Your browser is old and dusty. Try Google Chrome!

Details for slr0199

ORF slr0199
Accession NP_442348.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_4 Forward -366 -352 16.6169 0.295
NP_440795.1_7 Forward -193 -186 7.31561 0.259
NP_441418.1_6 Forward -165 -146 -29.4998 0.228
NP_441453.1_7 Reverse -70 -77 12.9205 0.23
NP_441623.1_1 Forward -77 -59 2.96908 0.202
NP_440561.1_8 Reverse -235 -254 5.70265 0.289
NP_441818.1_9 Forward -165 -146 -1.67217 0.2
NP_441818.1_9 Reverse -329 -348 -10.0303 0.292
NP_440259.1_4 Forward -62 -48 16.9268 0.117
NP_440259.1_4 Forward -63 -49 10.9496 0.262
NP_441098.1_3 Reverse -379 -398 -3.72644 0.28
NP_442752.1_4 Forward -358 -351 5.54565 0.194
NP_443027.1_4 Forward -360 -350 9.51814 0.161
NP_440878.1_9 Reverse -358 -377 5.80098 0.174
NP_440304.1_10 Reverse -212 -230 18.702 0.138
NP_442762.1_10 Reverse -188 -207 -12.3902 0.284
NP_441581.1_1 Reverse -188 -205 16.0668 0.157
NP_441352.1_2 Forward -160 -141 0.392778 0.268
NP_441208.1_9 Reverse -217 -231 13.1759 0.115
NP_441925.1_4 Reverse -141 -160 -17.4058 0.294
NP_440407.1_6 Forward -163 -149 14.8476 0.212
NP_441194.1_1 Reverse -378 -397 12.4613 0.238
NP_442145.1_4 Forward -399 -380 8.73709 0.177
NP_441265.1_1 Reverse -344 -363 -9.53865 0.167
NP_441667.1_1 Reverse -265 -280 15.0686 0.284
NP_440470.1_5 Forward -73 -54 5.58586 0.294
NP_441014.1_10 Reverse -348 -367 2.16195 0.216
NP_441014.1_10 Forward -68 -49 0.195343 0.245
NP_443018.1_3 Reverse -157 -164 7.11894 0.16
NP_442687.1_7 Forward -230 -220 8.73149 0.101
NP_442687.1_7 Forward -15 -5 4.0116 0.271
NP_441077.1_6 Forward -229 -213 7.33299 0.233
NP_442946.1_7 Forward -251 -236 12.0331 0.284
NP_441846.1_10 Forward -159 -140 -19.9617 0.256
NP_441950.1_7 Forward -156 -137 -7.96535 0.283
NP_442321.1_1 Forward -167 -148 -6.09707 0.231
NP_440203.1_5 Reverse -352 -362 10.4026 0.225
NP_442690.1_1 Forward -293 -274 -12.2919 0.241
NP_441099.1_5 Reverse -92 -111 -12.0953 0.294
NP_442598.1_2 Forward -58 -49 16.5193 0.252
NP_442438.1_10 Reverse -344 -358 0.294584 0.232
NP_441000.1_5 Reverse -370 -389 3.34192 0.291
NP_441125.1_10 Forward -86 -72 20.0591 0.156
NP_441916.1_10 Forward -237 -218 1.47442 0.264
NP_440206.1_9 Forward -20 -1 8.84924 0.272
NP_442396.1_5 Reverse -223 -236 6.1158 0.254
NP_442256.1_5 Forward -349 -335 19.2718 0.153
NP_440723.1_8 Forward -381 -367 12.1926 0.195
NP_442029.1_1 Forward -161 -142 -18.3884 0.272
NP_442247.1_6 Forward -88 -69 14.6508 0.14
NP_440780.1_1 Reverse -260 -279 11.3154 0.243
NP_442142.1_4 Forward -347 -334 6.90188 0.153
NP_441371.1_3 Forward -49 -31 5.62401 0.287
NP_440620.1_4 Reverse -264 -278 13.7625 0.281
NP_440158.1_8 Reverse -189 -208 10.8159 0.249
NP_441198.1_5 Forward -186 -173 11.4251 0.279
NP_441764.1_6 Forward -359 -348 17.3649 0.253
NP_441764.1_8 Reverse -260 -270 12.9377 0.284
NP_441911.1_10 Reverse -47 -66 23.2128 0.00804
NP_442808.1_1 Reverse -149 -159 1.65123 0.282
NP_442342.1_7 Forward -52 -33 15.109 0.275
NP_442789.1_5 Forward -176 -157 4.03102 0.215
NP_441445.1_1 Reverse -326 -345 -0.39387 0.291
NP_441870.1_7 Forward -395 -376 13.9625 0.291
NP_440157.1_5 Reverse -50 -69 14.8486 0.28
NP_442347.1_1 Reverse -280 -297 16.2711 0.283
NP_442347.1_2 Reverse -350 -359 8.65285 0.0792
NP_442347.1_5 Reverse -378 -397 23.7947 0.0109
NP_442347.1_10 Reverse -356 -370 16.8135 0.182
NP_441633.1_3 Forward -211 -198 -4.50394 0.199
NP_441728.2_4 Reverse -203 -222 13.0342 0.259
NP_440299.1_1 Forward -192 -179 7.39353 0.113
NP_441559.1_8 Forward -321 -307 -4.62196 0.231
NP_440915.1_6 Forward -241 -227 -2.95034 0.287
NP_440570.1_5 Reverse -316 -335 -2.75381 0.28
NP_442240.1_2 Reverse -336 -355 -13.6686 0.171
NP_440586.1_8 Forward -251 -244 7.02027 0.279
NP_442251.1_6 Forward -343 -336 8.20058 0.23
NP_440027.1_3 Forward -347 -329 5.91824 0.232
NP_439937.1_8 Forward -360 -341 -4.72043 0.286
NP_442511.1_5 Reverse -36 -55 16.9969 0.195
NP_441803.1_2 Forward -363 -344 -0.000545616 0.263
NP_442114.1_8 Reverse -253 -267 13.1753 0.213
NP_441018.1_7 Forward -65 -46 10.9142 0.194
NP_441018.1_7 Forward -77 -58 6.4893 0.286
NP_442262.1_10 Reverse -157 -164 8.20058 0.25
NP_442556.1_10 Forward -268 -249 9.40375 0.277
NP_440350.1_5 Forward -69 -50 10.2259 0.134
NP_442553.1_1 Reverse -108 -127 5.40686 0.232
NP_441771.1_4 Reverse -250 -269 2.16274 0.213
NP_441917.1_2 Forward -168 -150 12.5072 0.168
NP_441834.1_1 Forward -83 -64 12.2908 0.294
NP_441319.1_8 Reverse -8 -26 4.44404 0.297
NP_441469.1_8 Reverse -307 -316 7.96454 0.227
NP_443064.1_6 Reverse -361 -371 10.2399 0.166
NP_443062.1_1 Reverse -349 -367 7.96088 0.163
NP_442781.1_2 Reverse -111 -130 8.25844 0.277
NP_442204.1_1 Forward -200 -189 2.71361 0.266
NP_440818.1_5 Forward -393 -374 19.3377 0.27
NP_441353.1_1 Reverse -35 -54 17.434 0.166
NP_441443.1_7 Forward -168 -149 -0.885524 0.248
NP_441267.1_3 Forward -64 -46 9.85146 0.283
NP_440718.1_2 Reverse -51 -70 9.93088 0.3
NP_441052.1_2 Reverse -156 -166 1.16001 0.25
NP_442086.1_6 Reverse -179 -198 7.47261 0.276
NP_441336.1_1 Reverse -15 -34 18.289 0.24
NP_442208.1_5 Forward -111 -92 -0.000545616 0.248
NP_442856.1_8 Reverse -236 -254 12.8022 0.269
NP_441396.1_5 Reverse -244 -253 8.45619 0.224
NP_441409.1_8 Reverse -49 -68 7.98055 0.277
NP_442843.1_1 Forward -164 -145 -12.0953 0.298
NP_440431.1_4 Reverse -50 -69 -9.1199 0.275
NP_442006.1_2 Forward -165 -148 -8.0243 0.192
NP_442729.1_7 Reverse -342 -360 11.8189 0.232
NP_442729.1_7 Forward -73 -55 5.23069 0.292
NP_441663.1_8 Forward -376 -357 5.01433 0.155
NP_442348.1_1 Forward -363 -345 18.8004 0.12
NP_442348.1_2 Forward -73 -64 14.5527 0.147
NP_442348.1_3 Forward -243 -229 19.5675 0.254
NP_441091.1_5 Reverse -146 -165 12.9791 0.116
NP_441432.1_9 Forward -67 -54 8.79228 0.287
NP_441732.1_2 Forward -362 -346 -16.7561 0.195
NP_440629.1_4 Forward -200 -181 10.1275 0.238
NP_442274.1_8 Reverse -149 -167 12.7108 0.297
NP_440199.1_4 Reverse -203 -221 18.1455 0.193
NP_442079.1_6 Reverse -39 -58 12.8808 0.283
NP_442749.1_5 Reverse -299 -316 8.80213 0.225
NP_441968.1_1 Reverse -60 -68 15.162 0.257
NP_442008.1_2 Forward -373 -354 10.0292 0.156
NP_441653.1_2 Forward -95 -76 3.43298 0.264
NP_441943.1_5 Reverse -203 -222 16.6574 0.189
NP_440847.1_3 Reverse -148 -162 12.782 0.234
NP_440847.1_3 Reverse -149 -163 11.602 0.261
NP_441329.1_6 Reverse -48 -67 11.3154 0.106
NP_441329.1_6 Reverse -49 -68 -3.10391 0.296
NP_441973.1_1 Reverse -352 -367 0.569883 0.235
NP_442028.1_1 Forward -269 -256 7.70113 0.289
NP_442568.1_8 Reverse -52 -66 12.291 0.257
NP_441892.1_1 Reverse -147 -164 4.95539 0.105
NP_443035.1_10 Forward -163 -146 7.41366 0.273
NP_442052.1_8 Forward -379 -369 13.2547 0.253
NP_440462.1_6 Forward -360 -350 2.14332 0.294
NP_440401.1_9 Forward -349 -342 14.5917 0.287
NP_440341.1_1 Forward -160 -141 20.5506 0.0714
NP_441811.1_8 Reverse -343 -357 6.29277 0.28
NP_442679.1_1 Reverse -45 -64 6.98095 0.147
NP_442829.1_2 Reverse -52 -68 8.62426 0.287
NP_440008.1_9 Reverse -69 -88 11.8975 0.187
NP_442837.1_3 Reverse -350 -357 6.52896 0.2
NP_442532.1_2 Reverse -263 -282 0.524783 0.267
NP_440263.1_3 Forward -376 -357 0.786102 0.298
NP_441028.1_6 Reverse -350 -360 3.42118 0.296
NP_441527.1_4 Reverse -52 -71 10.4559 0.0593
NP_441527.1_4 Reverse -51 -70 -1.86252 0.15
NP_441527.1_4 Reverse -50 -69 -4.4408 0.186
NP_441527.1_4 Reverse -49 -68 -12.3666 0.285
NP_440903.1_1 Forward -126 -116 17.7779 0.16
NP_442588.1_6 Forward -81 -62 5.211 0.175
NP_442674.1_2 Forward -285 -266 14.4541 0.189
NP_440404.1_10 Reverse -203 -216 18.6472 0.233
NP_441808.1_8 Forward -111 -92 6.39097 0.289
NP_441021.1_1 Reverse -180 -199 -12.0953 0.279
NP_441463.1_2 Forward -279 -261 9.78942 0.138
NP_442893.1_4 Forward -293 -274 -2.8529 0.291
NP_442352.1_8 Reverse -153 -167 15.1419 0.273
NP_440814.1_8 Forward -99 -80 -1.47551 0.299
NP_442805.1_5 Reverse -137 -156 -6.29447 0.284
NP_441720.1_2 Reverse -65 -84 7.76679 0.213
NP_440293.1_10 Forward -380 -361 0.982764 0.219
NP_440293.1_10 Forward -160 -141 -2.75381 0.274
NP_440422.1_10 Forward -283 -264 11.3724 0.178
NP_440422.1_10 Forward -70 -51 4.11145 0.298
NP_442680.1_5 Reverse -46 -65 14.335 0.0823
NP_442680.1_5 Reverse -248 -267 14.2373 0.0823
NP_442680.1_5 Reverse -45 -64 -0.123152 0.277
NP_441984.1_3 Reverse -58 -76 7.09898 0.256
NP_442582.1_3 Reverse -264 -278 17.2002 0.127
NP_442582.1_8 Forward -64 -46 5.52568 0.28
NP_442439.1_8 Reverse -40 -59 8.65258 0.253
NP_442703.1_8 Forward -267 -249 13.588 0.253
NP_442513.1_3 Reverse -117 -136 15.9291 0.198
NP_442932.1_9 Forward -99 -80 6.68596 0.249
NP_441397.1_8 Reverse -44 -57 13.2397 0.245
NP_442495.1_4 Reverse -68 -78 13.943 0.183
NP_440149.1_8 Reverse -179 -198 -6.68705 0.258
NP_441875.1_7 Reverse -74 -84 15.6147 0.227
NP_440216.1_1 Reverse -361 -375 -12.2918 0.256
NP_440172.1_1 Forward -188 -178 5.19158 0.149
NP_442015.1_10 Forward -374 -361 2.47756 0.191
NP_440416.1_9 Reverse -354 -373 8.35759 0.0324
NP_443052.1_9 Reverse -367 -386 -6.88371 0.289
NP_442154.1_1 Forward -158 -140 -16.6971 0.244
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAACTTCACCTTTTGTAACATGGAGCAGCGGCGGAACGTCAAGGGGATCAAAACCCCAAGATCACCGACTACTACAGAGTTTCAGGCATTTCACTGAATCCTATGTCATGAATCCTTGATTTATTTTGTGAAGTTTTATGTTTTTTGCTCCCATCAATTCCGGAGTGAAGCGGCAAAAGTCAAGTTTTCTTGATAATCAACCCAGGCGCTGTGACAATCTCTTAACTGTCATAGTGTCCATGGGGTAGGTGGGTGAGGAAGTTATTATCTAGAGGTGTGTGAGGAGTAAGTTGAAGCCCCCGGAGTCGAAACAAGGAAAGACGCCCAGGGGCTTTTTCTTGCCTTTTTTTTGCCCTGAAAGATTTTTCAAGCTGGTCTATGCTCCCCGTAAAAGTTCGGG

CDS

ATGGGCAGCCACTGTCCTTTGGTTTCCCCGTCGGTAGGGATGATTTCAGCGGGCCGCCAAGATTATCAAAAGTTTTTTATGTGTCGTCTTTTAGGGTATCTGGGTCAACCACTGCGACCAGAGCAACTAATTTATCGCCCGGAACATTCCCTGATTGTCCAGAGCTATCAACCCCAGGAAATGACAGCGGGGCTTTTGAATGCTGACGGTTTTGGCTTGGGTTGGTTTGACCAGGAAAGTTTGCCCAATCCCTATCTCTACAAAAATGTCCTGCCCATTTGGAGTGATATTAATCTGCCCCACTTGAGTCGGTATATCCAGTCTAGTTGTTTTGTCAGTTATGTCCGTAGCGCCACACCGCCGTTGGCAGTGGATTTGACTAATTGTCAGCCCTTTACTGAGGAAGGACTTTTATTTGTCCACAATGGCTTTATTAATAATTTTCGCACCACTCTCTACCGGCCTCTACGCAATTTATTGAGCGATGCCAGTTATCAGTTTATCCATGGCACCACCGACTCGGAACATATTTTTGCCCTAATTTTGGATAATCTCCGGCGGTTAAGGCAAACTTCTCCTGGTGATAGTGATTGGGCAAAGACGAGCTTAGGAAAAGCGTTGGAGGCAAGTTTACTGACGTTGGTGGAGTTGGCTCGACAACATGACACGTTTTTTTCCGCCAATATTCTGCTGGCCGATGGTCAGCGCATTGTGGCCTGTCGTTATGCCAGTCGTCAACCGGAACCTAGTCTATATTGGTTGGCTAATAGTGAGCGGTGTCCGGGGGGAGTGATTGTGGCTTCGGAACCCCTATTTGCCGACCAAAAATGGCAGGCCTGTCCCTCCCAAAGTATTTTGGTAATTAATAGTCCAGAGGCGATCGCCGTTAAAGTTTTAGCGAATTCAGTGGCCTAA

Protein

MGSHCPLVSPSVGMISAGRQDYQKFFMCRLLGYLGQPLRPEQLIYRPEHSLIVQSYQPQEMTAGLLNADGFGLGWFDQESLPNPYLYKNVLPIWSDINLPHLSRYIQSSCFVSYVRSATPPLAVDLTNCQPFTEEGLLFVHNGFINNFRTTLYRPLRNLLSDASYQFIHGTTDSEHIFALILDNLRRLRQTSPGDSDWAKTSLGKALEASLLTLVELARQHDTFFSANILLADGQRIVACRYASRQPEPSLYWLANSERCPGGVIVASEPLFADQKWQACPSQSILVINSPEAIAVKVLANSVA