Your browser is old and dusty. Try Google Chrome!

Details for slr0196

ORF slr0196
Accession NP_442345.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -117 -131 11.5043 0.051
NP_440557.1_1 Reverse -117 -136 0.196116 0.265
NP_440795.1_7 Forward -124 -117 14.6904 0.0123
NP_440795.1_7 Reverse -117 -124 14.6904 0.0123
NP_440795.1_7 Reverse -276 -283 7.51227 0.24
NP_441418.1_6 Reverse -116 -135 -11.8986 0.0576
NP_442291.1_5 Forward -126 -110 3.69678 0.107
NP_442291.1_7 Forward -22 -8 11.3077 0.217
NP_440897.1_6 Forward -206 -187 -2.8529 0.225
NP_441453.1_4 Forward -125 -117 16.539 0.00633
NP_441453.1_4 Reverse -116 -124 7.8859 0.0536
NP_441453.1_4 Reverse -197 -205 6.70593 0.121
NP_441453.1_7 Reverse -357 -364 14.1988 0.175
NP_441623.1_1 Forward -295 -277 -4.60241 0.274
NP_442151.1_6 Reverse -116 -130 12.1926 0.0792
NP_442151.1_6 Reverse -122 -136 6.29277 0.24
NP_442151.1_6 Reverse -197 -211 5.50613 0.274
NP_442838.1_7 Forward -130 -111 -11.2103 0.272
NP_441818.1_1 Reverse -117 -128 9.69459 0.232
NP_441818.1_9 Reverse -300 -319 -8.55534 0.277
NP_440226.1_1 Forward -125 -106 8.75091 0.0823
NP_441465.1_8 Forward -103 -85 7.00065 0.246
NP_442169.1_1 Reverse -299 -318 -0.39387 0.261
NP_440120.1_4 Forward -62 -48 13.6676 0.29
NP_440150.1_2 Forward -112 -93 3.83357 0.29
NP_440150.1_6 Reverse -272 -291 0.786102 0.296
NP_442173.1_1 Reverse -117 -125 15.4574 0.00633
NP_442173.1_1 Forward -124 -116 14.1791 0.0165
NP_442173.1_1 Reverse -372 -380 7.59091 0.163
NP_442173.1_1 Forward -205 -197 5.82095 0.2
NP_442752.1_4 Reverse -197 -204 13.8055 0.0199
NP_442752.1_4 Forward -125 -118 13.8055 0.0199
NP_443027.1_4 Reverse -114 -124 17.188 0.0437
NP_443027.1_4 Forward -127 -117 14.828 0.0437
NP_441745.1_3 Forward -106 -87 13.175 0.292
NP_439997.1_6 Forward -399 -380 11.0125 0.212
NP_441812.1_3 Forward -142 -128 6.98109 0.287
NP_442975.1_10 Forward -129 -115 19.5668 0.00341
NP_440784.1_7 Forward -124 -117 15.9687 0.0123
NP_440784.1_7 Reverse -117 -124 15.9687 0.0123
NP_440784.1_7 Forward -205 -198 6.23397 0.241
NP_440784.1_7 Reverse -198 -205 6.13563 0.241
NP_440061.1_9 Forward -73 -59 7.3738 0.209
NP_440110.1_8 Reverse -363 -382 -0.787193 0.228
NP_441476.1_5 Forward -142 -123 -7.4737 0.29
NP_440878.1_4 Reverse -284 -302 11.7205 0.288
NP_442062.1_8 Reverse -116 -126 9.91146 0.0554
NP_442062.1_8 Forward -125 -115 9.61647 0.0587
NP_442062.1_8 Reverse -197 -207 7.15819 0.107
NP_441859.1_2 Reverse -82 -101 11.405 0.215
NP_441859.1_3 Reverse -196 -215 4.42355 0.222
NP_440304.1_4 Forward -127 -117 10.8948 0.051
NP_440304.1_4 Reverse -114 -124 10.1081 0.051
NP_440304.1_4 Reverse -208 -218 3.02829 0.299
NP_442242.1_4 Forward -124 -117 14.3954 0.0124
NP_442242.1_4 Reverse -117 -124 14.3954 0.0124
NP_442242.1_4 Reverse -198 -205 12.4288 0.0393
NP_440044.1_8 Forward -205 -186 1.86774 0.161
NP_441035.1_3 Reverse -275 -294 11.3075 0.122
NP_441594.1_6 Forward -134 -115 5.30933 0.209
NP_440370.1_10 Reverse -107 -126 21.4356 0.0301
NP_442110.1_7 Forward -125 -111 12.0943 0.0586
NP_442110.1_7 Reverse -116 -130 4.03116 0.208
NP_442110.1_7 Forward -380 -366 0.491246 0.259
NP_441925.1_4 Forward -286 -267 -9.04772 0.213
NP_441925.1_4 Forward -319 -300 -15.0459 0.263
NP_441083.1_5 Reverse -116 -126 2.04498 0.195
NP_441083.1_5 Forward -206 -196 1.74999 0.198
NP_441083.1_5 Forward -125 -115 1.55333 0.204
NP_441083.1_5 Reverse -197 -207 0.963343 0.218
NP_441738.1_2 Forward -204 -197 15.28 0.0102
NP_441738.1_2 Reverse -118 -125 15.28 0.0102
NP_441738.1_2 Forward -123 -116 11.5435 0.084
NP_441558.1_5 Reverse -114 -133 5.99764 0.232
NP_440209.1_1 Forward -125 -117 18.1123 0.00295
NP_440209.1_1 Reverse -197 -205 14.8674 0.012
NP_440209.1_1 Reverse -116 -124 8.47588 0.0457
NP_442889.1_1 Reverse -293 -312 -3.63879 0.146
NP_442889.1_8 Forward -128 -114 11.602 0.0733
NP_441713.1_1 Reverse -56 -75 -13.3736 0.255
NP_441713.1_4 Forward -320 -301 15.0441 0.142
NP_441713.1_5 Forward -141 -122 5.30933 0.286
NP_440178.1_7 Forward -126 -107 -13.1769 0.129
NP_442111.1_4 Reverse -115 -129 7.66941 0.0896
NP_442111.1_4 Forward -126 -112 7.37441 0.0975
NP_441163.1_1 Forward -316 -299 4.95467 0.282
NP_440343.1_3 Forward -324 -306 7.68819 0.205
NP_440851.1_5 Forward -146 -127 10.0284 0.281
NP_440906.1_5 Forward -124 -117 15.8704 0.0124
NP_440906.1_5 Reverse -117 -124 15.8704 0.0124
NP_440906.1_5 Forward -205 -198 12.0355 0.0724
NP_440906.1_5 Reverse -198 -205 12.0355 0.0724
NP_440747.1_10 Forward -209 -197 5.15219 0.0179
NP_440747.1_10 Reverse -113 -125 -2.02597 0.0196
NP_440747.1_10 Reverse -194 -206 -4.68091 0.115
NP_440747.1_10 Forward -128 -116 -11.7607 0.142
NP_441486.1_1 Forward -128 -114 3.63784 0.0563
NP_441486.1_1 Forward -209 -195 3.14618 0.0662
NP_441486.1_1 Reverse -113 -127 -0.295402 0.152
NP_441486.1_1 Reverse -194 -208 -2.65535 0.175
NP_442634.1_4 Forward -127 -113 7.57108 0.0479
NP_442848.1_1 Forward -131 -117 -2.45868 0.263
NP_443018.1_3 Forward -124 -117 14.8871 0.0123
NP_443018.1_3 Reverse -117 -124 14.8871 0.0123
NP_443018.1_3 Forward -205 -198 5.34899 0.212
NP_443018.1_3 Reverse -198 -205 5.34899 0.212
NP_441316.1_7 Forward -127 -112 7.25639 0.107
NP_441634.1_8 Reverse -87 -101 1.08123 0.209
NP_441634.1_8 Reverse -114 -128 0.88457 0.215
NP_441634.1_8 Forward -268 -254 0.294584 0.234
NP_440376.1_1 Forward -125 -116 9.73449 0.0365
NP_440376.1_1 Reverse -116 -125 9.63616 0.0385
NP_440376.1_1 Reverse -197 -206 -0.000272808 0.285
NP_440376.1_1 Forward -206 -197 -0.0986038 0.285
NP_441588.1_4 Forward -204 -194 15.9097 0.0369
NP_441588.1_4 Reverse -118 -128 6.96153 0.178
NP_442687.1_7 Forward -126 -116 6.76487 0.154
NP_441077.1_6 Forward -190 -174 5.01922 0.255
NP_442485.1_3 Reverse -283 -302 0.786102 0.234
NP_441846.1_10 Forward -102 -83 -6.29373 0.19
NP_441846.1_10 Reverse -300 -319 -21.4367 0.256
NP_441846.1_10 Reverse -299 -318 -22.42 0.259
NP_441846.1_10 Reverse -293 -312 -23.305 0.282
NP_442583.1_8 Reverse -94 -113 22.8122 0.0347
NP_440642.1_10 Reverse -188 -202 5.80051 0.241
NP_440642.1_10 Reverse -222 -236 4.71887 0.25
NP_440642.1_10 Forward -244 -230 3.14559 0.277
NP_441422.1_7 Forward -127 -110 -1.73112 0.194
NP_441422.1_7 Forward -382 -365 -7.72931 0.261
NP_441029.1_4 Forward -292 -273 -4.03212 0.293
NP_440667.1_2 Forward -125 -106 -7.4737 0.275
NP_441950.1_7 Reverse -153 -172 -9.44032 0.297
NP_442296.1_5 Reverse -107 -126 4.81767 0.251
NP_442296.1_9 Forward -131 -112 4.22769 0.156
NP_442296.1_9 Reverse -99 -118 -3.73712 0.257
NP_441763.1_10 Forward -136 -117 5.11187 0.294
NP_442658.1_1 Forward -127 -117 15.9091 0.00966
NP_442658.1_1 Reverse -114 -124 11.1893 0.0915
NP_440141.1_8 Reverse -201 -220 5.70265 0.273
NP_442782.1_2 Forward -125 -111 10.9143 0.173
NP_441414.1_9 Forward -125 -106 6.68596 0.0378
NP_441414.1_9 Forward -206 -187 -2.36049 0.114
NP_440607.1_1 Forward -116 -97 17.0107 0.165
NP_440607.1_8 Reverse -121 -140 -0.4922 0.289
NP_441256.1_4 Reverse -307 -326 20.2556 0.145
NP_442937.1_5 Forward -217 -198 8.16093 0.231
NP_442321.1_1 Forward -305 -286 -6.09707 0.231
NP_441958.1_5 Reverse -115 -125 11.3864 0.0074
NP_441958.1_5 Forward -126 -116 3.12662 0.0364
NP_441958.1_5 Reverse -196 -206 -6.41148 0.28
NP_441127.1_1 Reverse -230 -244 10.3243 0.251
NP_440203.1_5 Forward -306 -296 14.5325 0.0886
NP_440203.1_5 Forward -135 -125 12.0743 0.166
NP_439905.1_1 Forward -296 -283 6.21414 0.295
NP_443001.1_7 Reverse -117 -136 3.83436 0.279
NP_439990.1_5 Forward -211 -198 9.16406 0.15
NP_442911.1_2 Reverse -106 -125 8.06259 0.0223
NP_442911.1_2 Forward -216 -197 -0.688862 0.0775
NP_442911.1_2 Forward -135 -116 -4.13045 0.126
NP_441580.1_6 Forward -136 -117 -7.37537 0.241
NP_440153.1_5 Reverse -117 -131 10.226 0.0989
NP_440153.1_5 Forward -124 -110 8.45605 0.144
NP_440153.1_8 Forward -162 -149 -2.43899 0.238
NP_442064.1_1 Forward -211 -192 -10.7186 0.259
NP_443055.1_6 Reverse -75 -93 -1.45654 0.279
NP_440993.1_2 Reverse -111 -127 11.1699 0.0847
NP_440138.1_1 Forward -321 -303 6.50823 0.253
NP_442002.1_9 Forward -126 -119 10.7572 0.185
NP_441654.1_5 Forward -147 -128 13.6718 0.252
NP_441294.1_7 Forward -203 -189 10.8824 0.167
NP_441294.1_7 Forward -129 -115 9.05865 0.263
NP_442438.1_10 Reverse -111 -125 12.7826 0.0387
NP_442438.1_10 Forward -130 -116 6.78443 0.108
NP_441752.1_6 Forward -327 -308 -0.39387 0.279
NP_441000.1_5 Reverse -68 -87 4.52188 0.284
NP_441000.1_6 Reverse -274 -288 2.06454 0.151
NP_441000.1_6 Reverse -115 -129 -2.65535 0.22
NP_441000.1_6 Forward -126 -112 -5.40861 0.275
NP_440484.1_3 Reverse -195 -209 8.35772 0.3
NP_441674.1_5 Forward -336 -317 5.50599 0.144
NP_441550.1_8 Reverse -114 -124 9.81266 0.0836
NP_441550.1_8 Forward -127 -117 6.0761 0.214
NP_441550.1_8 Reverse -195 -205 5.28945 0.255
NP_441916.1_5 Forward -251 -232 16.8141 0.246
NP_441916.1_7 Reverse -116 -126 10.2065 0.0266
NP_441916.1_7 Forward -125 -115 9.61647 0.0333
NP_440206.1_4 Forward -130 -111 -0.197979 0.29
NP_440206.1_10 Forward -312 -293 14.4541 0.288
NP_441041.1_4 Forward -125 -106 7.37428 0.0395
NP_441041.1_4 Forward -131 -112 -7.4737 0.188
NP_441041.1_4 Reverse -117 -136 -9.63698 0.219
NP_441041.1_4 Reverse -123 -142 -10.0303 0.227
NP_442004.1_6 Forward -71 -57 5.80112 0.181
NP_440703.1_9 Forward -101 -88 4.54195 0.296
NP_441725.1_5 Reverse -117 -127 11.2881 0.0247
NP_441725.1_5 Forward -124 -114 9.91146 0.0441
NP_439966.1_7 Forward -127 -117 18.4657 0.00473
NP_439966.1_7 Reverse -114 -124 12.2709 0.0464
NP_439966.1_7 Forward -382 -372 4.99446 0.248
NP_439966.1_9 Forward -127 -118 0.983037 0.253
NP_442941.1_3 Reverse -117 -127 11.4848 0.0116
NP_442941.1_3 Forward -124 -114 10.5014 0.0148
NP_442941.1_3 Forward -205 -195 1.35667 0.15
NP_440289.1_2 Forward -128 -115 5.32916 0.0636
NP_440983.1_5 Forward -144 -125 -7.57203 0.291
NP_440260.1_7 Reverse -166 -185 -5.70374 0.277
NP_442281.1_1 Forward -130 -116 17.7968 0.00542
NP_440437.1_1 Reverse -110 -129 10.3242 0.0441
NP_442012.1_1 Reverse -122 -141 1.76941 0.212
NP_441556.1_4 Forward -296 -277 10.9692 0.261
NP_440498.1_1 Reverse -107 -125 17.7187 0.0181
NP_442982.1_5 Reverse -106 -125 -2.85214 0.289
NP_440375.1_8 Forward -205 -186 -1.57384 0.288
NP_443030.1_4 Reverse -104 -123 -0.295539 0.222
NP_443030.1_4 Reverse -93 -112 -7.86702 0.299
NP_441644.1_6 Forward -125 -115 16.5975 0.00319
NP_441644.1_6 Reverse -197 -207 10.5993 0.0628
NP_441644.1_6 Reverse -123 -133 5.28945 0.199
NP_441795.1_5 Reverse -23 -42 6.78429 0.245
NP_442215.1_1 Reverse -112 -131 4.916 0.247
NP_442215.1_2 Forward -208 -192 1.43517 0.134
NP_442215.1_2 Reverse -195 -211 -3.77637 0.222
NP_442215.1_2 Reverse -114 -130 -3.77637 0.222
NP_442215.1_2 Forward -127 -111 -5.54633 0.251
NP_442215.1_7 Forward -235 -216 19.0757 0.159
NP_442029.1_6 Reverse -123 -142 11.6025 0.158
NP_442029.1_6 Reverse -57 -76 10.5209 0.18
NP_442029.1_6 Reverse -192 -211 6.58763 0.238
NP_440253.1_2 Forward -263 -245 -0.669169 0.218
NP_440929.1_8 Forward -125 -116 17.4043 0.00289
NP_440929.1_8 Reverse -116 -125 17.4043 0.00289
NP_440929.1_8 Forward -206 -197 7.86621 0.0522
NP_440929.1_8 Reverse -197 -206 7.57121 0.0706
NP_440929.1_8 Forward -380 -371 3.44131 0.226
NP_440469.1_8 Forward -235 -216 22.5172 0.0272
NP_440469.1_10 Forward -202 -183 18.8781 0.207
NP_442933.1_10 Forward -125 -116 9.04618 0.063
NP_442933.1_10 Reverse -116 -125 8.94785 0.0643
NP_442933.1_10 Reverse -197 -206 5.40793 0.19
NP_441751.2_8 Forward -124 -110 -1.18038 0.129
NP_441751.2_8 Reverse -117 -131 -1.47537 0.129
NP_442554.1_8 Reverse -117 -127 13.8447 0.0145
NP_442554.1_8 Forward -124 -114 13.648 0.0164
NP_442554.1_8 Forward -205 -195 5.5849 0.145
NP_442554.1_8 Reverse -198 -208 2.43831 0.272
NP_442554.1_8 Reverse -57 -67 1.84832 0.292
NP_442075.1_10 Forward -125 -106 11.7992 0.282
NP_441762.1_7 Reverse -115 -127 -4.48425 0.175
NP_441762.1_7 Forward -126 -114 -5.17256 0.191
NP_442313.1_3 Reverse -321 -340 8.65258 0.224
NP_442142.1_4 Reverse -113 -126 10.4418 0.0724
NP_442142.1_4 Forward -128 -115 7.2952 0.143
NP_442142.1_4 Forward -209 -196 5.52525 0.188
NP_442292.1_1 Forward -124 -115 16.9127 0.00594
NP_442292.1_1 Reverse -117 -126 9.63616 0.0183
NP_442292.1_1 Forward -205 -196 8.75118 0.0306
NP_442292.1_1 Reverse -198 -207 8.06287 0.0554
NP_441024.1_7 Reverse -185 -203 8.96649 0.292
NP_440895.1_6 Forward -212 -199 10.934 0.202
NP_443009.1_5 Reverse -115 -126 9.89126 0.0866
NP_443009.1_5 Forward -126 -115 6.74468 0.15
NP_443009.1_6 Reverse -130 -149 17.5024 0.28
NP_441715.1_4 Reverse -117 -127 16.303 0.0117
NP_441715.1_4 Forward -124 -114 5.09324 0.233
NP_441448.1_1 Reverse -268 -287 4.62101 0.275
NP_440183.1_9 Forward -301 -282 -14.1602 0.263
NP_440183.1_9 Reverse -85 -104 -19.3717 0.278
NP_441198.1_5 Forward -204 -191 13.6867 0.206
NP_441198.1_8 Reverse -114 -124 11.8064 0.183
NP_440379.1_5 Reverse -230 -249 -5.70374 0.226
NP_441468.1_1 Forward -124 -117 15.8704 0.0124
NP_441468.1_1 Reverse -117 -124 15.8704 0.0124
NP_441468.1_1 Forward -205 -198 6.13563 0.209
NP_441468.1_1 Reverse -198 -205 6.0373 0.223
NP_441020.2_6 Forward -127 -110 9.47861 0.17
NP_441015.1_8 Forward -72 -53 0.982764 0.272
NP_441015.1_10 Reverse -294 -313 -10.522 0.284
NP_441673.1_1 Forward -125 -116 11.1111 0.0121
NP_441673.1_1 Reverse -116 -125 11.0128 0.018
NP_441673.1_1 Forward -206 -197 1.27803 0.155
NP_441673.1_1 Reverse -197 -206 1.27803 0.155
NP_441826.1_2 Forward -131 -117 23.1074 0.00229
NP_441826.1_2 Reverse -110 -124 3.34284 0.111
NP_441330.1_1 Forward -281 -262 -15.8318 0.3
NP_442490.1_10 Forward -102 -84 16.1454 0.0966
NP_442490.1_10 Forward -142 -124 8.08229 0.286
NP_441764.1_8 Forward -61 -51 11.6935 0.284
NP_442868.1_6 Forward -127 -117 0.963343 0.205
NP_442868.1_6 Reverse -195 -205 -0.0199663 0.255
NP_441056.1_1 Reverse -116 -135 0.294447 0.156
NP_442677.1_5 Reverse -197 -216 11.7008 0.292
NP_441612.1_2 Reverse -239 -249 12.325 0.21
NP_442361.1_3 Forward -131 -118 9.85238 0.272
NP_442808.1_1 Forward -327 -317 9.616 0.0481
NP_442808.1_1 Forward -126 -116 8.73102 0.0481
NP_441101.1_10 Reverse -358 -377 0.58944 0.175
NP_440031.1_10 Reverse -124 -143 3.04771 0.256
NP_440145.1_3 Reverse -361 -380 -4.32711 0.228
NP_442542.1_9 Forward -132 -118 9.73373 0.13
NP_442113.1_10 Forward -321 -302 -7.76869 0.271
NP_442050.1_5 Reverse -114 -124 17.4824 0.00791
NP_442050.1_5 Forward -127 -117 9.12434 0.193
NP_441493.2_7 Reverse -298 -317 14.6508 0.205
NP_440558.1_2 Forward -141 -122 3.24438 0.159
NP_440558.1_2 Forward -123 -104 2.65439 0.166
NP_440558.1_2 Reverse -107 -126 -1.27885 0.213
NP_440558.1_2 Forward -324 -305 -4.6221 0.247
NP_442789.1_4 Reverse -154 -173 -5.99873 0.281
NP_440274.1_4 Forward -378 -360 1.78911 0.27
NP_442688.1_4 Forward -113 -94 12.3892 0.204
NP_441878.1_6 Forward -126 -116 0.668351 0.139
NP_441878.1_6 Reverse -115 -125 0.668351 0.139
NP_441036.1_8 Reverse -115 -125 14.7297 0.0187
NP_441036.1_8 Forward -126 -116 8.1415 0.176
NP_441036.1_8 Forward -207 -197 5.78156 0.258
NP_442650.1_2 Reverse -197 -211 8.25939 0.13
NP_441557.1_5 Reverse -116 -125 17.4043 0.0023
NP_441557.1_5 Forward -125 -116 10.8161 0.00464
NP_441557.1_5 Forward -206 -197 7.66954 0.0443
NP_441557.1_5 Reverse -197 -206 0.983037 0.0911
NP_441557.1_8 Forward -319 -309 12.9592 0.23
NP_441445.1_8 Reverse -358 -377 -5.11376 0.277
NP_441445.1_8 Forward -301 -282 -10.9153 0.277
NP_441433.1_2 Forward -174 -155 13.5691 0.265
NP_442777.1_3 Forward -310 -292 6.90155 0.199
NP_441308.1_8 Reverse -114 -124 11.8781 0.22
NP_441308.1_8 Forward -127 -117 10.1081 0.22
NP_440101.1_3 Reverse -111 -130 8.75091 0.154
NP_441574.1_1 Reverse -326 -345 -3.14714 0.236
NP_441549.1_9 Forward -129 -111 -6.4707 0.2
NP_442347.1_2 Reverse -117 -126 11.1111 0.056
NP_442347.1_2 Forward -205 -196 3.93297 0.284
NP_442645.1_2 Reverse -108 -127 -14.4552 0.175
NP_441037.1_4 Forward -127 -117 7.02532 0.237
NP_441037.1_4 Reverse -195 -205 6.92787 0.237
NP_441037.1_4 Reverse -114 -124 6.24566 0.274
NP_441633.1_3 Reverse -114 -127 -4.11062 0.181
NP_441633.1_3 Forward -208 -195 -6.76555 0.271
NP_440136.1_2 Forward -124 -117 15.9687 0.0123
NP_440136.1_2 Reverse -117 -124 15.9687 0.0123
NP_440136.1_2 Forward -205 -198 6.23397 0.171
NP_440136.1_2 Reverse -198 -205 6.13563 0.193
NP_442590.1_9 Reverse -82 -101 7.47261 0.25
NP_442590.1_10 Reverse -116 -135 10.0292 0.183
NP_442590.1_10 Reverse -86 -105 5.50599 0.258
NP_442998.1_5 Forward -61 -51 11.0914 0.196
NP_442998.1_10 Forward -204 -197 15.5754 0.0102
NP_442998.1_10 Reverse -118 -125 15.5754 0.0102
NP_442998.1_10 Forward -123 -116 5.84064 0.235
NP_440899.1_1 Forward -143 -124 5.67487 0.297
NP_440299.1_1 Forward -210 -197 18.0132 0.00482
NP_440299.1_1 Reverse -112 -125 7.98351 0.1
NP_440299.1_1 Reverse -193 -206 6.60689 0.136
NP_440299.1_1 Forward -129 -116 3.36198 0.247
NP_441799.1_1 Reverse -112 -126 7.86545 0.13
NP_441799.1_4 Forward -287 -268 -5.60541 0.228
NP_440640.1_6 Forward -137 -118 0.294447 0.275
NP_441007.1_10 Reverse -111 -124 0.60927 0.221
NP_441007.1_10 Reverse -148 -161 -1.06236 0.3
NP_442333.2_5 Forward -136 -117 -14.0619 0.271
NP_440256.1_1 Reverse -113 -132 8.65258 0.0229
NP_440256.1_1 Forward -128 -109 -8.94866 0.27
NP_440087.1_1 Reverse -308 -327 -7.4737 0.276
NP_441512.1_4 Reverse -112 -131 11.1109 0.237
NP_441512.1_4 Forward -148 -129 6.78429 0.299
NP_440915.1_6 Forward -129 -115 6.09611 0.0862
NP_442158.1_4 Reverse -54 -64 10.6981 0.283
NP_442967.1_10 Forward -132 -118 16.2915 0.222
NP_440749.1_1 Reverse -116 -135 1.76941 0.257
NP_442866.1_1 Reverse -111 -130 -0.983855 0.202
NP_440748.1_5 Reverse -107 -126 9.43923 0.143
NP_440748.1_5 Forward -129 -110 6.78429 0.188
NP_440695.1_5 Reverse -326 -345 0.0977854 0.284
NP_442453.1_6 Forward -101 -87 17.2382 0.161
NP_442993.1_1 Reverse -116 -132 -7.31629 0.146
NP_442386.1_9 Forward -126 -117 15.7322 0.0144
NP_442386.1_9 Reverse -115 -124 5.11253 0.266
NP_440570.1_4 Reverse -293 -311 4.05072 0.238
NP_442054.1_2 Forward -184 -165 -1.67217 0.224
NP_441340.1_5 Forward -124 -117 15.6737 0.0124
NP_441340.1_5 Reverse -117 -124 15.6737 0.0124
NP_441340.1_5 Reverse -198 -205 6.13563 0.175
NP_441340.1_5 Forward -205 -198 5.93897 0.198
NP_441340.1_5 Reverse -372 -379 4.07068 0.239
NP_442791.1_1 Forward -142 -123 10.0292 0.25
NP_442791.1_5 Reverse -259 -278 -11.5053 0.29
NP_442506.1_2 Reverse -100 -119 1.57275 0.3
NP_440586.1_1 Reverse -152 -171 -3.73712 0.273
NP_440586.1_8 Forward -124 -117 13.2151 0.026
NP_440586.1_8 Reverse -117 -124 13.2151 0.026
NP_440586.1_8 Reverse -198 -205 11.4451 0.0645
NP_442251.1_6 Forward -124 -117 15.2804 0.0124
NP_442251.1_6 Reverse -117 -124 15.2804 0.0124
NP_442251.1_6 Forward -205 -198 12.0355 0.0627
NP_442959.1_4 Forward -107 -88 6.19431 0.224
NP_442959.1_4 Reverse -51 -70 5.30933 0.25
NP_442959.1_5 Reverse -172 -191 6.68596 0.251
NP_440684.1_9 Forward -131 -117 8.65272 0.225
NP_441262.1_3 Reverse -116 -123 14.8871 0.0223
NP_441262.1_3 Reverse -197 -204 14.7888 0.0223
NP_441262.1_3 Forward -125 -118 14.7888 0.0223
NP_441262.1_3 Reverse -371 -378 5.44732 0.11
NP_441262.1_3 Forward -206 -199 5.15232 0.265
NP_443051.1_1 Reverse -115 -124 17.5026 0.0066
NP_443051.1_1 Forward -126 -117 10.4228 0.00754
NP_443051.1_1 Reverse -196 -205 0.786375 0.125
NP_440408.1_3 Forward -131 -112 9.24257 0.105
NP_440439.1_1 Reverse -113 -126 6.4108 0.078
NP_440439.1_1 Forward -128 -115 -0.0790467 0.207
NP_440372.1_2 Forward -124 -117 16.3621 0.0124
NP_440372.1_2 Reverse -117 -124 16.3621 0.0124
NP_440372.1_2 Reverse -198 -205 6.72562 0.0929
NP_440372.1_2 Forward -205 -198 6.62729 0.151
NP_440372.1_2 Reverse -372 -379 4.36568 0.205
NP_440171.1_3 Reverse -296 -315 1.76941 0.293
NP_441803.1_2 Reverse -111 -130 0.786102 0.244
NP_441803.1_2 Reverse -123 -142 0.491109 0.251
NP_439977.1_5 Forward -386 -367 0.884433 0.199
NP_441616.1_9 Reverse -299 -318 18.289 0.27
NP_440139.1_1 Forward -282 -263 3.53858 0.202
NP_440139.1_1 Forward -131 -112 2.45694 0.233
NP_441572.1_7 Forward -131 -112 21.1406 0.015
NP_440267.1_2 Reverse -111 -125 16.4202 0.0566
NP_441245.1_2 Forward -272 -258 19.7641 0.274
NP_442384.1_10 Forward -125 -112 4.73917 0.148
NP_442384.1_10 Forward -206 -193 4.34585 0.16
NP_442114.1_4 Reverse -116 -127 8.81013 0.182
NP_442790.1_4 Forward -134 -115 -14.4552 0.277
NP_442262.1_10 Forward -124 -117 14.1988 0.0123
NP_442262.1_10 Reverse -117 -124 14.1988 0.0123
NP_441689.1_5 Reverse -114 -124 10.796 0.132
NP_441689.1_5 Forward -127 -117 8.53436 0.132
NP_440163.1_10 Forward -128 -118 15.2213 0.0762
NP_440344.1_10 Forward -132 -115 -5.1727 0.104
NP_440282.1_10 Forward -313 -294 -8.94866 0.269
NP_440282.1_10 Forward -142 -123 -9.24366 0.275
NP_441640.1_8 Reverse -123 -142 -3.3438 0.255
NP_440297.1_9 Forward -124 -114 9.51814 0.0917
NP_440297.1_9 Reverse -117 -127 9.32148 0.0917
NP_440894.1_10 Forward -244 -225 11.4058 0.146
NP_440999.1_2 Reverse -160 -179 9.0459 0.285
NP_440999.1_9 Forward -129 -115 1.86788 0.157
NP_440999.1_9 Forward -384 -370 -2.65535 0.273
NP_440888.1_2 Reverse -116 -130 10.717 0.0861
NP_440888.1_2 Forward -125 -111 6.19383 0.243
NP_440888.1_2 Forward -320 -306 5.30886 0.284
NP_442225.1_10 Reverse -52 -71 9.43841 0.233
NP_439969.1_3 Forward -130 -111 0.0977854 0.27
NP_441748.1_3 Forward -52 -33 12.6132 0.25
NP_442277.1_2 Forward -250 -236 11.5043 0.263
NP_442277.1_4 Forward -134 -115 6.58682 0.157
NP_441543.1_2 Reverse -117 -126 18.486 0.00236
NP_441543.1_2 Forward -205 -196 7.17789 0.131
NP_441543.1_2 Forward -124 -115 6.39124 0.153
NP_442845.1_2 Forward -131 -117 6.6861 0.205
NP_441178.1_6 Reverse -284 -303 3.9319 0.269
NP_441469.1_8 Forward -126 -117 16.126 0.00797
NP_441469.1_8 Reverse -115 -124 6.98123 0.227
NP_442337.1_6 Reverse -14 -33 12.6654 0.285
NP_442578.1_7 Forward -124 -117 14.5921 0.026
NP_442578.1_7 Reverse -117 -124 14.5921 0.026
NP_442578.1_7 Reverse -198 -205 5.93897 0.183
NP_441462.1_2 Forward -125 -115 11.3864 0.00425
NP_441462.1_2 Reverse -116 -126 1.74999 0.0811
NP_441621.1_7 Forward -127 -113 -3.54032 0.19
NP_443062.1_1 Forward -125 -107 16.5415 0.0308
NP_443062.1_1 Reverse -116 -134 10.8861 0.108
NP_443062.1_1 Forward -308 -290 5.42569 0.229
NP_443062.1_1 Reverse -123 -141 4.06059 0.276
NP_441410.1_3 Forward -134 -115 8.35759 0.21
NP_442204.1_1 Forward -129 -118 0.353664 0.281
NP_442204.1_1 Reverse -112 -123 -0.334653 0.295
NP_442204.1_2 Forward -135 -116 7.07928 0.287
NP_442204.1_5 Forward -135 -116 2.94938 0.201
NP_442204.1_5 Reverse -230 -249 2.16274 0.217
NP_442204.1_6 Reverse -83 -102 5.80098 0.269
NP_440516.1_2 Forward -212 -194 -1.94747 0.295
NP_440516.1_6 Reverse -83 -97 9.83206 0.234
NP_440516.1_8 Forward -125 -116 9.53783 0.0136
NP_440516.1_8 Reverse -197 -206 8.25953 0.0391
NP_440516.1_8 Reverse -116 -125 7.07956 0.0867
NP_442428.1_4 Forward -126 -107 11.0125 0.131
NP_442428.1_5 Forward -124 -117 15.8704 0.0124
NP_442428.1_5 Reverse -117 -124 15.8704 0.0124
NP_442428.1_5 Forward -205 -198 6.13563 0.209
NP_442428.1_5 Reverse -198 -205 6.0373 0.212
NP_440818.1_6 Reverse -360 -379 5.89931 0.284
NP_442120.1_10 Forward -131 -112 -14.1602 0.288
NP_442120.1_10 Reverse -153 -172 -15.0452 0.289
NP_440673.1_3 Forward -204 -197 12.4288 0.0426
NP_440673.1_3 Reverse -118 -125 12.4288 0.0426
NP_440673.1_3 Reverse -367 -374 6.92228 0.277
NP_440673.1_3 Forward -123 -116 5.34899 0.298
NP_440673.1_7 Forward -136 -117 9.63589 0.115
NP_441714.1_3 Forward -213 -195 16.6363 0.116
NP_441052.1_2 Reverse -116 -126 1.94665 0.221
NP_441052.1_2 Forward -206 -196 1.65166 0.233
NP_441052.1_2 Forward -125 -115 0.668351 0.256
NP_441052.1_2 Reverse -197 -207 0.57002 0.256
NP_442219.1_9 Reverse -117 -126 8.35786 0.0681
NP_442219.1_9 Forward -205 -196 8.06287 0.0696
NP_440436.1_4 Reverse -117 -126 18.1905 0.00233
NP_440436.1_4 Forward -205 -196 13.9623 0.0193
NP_440436.1_4 Reverse -198 -207 4.81753 0.239
NP_441884.1_8 Forward -126 -107 -9.73531 0.268
NP_441884.1_9 Reverse -282 -301 -22.125 0.275
NP_442412.1_5 Forward -309 -290 1.47442 0.295
NP_440314.1_9 Forward -346 -327 -0.0988766 0.104
NP_442577.1_5 Reverse -105 -124 5.70265 0.245
NP_441719.1_4 Forward -124 -117 16.3621 0.0124
NP_441719.1_4 Reverse -117 -124 16.3621 0.0124
NP_441719.1_4 Reverse -198 -205 6.72562 0.093
NP_441719.1_4 Forward -205 -198 6.62729 0.151
NP_441733.1_10 Reverse -113 -126 6.01747 0.203
NP_441004.1_1 Reverse -123 -142 -13.2752 0.256
NP_442813.1_4 Reverse -363 -382 -7.76869 0.299
NP_442366.1_3 Reverse -196 -214 7.39397 0.0747
NP_442366.1_3 Reverse -115 -133 6.50899 0.0776
NP_442366.1_3 Reverse -27 -45 -2.0458 0.219
NP_442366.1_5 Reverse -194 -204 15.4175 0.0374
NP_440129.1_10 Forward -132 -118 3.73617 0.189
NP_441115.1_4 Reverse -115 -133 18.7012 0.0126
NP_441115.1_4 Forward -126 -108 13.293 0.0827
NP_442206.1_1 Forward -288 -269 -14.1602 0.267
NP_442206.1_10 Reverse -123 -138 11.7796 0.0975
NP_442206.1_10 Forward -125 -110 5.48643 0.178
NP_440328.1_4 Forward -131 -112 -0.197208 0.27
NP_443054.1_2 Reverse -114 -128 2.65453 0.242
NP_441966.1_7 Reverse -290 -309 5.40686 0.192
NP_441966.1_7 Reverse -101 -120 -1.57461 0.288
NP_442308.1_8 Forward -144 -125 11.6025 0.231
NP_441851.1_10 Forward -126 -116 15.8113 0.00552
NP_441851.1_10 Reverse -115 -125 6.96153 0.151
NP_441851.1_10 Reverse -196 -206 5.87989 0.196
NP_441851.1_10 Reverse -274 -284 4.99491 0.233
NP_441851.1_10 Forward -207 -197 4.50326 0.266
NP_442515.1_1 Reverse -239 -253 -4.03198 0.298
NP_440593.1_3 Forward -113 -94 1.27776 0.19
NP_440593.1_3 Reverse -192 -211 -6.78538 0.28
NP_440593.1_9 Reverse -359 -373 10.6193 0.24
NP_441349.1_10 Reverse -220 -239 -2.95047 0.13
NP_442843.1_1 Reverse -141 -160 -10.7186 0.28
NP_439960.1_4 Reverse -82 -101 14.9449 0.164
NP_439960.1_10 Reverse -223 -241 -2.63579 0.257
NP_440474.1_8 Reverse -117 -131 9.34041 0.162
NP_440726.1_2 Forward -301 -282 -0.787193 0.295
NP_441477.1_5 Reverse -85 -104 11.7992 0.268
NP_441477.1_5 Forward -106 -87 7.17762 0.277
NP_441477.1_5 Forward -246 -227 5.80098 0.292
NP_442450.1_5 Forward -127 -117 9.32148 0.115
NP_442168.1_5 Reverse -154 -173 -2.36049 0.264
NP_440195.1_4 Forward -137 -118 4.62101 0.294
NP_440954.1_1 Reverse -153 -172 -11.2103 0.289
NP_442006.1_2 Forward -241 -224 -18.1524 0.288
NP_441003.1_9 Forward -312 -293 7.17762 0.237
NP_441003.1_9 Reverse -83 -102 6.68596 0.242
NP_442243.1_1 Reverse -365 -383 -2.24319 0.288
NP_441570.1_1 Forward -125 -107 10.2456 0.00922
NP_441078.1_4 Forward -125 -116 9.93116 0.0203
NP_441078.1_4 Reverse -116 -125 9.83282 0.0226
NP_441078.1_4 Reverse -197 -206 0.0980582 0.205
NP_441078.1_4 Forward -206 -197 0.0980582 0.205
NP_442729.1_8 Forward -129 -116 5.13249 0.263
NP_442443.1_1 Reverse -84 -103 -5.80207 0.285
NP_440526.1_3 Reverse -198 -209 4.8764 0.264
NP_440526.1_3 Reverse -117 -128 1.92649 0.267
NP_441432.1_8 Forward -126 -117 8.25953 0.0755
NP_441432.1_8 Reverse -196 -205 7.17789 0.102
NP_441432.1_8 Reverse -115 -124 6.98123 0.112
NP_442320.1_8 Forward -131 -117 13.5693 0.0144
NP_442344.1_7 Forward -205 -186 -7.96535 0.198
NP_442344.1_7 Reverse -117 -136 -9.34199 0.249
NP_442344.1_7 Forward -124 -105 -9.83364 0.27
NP_441732.1_2 Forward -210 -194 -17.5427 0.27
NP_441732.1_2 Reverse -112 -128 -17.641 0.281
NP_442343.1_1 Reverse -113 -132 16.7157 0.271
NP_442343.1_1 Forward -129 -110 14.7491 0.271
NP_440629.1_4 Reverse -17 -36 8.75091 0.264
NP_440199.1_10 Forward -128 -118 14.533 0.0861
NP_440461.1_3 Forward -109 -90 17.3057 0.145
NP_441945.1_10 Reverse -122 -141 8.45592 0.273
NP_441805.1_6 Forward -173 -154 10.3242 0.194
NP_441057.1_4 Reverse -356 -374 -3.52077 0.29
NP_442489.1_7 Forward -125 -116 10.4228 0.0151
NP_442489.1_7 Reverse -116 -125 10.3245 0.0193
NP_442489.1_7 Forward -206 -197 0.786375 0.152
NP_442489.1_7 Reverse -197 -206 0.589713 0.17
NP_441830.1_8 Forward -299 -280 20.9472 0.159
NP_440559.1_1 Forward -205 -196 14.1594 0.0317
NP_440559.1_1 Reverse -117 -126 8.75118 0.0586
NP_440559.1_1 Forward -124 -115 7.76787 0.0918
NP_440559.1_1 Reverse -198 -207 7.07956 0.112
NP_441659.2_8 Forward -125 -115 17.5813 0.0024
NP_441659.2_8 Reverse -197 -207 11.4848 0.0172
NP_441659.2_8 Reverse -116 -126 2.43831 0.2
NP_441659.2_8 Reverse -254 -264 1.25834 0.245
NP_441040.1_5 Reverse -192 -211 5.01433 0.241
NP_442346.1_5 Reverse -196 -206 14.0414 0.0173
NP_442346.1_5 Forward -126 -116 7.74818 0.159
NP_442346.1_5 Reverse -115 -125 6.8632 0.188
NP_440352.1_5 Forward -70 -51 12.461 0.229
NP_440545.1_3 Reverse -112 -129 3.67709 0.0804
NP_440545.1_3 Reverse -290 -307 -3.40274 0.203
NP_440545.1_3 Forward -129 -112 -4.09106 0.218
NP_441856.1_3 Forward -128 -109 1.0811 0.213
NP_441786.1_3 Reverse -295 -314 9.3409 0.221
NP_440459.1_2 Forward -241 -224 15.2801 0.113
NP_441653.1_2 Forward -136 -117 6.04209 0.235
NP_440010.1_1 Reverse -126 -145 7.07928 0.246
NP_440946.1_6 Reverse -81 -100 6.09597 0.294
NP_441948.1_4 Reverse -109 -127 -2.93078 0.179
NP_441833.1_4 Forward -124 -117 15.9687 0.0124
NP_441833.1_4 Reverse -117 -124 15.9687 0.0124
NP_441833.1_4 Forward -205 -198 14.1004 0.0258
NP_441833.1_4 Reverse -198 -205 6.13563 0.198
NP_442162.1_9 Forward -124 -117 16.2637 0.0124
NP_442162.1_9 Reverse -117 -124 16.2637 0.0124
NP_442162.1_9 Forward -205 -198 6.62729 0.142
NP_442162.1_9 Reverse -198 -205 6.52896 0.178
NP_442162.1_9 Reverse -372 -379 3.4807 0.246
NP_442162.1_9 Forward -379 -372 3.38237 0.276
NP_440671.1_4 Forward -131 -117 19.3708 0.00937
NP_440671.1_4 Reverse -110 -124 13.0776 0.0926
NP_440671.1_4 Reverse -299 -313 6.58777 0.243
NP_442140.1_3 Reverse -198 -208 11.7798 0.0727
NP_442140.1_3 Reverse -117 -127 8.33817 0.119
NP_440875.1_9 Forward -306 -296 8.5667 0.233
NP_440875.1_9 Reverse -118 -128 8.37203 0.233
NP_441813.1_5 Forward -127 -117 17.188 0.00979
NP_441813.1_5 Reverse -114 -124 15.123 0.0136
NP_441813.1_5 Forward -382 -372 5.97822 0.105
NP_441813.1_7 Forward -200 -186 8.84875 0.272
NP_440594.1_3 Reverse -116 -134 13.2938 0.239
NP_440590.1_4 Reverse -117 -130 13.0973 0.013
NP_440590.1_4 Forward -205 -192 4.93583 0.0585
NP_440590.1_4 Forward -97 -84 -2.34066 0.241
NP_440590.1_4 Reverse -372 -385 -5.58558 0.283
NP_440590.1_4 Reverse -198 -211 -5.88057 0.293
NP_440567.1_1 Reverse -117 -131 13.0776 0.0213
NP_440567.1_1 Forward -205 -191 5.30946 0.104
NP_440567.1_1 Forward -124 -110 1.17956 0.214
NP_442497.1_1 Forward -287 -268 7.37347 0.291
NP_442497.1_10 Forward -124 -115 15.7327 0.0087
NP_442497.1_10 Reverse -117 -126 10.4228 0.0087
NP_442497.1_10 Forward -205 -196 0.688044 0.141
NP_440821.1_4 Forward -127 -117 19.0562 0.00399
NP_440821.1_4 Reverse -114 -124 10.5014 0.015
NP_440821.1_4 Reverse -195 -205 -0.41329 0.257
NP_441239.1_9 Reverse -114 -126 14.6903 0.0258
NP_441239.1_9 Forward -127 -115 9.18376 0.113
NP_441239.1_9 Forward -305 -293 5.05386 0.231
NP_441239.1_9 Reverse -81 -93 4.75886 0.243
NP_441892.1_1 Forward -134 -117 2.10379 0.144
NP_441892.1_1 Reverse -90 -107 -4.38605 0.26
NP_440604.1_6 Forward -125 -106 -1.37718 0.202
NP_442044.1_9 Forward -125 -106 9.73422 0.146
NP_442270.1_9 Forward -142 -123 -7.96535 0.215
NP_440500.1_4 Forward -191 -172 16.0274 0.202
NP_442809.1_6 Forward -71 -52 4.71934 0.256
NP_440546.1_4 Forward -125 -115 6.65249 0.288
NP_442041.1_2 Reverse -8 -26 9.36059 0.283
NP_442041.1_5 Forward -327 -308 -1.37718 0.284
NP_440462.1_6 Forward -127 -117 15.418 0.0142
NP_440462.1_6 Reverse -114 -124 8.23984 0.0687
NP_442611.1_1 Forward -380 -361 9.93088 0.1
NP_440868.1_4 Reverse -112 -124 5.15219 0.104
NP_440868.1_4 Forward -243 -231 2.69391 0.149
NP_440868.1_4 Forward -129 -117 1.7106 0.174
NP_442840.1_10 Forward -282 -263 15.9291 0.229
NP_442402.1_4 Reverse -54 -73 -8.06442 0.278
NP_441848.1_4 Forward -38 -22 14.3306 0.17
NP_441084.1_6 Forward -68 -54 11.2833 0.208
NP_441084.1_6 Forward -134 -120 9.92586 0.257
NP_440653.1_10 Reverse -117 -136 12.7825 0.121
NP_442460.1_7 Reverse -123 -142 2.16274 0.249
NP_442923.1_4 Reverse -123 -142 -6.49039 0.297
NP_442039.1_4 Forward -124 -117 15.1821 0.0124
NP_442039.1_4 Reverse -117 -124 15.1821 0.0124
NP_442837.1_3 Forward -124 -117 15.7721 0.0124
NP_442837.1_3 Reverse -117 -124 15.7721 0.0124
NP_442837.1_3 Forward -205 -198 6.13563 0.25
NP_442837.1_3 Reverse -198 -205 5.93897 0.265
NP_442053.1_1 Forward -125 -116 9.34117 0.0666
NP_442053.1_1 Reverse -116 -125 8.84951 0.072
NP_440505.1_3 Forward -127 -117 13.8447 0.0247
NP_440505.1_3 Reverse -195 -205 7.94484 0.147
NP_440505.1_3 Reverse -114 -124 5.28991 0.236
NP_441102.1_1 Reverse -117 -136 11.6025 0.125
NP_441203.1_1 Reverse -117 -136 -20.1584 0.297
NP_441203.1_2 Forward -303 -284 -5.40875 0.265
NP_440914.1_1 Forward -125 -115 14.0802 0.0188
NP_440914.1_1 Reverse -240 -250 7.24882 0.242
NP_440914.1_1 Forward -206 -196 6.95605 0.257
NP_441011.1_8 Reverse -117 -126 16.9127 0.00602
NP_441011.1_8 Forward -124 -115 8.94785 0.141
NP_442101.1_2 Reverse -369 -388 17.994 0.171
NP_442533.1_6 Forward -125 -116 7.86621 0.0862
NP_442533.1_6 Reverse -116 -125 7.37455 0.0898
NP_442533.1_6 Forward -65 -56 1.57302 0.294
NP_441482.1_7 Reverse -110 -124 -1.8687 0.0876
NP_441482.1_7 Forward -131 -117 -8.65353 0.193
NP_439944.1_9 Forward -124 -114 15.418 0.0198
NP_439944.1_9 Reverse -117 -127 10.3048 0.0887
NP_439944.1_9 Reverse -198 -208 6.27322 0.188
NP_441028.1_6 Forward -386 -376 3.51951 0.292
NP_442202.1_6 Forward -347 -328 -0.983855 0.268
NP_440116.1_8 Forward -379 -360 -9.44032 0.278
NP_440116.1_8 Reverse -117 -136 -10.0303 0.297
NP_441527.1_4 Reverse -233 -252 -7.974 0.24
NP_440007.1_9 Forward -129 -115 13.8643 0.163
NP_440007.1_9 Reverse -107 -121 2.35953 0.281
NP_441680.1_4 Reverse -225 -244 -2.65548 0.27
NP_442562.1_10 Reverse -360 -379 12.6841 0.212
NP_441972.1_5 Forward -136 -117 -0.787193 0.169
NP_441972.1_5 Forward -238 -219 -9.73531 0.293
NP_441106.1_1 Forward -126 -117 18.191 0.0028
NP_441106.1_1 Reverse -115 -124 9.34117 0.0333
NP_439903.1_6 Reverse -113 -132 -0.29631 0.28
NP_439903.1_6 Reverse -107 -126 -0.39464 0.282
NP_442588.1_6 Reverse -309 -328 -1.08219 0.268
NP_441286.1_1 Reverse -115 -127 3.77555 0.0435
NP_441286.1_1 Forward -207 -195 1.90727 0.0767
NP_441286.1_1 Reverse -196 -208 1.21895 0.091
NP_441286.1_1 Forward -126 -114 -4.28759 0.154
NP_441286.1_1 Reverse -253 -265 -6.84419 0.283
NP_440670.1_8 Forward -125 -116 16.3227 0.00291
NP_440670.1_8 Reverse -116 -125 15.1427 0.00768
NP_440670.1_8 Forward -206 -197 13.2744 0.0157
NP_440670.1_8 Reverse -197 -206 7.37455 0.0774
NP_440670.1_8 Reverse -371 -380 3.34298 0.275
NP_441930.1_2 Reverse -299 -309 13.8447 0.236
NP_440886.1_7 Forward -126 -116 8.53436 0.0805
NP_442614.1_2 Forward -125 -111 10.6193 0.234
NP_442614.1_2 Reverse -197 -211 7.66941 0.268
NP_442614.1_2 Forward -18 -4 6.3911 0.291
NP_442382.1_9 Reverse -17 -36 9.63507 0.281
NP_442072.1_9 Forward -126 -108 -4.11075 0.041
NP_442072.1_9 Reverse -115 -133 -4.50408 0.0462
NP_442213.1_6 Reverse -291 -310 3.73603 0.29
NP_440823.1_3 Forward -302 -283 28.6138 0.00103
NP_440028.1_6 Reverse -300 -318 14.8671 0.218
NP_440907.2_8 Reverse -117 -127 7.84605 0.117
NP_440907.2_8 Forward -124 -114 7.64939 0.117
NP_441021.1_1 Reverse -117 -136 -10.522 0.24
NP_441463.1_3 Reverse -106 -125 -1.57384 0.143
NP_441463.1_3 Reverse -130 -149 -5.11376 0.22
NP_441463.1_3 Reverse -118 -137 -8.65367 0.272
NP_441626.1_2 Forward -124 -117 15.7721 0.0124
NP_441626.1_2 Reverse -117 -124 15.7721 0.0124
NP_441626.1_2 Forward -205 -198 6.0373 0.212
NP_441626.1_2 Reverse -198 -205 6.0373 0.212
NP_442211.1_3 Forward -131 -112 14.6695 0.22
NP_442211.1_3 Forward -137 -118 10.0008 0.257
NP_442362.1_7 Reverse -296 -314 13.4905 0.22
NP_442794.1_1 Forward -210 -198 19.4102 0.00716
NP_442615.1_1 Reverse -188 -206 8.37728 0.0284
NP_440387.1_1 Forward -125 -109 3.59845 0.0551
NP_441488.1_8 Forward -211 -197 8.94708 0.17
NP_442647.1_7 Forward -313 -300 6.70579 0.257
NP_441836.1_2 Reverse -227 -246 -5.60541 0.284
NP_441993.1_1 Reverse -300 -319 4.67549 0.215
NP_441174.1_2 Reverse -296 -310 12.9793 0.23
NP_440814.1_5 Forward -127 -108 5.50599 0.215
NP_440467.1_3 Forward -136 -117 11.1586 0.284
NP_440114.1_10 Forward -125 -111 7.47274 0.235
NP_442684.1_10 Forward -314 -296 17.0296 0.273
NP_442698.1_10 Reverse -377 -396 3.83436 0.279
NP_442323.1_7 Reverse -111 -130 4.71854 0.215
NP_441206.1_4 Forward -142 -123 -3.83545 0.263
NP_441510.2_7 Forward -131 -117 12.3887 0.28
NP_440287.1_6 Forward -134 -115 3.34271 0.224
NP_440766.1_4 Reverse -112 -126 8.75105 0.0871
NP_440766.1_4 Reverse -367 -381 5.50613 0.11
NP_440766.1_4 Forward -129 -115 1.47456 0.23
NP_441237.1_9 Forward -205 -195 10.5014 0.228
NP_441237.1_9 Reverse -198 -208 10.3048 0.237
NP_441311.1_2 Reverse -191 -205 11.7003 0.243
NP_439910.1_2 Reverse -108 -125 -13.7275 0.162
NP_439910.1_2 Forward -133 -116 -21.594 0.183
NP_440457.1_1 Reverse -112 -124 8.10212 0.101
NP_440457.1_1 Forward -129 -117 7.02048 0.105
NP_440457.1_1 Reverse -367 -379 3.77555 0.186
NP_440798.1_6 Forward -124 -111 10.4424 0.0754
NP_440142.1_7 Forward -107 -88 11.9958 0.2
NP_442297.1_3 Forward -241 -222 9.53674 0.249
NP_441332.1_6 Forward -382 -372 10.9691 0.278
NP_441436.1_8 Reverse -311 -330 7.57094 0.293
NP_442509.1_9 Reverse -116 -126 12.1726 0.101
NP_440524.1_2 Reverse -124 -143 1.0811 0.264
NP_442514.1_5 Forward -323 -304 -8.94939 0.292
NP_440554.1_4 Forward -124 -114 17.3846 0.0189
NP_440554.1_4 Reverse -117 -127 14.6313 0.02
NP_442862.1_4 Forward -130 -111 18.2882 0.249
NP_441885.1_5 Forward -125 -115 2.24165 0.0822
NP_441885.1_5 Reverse -197 -207 2.24165 0.0822
NP_441885.1_5 Reverse -116 -126 1.65166 0.106
NP_441885.1_5 Forward -206 -196 1.35667 0.11
NP_441428.1_8 Forward -133 -114 3.73603 0.251
NP_442341.1_7 Reverse -115 -129 1.47456 0.288
NP_442341.1_9 Reverse -114 -128 6.68548 0.217
NP_442341.1_9 Forward -127 -113 5.50552 0.267
NP_441756.1_5 Forward -312 -293 5.211 0.187
NP_441756.1_5 Forward -330 -311 1.76941 0.215
NP_442395.2_4 Forward -31 -12 3.34192 0.207
NP_443000.1_7 Forward -127 -117 8.73149 0.0437
NP_443000.1_7 Reverse -114 -124 8.4365 0.0459
NP_443000.1_7 Reverse -195 -205 0.471689 0.298
NP_440507.2_3 Reverse -266 -285 7.96345 0.263
NP_441842.1_10 Reverse -190 -204 14.7492 0.0531
NP_441842.1_10 Forward -132 -118 9.73436 0.182
NP_441842.1_10 Reverse -331 -345 8.06273 0.237
NP_440275.1_3 Reverse -114 -124 9.22315 0.055
NP_440275.1_3 Forward -127 -117 8.4365 0.0602
NP_440275.1_3 Reverse -369 -379 5.78156 0.131
NP_440275.1_3 Forward -208 -198 5.28991 0.158
NP_440275.1_3 Forward -382 -372 4.89658 0.169
NP_440091.1_1 Forward -129 -117 10.7571 0.0429
NP_440091.1_1 Reverse -112 -124 1.21895 0.204
NP_442275.1_1 Reverse -230 -249 0.392778 0.285
NP_440679.1_10 Reverse -125 -144 -12.5869 0.203
NP_442451.1_2 Forward -333 -314 -10.4236 0.269
NP_441122.1_1 Reverse -24 -39 12.3696 0.179
NP_439962.1_4 Reverse -363 -382 -2.36049 0.226
NP_439962.1_4 Forward -316 -297 -8.26035 0.292
NP_442495.1_4 Forward -304 -294 10.9931 0.295
NP_441105.1_3 Reverse -288 -307 -1.18052 0.147
NP_441105.1_3 Forward -136 -117 -2.26216 0.159
NP_441105.1_3 Forward -217 -198 -6.58872 0.236
NP_441105.1_3 Reverse -51 -70 -9.83364 0.297
NP_440216.1_1 Forward -125 -111 6.6861 0.0139
NP_440216.1_1 Reverse -116 -130 -1.5737 0.034
NP_440216.1_1 Forward -206 -192 -10.9151 0.153
NP_440216.1_6 Forward -132 -116 6.05672 0.189
NP_440216.1_9 Forward -231 -222 12.7828 0.223
NP_440216.1_9 Forward -63 -54 8.25953 0.286
NP_440216.1_9 Forward -35 -26 5.3096 0.298
NP_440172.1_1 Forward -125 -115 10.9931 0.0445
NP_442015.1_10 Forward -210 -197 12.6056 0.0365
NP_442015.1_10 Reverse -112 -125 3.75586 0.178
NP_442015.1_10 Forward -129 -116 0.904263 0.216
NP_441226.1_7 Forward -124 -117 14.4934 0.0123
NP_441226.1_7 Reverse -117 -124 14.4934 0.0123
NP_441226.1_7 Reverse -372 -379 10.0685 0.103
NP_441226.1_7 Forward -131 -124 9.47853 0.147
NP_441111.1_7 Reverse -117 -125 18.7023 0.00294
NP_441111.1_7 Forward -205 -197 8.96754 0.0463
NP_441111.1_7 Forward -124 -116 8.96754 0.0463
NP_442379.1_10 Reverse -109 -126 1.02215 0.223
NP_441766.1_2 Reverse -116 -125 16.2243 0.0047
NP_441766.1_2 Forward -125 -116 9.14451 0.0337
NP_441766.1_2 Forward -206 -197 6.5879 0.0918
NP_441766.1_9 Reverse -84 -103 10.4225 0.144
NP_442417.1_5 Forward -125 -111 5.89945 0.244
NP_440416.1_9 Forward -250 -231 -9.53865 0.133
NP_440416.1_9 Reverse -82 -101 -11.6036 0.152
NP_440416.1_9 Forward -132 -113 -16.0285 0.206
NP_440416.1_9 Reverse -109 -128 -16.0285 0.206
NP_440416.1_9 Reverse -121 -140 -17.5035 0.241
NP_440416.1_9 Reverse -223 -242 -18.6834 0.262
NP_440416.1_9 Reverse -190 -209 -20.0601 0.281
NP_440416.1_9 Reverse -55 -74 -20.4534 0.285
NP_443052.1_9 Forward -142 -123 -0.885524 0.218
NP_442403.1_9 Reverse -326 -345 12.6841 0.148
NP_442154.1_1 Reverse -300 -318 -17.1888 0.249
NP_440261.1_5 Reverse -117 -130 -10.5021 0.201
NP_440261.1_5 Forward -124 -111 -10.9938 0.23
NP_440261.1_5 Reverse -255 -268 -12.3704 0.284
NP_440988.1_10 Forward -133 -119 5.38289 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCCTTTTTGGTCTTTACCTCCGACCGCAACGGGACCCAGGGAATTTATCTATACAATCTCCAAAATAACCGCCTGGAAACCCTGCCCCGCCTCAATGCCCTGGACCAGGTGGCCAGTCATCCCACCATTACTGAGGACGGACGCTATATTGTCTTTGCCCTCAGTCGCCAAGGGAAGACTGACATTGTCCTTTACGATCGCCAAACGGAACAAAAGCGTAATTTAACCGCTGATTTAGCCGCCGACACTAGAAATCCCGTCATCAATGCCAACGGCGATCGCATTGCGTTTGAAGTGGCCCAGGACGGCCAGTGGGACATTATGGTAATGGATGCCCAGGGCAAAATTATTACTACCCCTTAACAATTGCAAAACTCCTGGGCCAAGAGAATTAGAAT

CDS

ATGACCAAAGTGCTAACACCAATGAAACCTATTTCCTTTCCCCTATGGTTGACTCTCTGCTTTGGTGCGGTTGCATGCACTGCAATTAAAGAACTGCCCCCGGTGCAGGCCGAGCCGATGGAAGCGAATTTGCCCACAGTTGCCACCATCACAGAGTTGGTCAATGGAGATTTAGCTTGTTATGTGGACTTGATGGACAGTCAAGGTAATCAGTATCAGGGGCTATACGCCGCCTTTGAAATTTGCGAACAGGTTGCCCTGATTGGCCAAAAGGTCAAACTCACCTATCAACCCTTATCCTTTAACGATTGCCAGAGTAGTGAGCCCTGCGGTAAAAGTAAGACCGAGTTGGCGATCGTCCAGATTGAACCATGGGAAAACTAA

Protein

MTKVLTPMKPISFPLWLTLCFGAVACTAIKELPPVQAEPMEANLPTVATITELVNGDLACYVDLMDSQGNQYQGLYAAFEICEQVALIGQKVKLTYQPLSFNDCQSSEPCGKSKTELAIVQIEPWEN