1 Forward -298 -279 -16.6185 0.286
NP_441004.1_2 Forward -303 -284 -2.26216 0.264
NP_441004.1_4 Forward -295 -285 9.12481 0.259
NP_441004.1_5 Forward -296 -282 11.111 0.241
NP_440296.1_10 Forward -303 -284 -8.35868 0.252
NP_442206.1_1 Reverse -283 -302 -11.8003 0.221
NP_442206.1_10 Forward -207 -192 1.35653 0.233
NP_440328.1_4 Reverse -211 -230 1.86774 0.213
NP_441851.1_5 Forward -293 -274 9.83255 0.23
NP_441851.1_10 Forward -97 -87 7.64985 0.135
NP_442208.1_5 Forward -121 -102 -7.27704 0.27
NP_442622.1_1 Forward -310 -291 -5.99873 0.257
NP_442856.1_7 Forward -354 -335 -2.55715 0.236
NP_441683.1_7 Forward -293 -274 -6.49039 0.27
NP_441982.1_6 Reverse -42 -51 11.9124 0.288
NP_442709.1_3 Forward -157 -138 3.44104 0.284
NP_441661.1_3 Forward -375 -358 1.8088 0.226
NP_440389.1_5 Forward -191 -172 14.8254 0.213
NP_439950.1_1 Forward -353 -344 13.1761 0.277
NP_440954.1_4 Forward -160 -141 -3.73712 0.287
NP_442006.1_2 Reverse -208 -225 -14.5141 0.203
NP_441003.1_9 Forward -226 -207 8.94757 0.224
NP_441003.1_9 Reverse -71 -90 3.73603 0.291
NP_440539.1_9 Reverse -321 -340 -4.13045 0.286
NP_442443.1_1 Forward -300 -281 -3.93378 0.267
NP_440526.1_3 Forward -281 -270 4.97473 0.261
NP_441432.1_8 Reverse -174 -183 5.3096 0.17
NP_443024.1_2 Reverse -282 -295 18.7999 0.156
NP_443024.1_2 Reverse -283 -296 15.3583 0.228
NP_442157.1_9 Forward -310 -291 16.9124 0.212
NP_439935.1_1 Forward -195 -176 5.99764 0.281
NP_442727.1_10 Forward -336 -317 2.45773 0.203
NP_440713.1_4 Reverse -291 -310 8.55425 0.17
NP_440565.1_3 Forward -312 -293 14.3226 0.271
NP_441022.1_1 Reverse -321 -330 11.6421 0.274
NP_442346.1_5 Reverse -335 -345 5.48657 0.243
NP_440352.1_5 Reverse -240 -259 10.9037 0.27
NP_440545.1_5 Forward -216 -199 4.95539 0.244
NP_442603.1_7 Forward -219 -205 7.66879 0.198
NP_442603.1_7 Forward -310 -296 5.50552 0.29
NP_442828.1_7 Forward -296 -277 3.93269 0.207
NP_441895.1_2 Forward -310 -291 -26.5499 0.24
NP_442162.1_9 Forward -218 -211 5.93897 0.214
NP_440671.1_4 Reverse -162 -176 12.586 0.105
NP_441609.1_1 Forward -339 -320 8.16093 0.152
NP_440590.1_4 Reverse -211 -224 -5.88057 0.293
NP_441239.1_9 Forward -116 -104 8.6921 0.125
NP_441239.1_9 Reverse -208 -220 3.87389 0.272
NP_442643.1_1 Forward -229 -210 -11.3086 0.231
NP_442216.1_4 Forward -62 -54 8.1805 0.255
NP_441526.1_6 Reverse -256 -275 1.76941 0.297
NP_440949.1_7 Forward -281 -262 11.0117 0.233
NP_442141.1_2 Forward -80 -61 21.8289 0.0636
NP_442141.1_3 Forward -270 -251 18.7807 0.243
NP_442141.1_6 Forward -20 -1 23.5328 0.0354
NP_442141.1_10 Forward -355 -336 20.354 0.144
NP_442479.1_9 Forward -219 -200 -11.8003 0.275
NP_442402.1_4 Reverse -60 -79 -9.9327 0.295
NP_441848.1_4 Reverse -312 -328 8.02812 0.288
NP_441843.2_9 Forward -224 -206 13.799 0.205
NP_441701.1_3 Forward -302 -285 7.11867 0.266
NP_441102.1_2 Reverse -47 -66 6.4893 0.298
NP_441252.1_6 Reverse -52 -59 11.6422 0.288
NP_442532.1_4 Reverse -47 -65 17.1759 0.115
NP_440914.1_1 Forward -83 -73 6.17532 0.293
NP_442533.1_1 Forward -301 -282 -10.9153 0.235
NP_442541.1_10 Forward -184 -170 2.94893 0.254
NP_442322.1_4 Reverse -283 -300 -2.42012 0.231
NP_441697.1_5 Reverse -47 -66 -6.7326 0.234
NP_441028.1_6 Reverse -278 -288 17.1874 0.132
NP_441059.1_10 Forward -27 -14 12.999 0.226
NP_443045.1_9 Forward -121 -103 7.98318 0.262
NP_440670.1_8 Forward -339 -330 3.14632 0.296
NP_440886.1_7 Reverse -282 -292 5.78111 0.163
NP_440828.1_4 Forward -131 -112 8.55343 0.104
NP_442614.1_2 Reverse -301 -315 6.78443 0.285
NP_441753.1_10 Reverse -201 -220 2.94938 0.225
NP_440841.1_4 Forward -85 -66 -11.0136 0.292
NP_441962.1_4 Forward -287 -268 -12.0953 0.252
NP_441963.1_2 Forward -289 -270 -2.45882 0.295
NP_441431.1_2 Forward -187 -173 10.422 0.159
NP_441431.1_2 Forward -222 -208 6.0955 0.28
NP_442224.1_1 Forward -312 -293 -0.885524 0.233
NP_440114.1_10 Reverse -210 -224 6.19444 0.282
NP_440287.1_5 Reverse -286 -305 6.48849 0.292
NP_440287.1_6 Forward -228 -209 0.392778 0.293
NP_440293.1_3 Reverse -104 -123 -6.1954 0.287
NP_440766.1_4 Reverse -206 -220 0.88457 0.263
NP_439988.1_3 Forward -222 -208 6.48943 0.278
NP_439988.1_3 Reverse -101 -115 6.09611 0.278
NP_440457.1_1 Reverse -107 -119 -1.14099 0.294
NP_440473.1_9 Forward -303 -284 -9.047 0.26
NP_442509.1_9 Forward -282 -272 10.1076 0.192
NP_442509.1_9 Reverse -141 -151 6.56775 0.263
NP_441489.1_3 Reverse -39 -53 8.31942 0.244
NP_440628.1_1 Forward -13 -3 13.8734 0.279
NP_442341.1_7 Reverse -329 -343 1.08123 0.299
NP_440275.1_3 Forward -228 -218 5.97822 0.129
NP_442638.1_3 Reverse -42 -61 15.899 0.235
NP_439962.1_4 Reverse -202 -221 -4.91709 0.272
NP_442373.1_2 Forward -301 -282 -9.24366 0.258
NP_440172.1_1 Reverse -175 -185 4.10993 0.205
NP_441226.1_7 Forward -309 -302 6.52862 0.253
NP_443052.1_8 Reverse -263 -282 -11.1119 0.223
NP_443052.1_8 Reverse -207 -226 -11.8986 0.241
NP_440072.1_5 Forward -301 -283 -1.84914 0.264
NP_442564.1_10 Reverse -200 -214 8.45605 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATTTTGCGGGATGCGGACTTCATTGTGCGGGACGAAATTTCCAAACGGGGTATTTACCATGACTATTGGCAAGCTTTTGCTGTACTGTTACCCATCCGCAGCGTGGGGGTAATGGGGGACAAACGCACCTATGCTCACCCCGTTGTTCTACGCTTTATCACCAGTGAAGACGGTATGACCGCCGATTGGGCCCGGGTTCCCTACGATATTCTCGAAGCCATTTCCAACCGCATTGTCAACGAAGTTAAGGGGGTTAACCGGGTAGTTTATGACATCACGTCCAAGCCCCCTGGCACTATCGAGTGGGAATGATCAGAACAATGGGGAAGACATAAATAAATTCCCCAATTTTTAAGCAACGAAGTCAAATTTAAGCGCTAGAAGAAAACCAGAAAAACC

CDS

ATGGCCAGACCCATTGCCATCGACTTGTTTGCGGGCTGTGGTGGCATGTCCTTGGGTTTAGAAGCCGCTGGATTTGATATTGCCGCCGCGGTGGAATTTGATGCAGTGCATTGTTTGGTCCATCATCATAATTTTCCCTATGGTGTTACTATCTGTCGGGATATTGCTCTGGTAAGTGCGGGCGAAATTCTAAGAAAGTTAAATAATAAAGGTTATTCAAGCGATATAGACCTGATTGCTGGAGGCCCTCCCTGTCAAGGCTTTTCCCTCATGGGTAAAAGGCAGTTGGATGATCCTCGTAACTCCTTGGTGTTTGAATATGTGCGAATGATTCGGGATCTCAAACCCAAATATTTTTTATTTGAAAATGTTCCCGGTATGCGATCGGGGCAACATAAAAAATTTTTAGAGGAATTAGTTAGGGAATTTGAAACCATTGGTTACCACATCGAAAAACCAATTTTAGTGCTAGATGCGTCCCTCTATGGTGCTCCCCAAAAACGAAAAAGGTTGATTATTCTCGGCTCCAGAAAAGATGTCAAGCCTGTCACCTATCCCCTTCCACTCTATTTTGACGTTGCTGAATTAAAACAAAGTAATTGTTCTGAAAAATCAGTTTCTAACATAGCTTATAAACCGCCATTTACCTGTGGAGAAGCCATTGATGATCTAGTTGACCATACACCCTATGCAGTAGGAGAAGACCAAGGTATTCCATCAGAATTATTGGATTATTCAGCCCTGAGAAAAAGTTATGCCATCCATGCAAATGGAGCATTTTCCCTCTGCCATAAGCGCCAAGTTAATAATTTAGTTTATGGCCATATTGGTTCTCAACATACTGAAAAATCAATGAAAAGATTTGCGGATACTGTCCCTGGAACGGTGGAAAGAACCAGTCGCTTTCTGCGGCTATCAAAAACTGGTTTATGTAATACCCTGAGGGCCGGCACTGCTAGTGATAAGGGTGCTTATACCGCCCCTAGGCCAATACACTACGCCTTACCTAGATGTATAACTGTGAGAGAAGCGGCCAGACTCCATACCTATCCGGATTGGTTTCAGTTCCACAACACCATCTGGCACGGCTTTCGGGAAATTGGTAACTCCGTCGTACCTTTGCTGGCTAAGGTTTTGGGAGAACAGGTTATGGCCGCATTGAATTGTTCTGTTGAGGATTTGCCGGTTTATGAACTGGAGCCCCAAGACCGAACATTACTACATTACAATTTGCCCCAGGCTAGTCGATATTTATGTGCCAAATCCCATTCCTAA

Protein

MARPIAIDLFAGCGGMSLGLEAAGFDIAAAVEFDAVHCLVHHHNFPYGVTICRDIALVSAGEILRKLNNKGYSSDIDLIAGGPPCQGFSLMGKRQLDDPRNSLVFEYVRMIRDLKPKYFLFENVPGMRSGQHKKFLEELVREFETIGYHIEKPILVLDASLYGAPQKRKRLIILGSRKDVKPVTYPLPLYFDVAELKQSNCSEKSVSNIAYKPPFTCGEAIDDLVDHTPYAVGEDQGIPSELLDYSALRKSYAIHANGAFSLCHKRQVNNLVYGHIGSQHTEKSMKRFADTVPGTVERTSRFLRLSKTGLCNTLRAGTASDKGAYTAPRPIHYALPRCITVREAARLHTYPDWFQFHNTIWHGFREIGNSVVPLLAKVLGEQVMAALNCSVEDLPVYELEPQDRTLLHYNLPQASRYLCAKSHS