Your browser is old and dusty. Try Google Chrome!

Details for slr0195

ORF slr0195
Accession NP_442344.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -334 -320 8.75105 0.0846
NP_440557.1_1 Reverse -152 -171 0.294447 0.265
NP_440557.1_1 Forward -334 -315 -0.0988766 0.265
NP_440694.1_6 Forward -189 -170 5.211 0.255
NP_443041.1_1 Forward -278 -259 7.17762 0.0674
NP_440561.1_8 Reverse -180 -199 7.47261 0.282
NP_440120.1_4 Forward -386 -372 14.2576 0.273
NP_443027.1_4 Reverse -191 -201 6.76487 0.269
NP_441812.1_3 Forward -364 -350 8.06273 0.254
NP_442975.1_10 Reverse -109 -123 7.27547 0.138
NP_440061.1_9 Reverse -384 -398 5.21053 0.293
NP_441900.1_2 Reverse -382 -400 -1.84987 0.273
NP_441995.1_8 Forward -176 -159 17.6401 0.147
NP_440304.1_4 Forward -228 -218 2.63497 0.299
NP_441781.1_7 Forward -197 -178 -3.44213 0.296
NP_439918.1_2 Forward -113 -94 -3.24547 0.251
NP_442196.1_8 Forward -190 -171 19.764 0.171
NP_442726.1_4 Forward -102 -83 24.3855 0.0123
NP_439957.1_6 Reverse -44 -63 16.8141 0.0845
NP_440645.1_4 Reverse -218 -237 8.16093 0.253
NP_441558.1_5 Reverse -233 -252 5.60432 0.245
NP_442889.1_8 Forward -200 -186 3.14559 0.287
NP_441025.1_5 Reverse -380 -394 16.0275 0.257
NP_441327.1_1 Reverse -88 -107 4.11727 0.274
NP_440343.1_9 Reverse -178 -197 17.3057 0.139
NP_441486.1_1 Forward -332 -318 -3.24533 0.177
NP_443018.1_3 Forward -328 -321 9.38056 0.128
NP_441634.1_8 Forward -400 -386 -4.03198 0.295
NP_440376.1_1 Reverse -73 -82 1.96635 0.236
NP_442730.1_8 Forward -331 -312 10.9134 0.185
NP_442485.1_3 Reverse -231 -250 -4.42544 0.28
NP_440667.1_2 Forward -119 -100 -8.35868 0.289
NP_441950.1_7 Forward -128 -109 -7.4737 0.278
NP_440141.1_3 Reverse -327 -346 0.982764 0.274
NP_440141.1_8 Reverse -311 -330 5.211 0.277
NP_442782.1_1 Reverse -189 -208 17.9932 0.296
NP_442496.1_5 Reverse -312 -330 5.82068 0.285
NP_442205.1_9 Forward -341 -325 2.8118 0.203
NP_441414.1_9 Reverse -113 -132 -4.6221 0.158
NP_440800.1_2 Forward -300 -281 16.1877 0.15
NP_441127.1_1 Reverse -320 -334 8.25939 0.3
NP_440203.1_5 Forward -332 -322 11.5826 0.185
NP_440934.1_2 Forward -87 -68 1.0811 0.277
NP_440827.1_3 Reverse -309 -328 10.3242 0.299
NP_442853.1_5 Reverse -240 -259 7.37347 0.281
NP_442438.1_10 Forward -121 -107 -1.08205 0.291
NP_440879.1_6 Reverse -324 -343 -3.44213 0.279
NP_440147.1_4 Forward -162 -149 3.65753 0.183
NP_441041.1_4 Reverse -29 -48 -12.9802 0.278
NP_441041.1_4 Reverse -182 -201 -13.8652 0.297
NP_442004.1_6 Forward -335 -321 2.16287 0.273
NP_441725.1_4 Reverse -359 -373 14.1586 0.0693
NP_441725.1_5 Forward -328 -318 -0.609952 0.265
NP_440260.1_8 Reverse -244 -262 -6.1757 0.287
NP_442281.1_1 Forward -165 -151 4.32555 0.199
NP_001035871.2_2 Forward -297 -278 16.4947 0.296
NP_442012.1_1 Reverse -145 -164 0.392778 0.241
NP_440723.1_4 Reverse -148 -167 -11.4069 0.298
NP_442068.1_4 Reverse -380 -399 4.22689 0.296
NP_442215.1_2 Forward -241 -225 -1.41643 0.185
NP_442215.1_2 Reverse -227 -243 -3.8747 0.223
NP_442215.1_2 Reverse -252 -268 -5.93965 0.262
NP_442554.1_8 Reverse -321 -331 8.04317 0.0801
NP_442554.1_8 Forward -328 -318 2.83163 0.253
NP_442292.1_5 Forward -99 -80 -1.96717 0.273
NP_441448.1_1 Forward -379 -360 5.30933 0.261
NP_441015.1_10 Forward -400 -381 -11.6036 0.298
NP_441612.1_2 Forward -173 -163 7.19391 0.26
NP_442227.1_2 Reverse -112 -131 1.0811 0.25
NP_442808.1_1 Forward -83 -73 2.33954 0.27
NP_440145.1_4 Forward -159 -149 14.4342 0.241
NP_442718.1_2 Reverse -188 -207 -2.0655 0.266
NP_440334.1_2 Forward -14 -1 14.8673 0.226
NP_440558.1_2 Forward -200 -181 10.8159 0.0935
NP_440558.1_2 Reverse -220 -239 -0.39387 0.203
NP_441518.1_3 Reverse -97 -116 -15.5368 0.296
NP_441878.1_6 Reverse -319 -329 0.766681 0.134
NP_441878.1_6 Reverse -72 -82 -7.29646 0.217
NP_440101.1_3 Forward -340 -321 4.916 0.207
NP_441549.1_9 Forward -333 -315 -10.5023 0.279
NP_442347.1_2 Forward -334 -325 8.1612 0.108
NP_442594.1_8 Forward -400 -381 9.93088 0.185
NP_442594.1_8 Reverse -32 -51 4.71934 0.259
NP_441633.1_3 Forward -162 -149 -7.15888 0.294
NP_442998.1_5 Forward -174 -164 11.1898 0.191
NP_442998.1_5 Forward -372 -362 9.81313 0.233
NP_442334.1_2 Forward -392 -375 -7.33598 0.289
NP_442333.2_1 Forward -199 -180 -2.75381 0.198
NP_440256.1_1 Forward -189 -170 -8.06369 0.251
NP_441559.1_8 Forward -339 -325 -7.76856 0.299
NP_442866.1_1 Forward -340 -321 -5.80207 0.245
NP_440702.1_2 Forward -400 -381 -2.95047 0.257
NP_440026.1_7 Reverse -68 -83 20.6294 0.0824
NP_440306.1_4 Forward -88 -69 7.86593 0.299
NP_441494.1_6 Forward -340 -327 8.57408 0.23
NP_442386.1_9 Forward -83 -74 9.43907 0.161
NP_442386.1_9 Forward -330 -321 5.21086 0.262
NP_440570.1_5 Reverse -64 -83 5.60432 0.191
NP_442791.1_5 Reverse -225 -244 -7.96535 0.279
NP_440327.1_6 Forward -113 -94 15.1424 0.13
NP_441232.1_10 Reverse -177 -196 7.7676 0.142
NP_439937.1_9 Reverse -110 -127 -15.4981 0.287
NP_440316.1_10 Reverse -319 -329 8.1415 0.24
NP_441803.1_2 Forward -328 -309 2.65439 0.206
NP_439977.1_5 Reverse -40 -59 1.0811 0.196
NP_442384.1_10 Forward -335 -322 4.73917 0.148
NP_442262.1_10 Forward -328 -321 9.47889 0.187
NP_440344.1_10 Reverse -106 -123 -1.63279 0.0557
NP_441640.1_8 Forward -244 -225 4.12936 0.124
NP_440297.1_9 Forward -328 -318 9.22315 0.0917
NP_440297.1_9 Reverse -321 -331 -0.118297 0.282
NP_440888.1_2 Forward -335 -321 8.55376 0.156
NP_441304.1_10 Forward -98 -89 14.7494 0.164
NP_441551.1_5 Forward -248 -232 6.15437 0.281
NP_442710.1_7 Forward -171 -152 -8.37606 0.299
NP_441469.1_4 Forward -398 -379 7.66927 0.282
NP_441469.1_8 Forward -83 -74 5.21127 0.283
NP_442315.1_2 Forward -126 -114 10.8554 0.291
NP_440071.1_6 Forward -125 -111 15.1623 0.241
NP_443062.1_1 Forward -202 -184 5.5232 0.227
NP_442872.1_1 Reverse -93 -112 -6.58872 0.241
NP_442768.1_6 Forward -340 -321 18.289 0.234
NP_442823.1_9 Reverse -363 -382 14.9589 0.239
NP_440603.1_9 Reverse -165 -184 7.86593 0.217
NP_440673.1_7 Reverse -231 -250 4.71934 0.185
NP_441052.1_2 Reverse -113 -123 5.87989 0.0998
NP_442219.1_9 Forward -334 -325 1.76968 0.298
NP_442086.1_6 Forward -389 -370 10.6192 0.255
NP_440314.1_9 Reverse -49 -68 -9.93197 0.281
NP_441363.1_1 Reverse -163 -182 12.0942 0.164
NP_439949.1_7 Forward -98 -84 15.9292 0.18
NP_440328.1_4 Reverse -380 -399 2.16274 0.209
NP_441228.1_7 Reverse -378 -396 17.3823 0.296
NP_442430.1_2 Forward -333 -314 2.3594 0.268
NP_441851.1_9 Reverse -226 -245 6.78429 0.291
NP_442208.1_5 Forward -397 -378 -6.58872 0.266
NP_441668.1_4 Reverse -220 -239 4.71934 0.173
NP_441668.1_4 Forward -111 -92 -0.000545616 0.248
NP_442515.1_1 Reverse -385 -399 0.0979218 0.203
NP_441396.1_5 Forward -127 -118 16.8143 0.199
NP_441396.1_5 Forward -103 -94 8.35786 0.224
NP_441683.1_5 Reverse -78 -97 12.0942 0.171
NP_440593.1_3 Forward -243 -224 3.14605 0.162
NP_440593.1_3 Forward -165 -146 0.58944 0.194
NP_441046.1_2 Forward -382 -363 1.47442 0.256
NP_441046.1_2 Forward -96 -77 -0.4922 0.281
NP_442843.1_1 Forward -301 -282 -11.5053 0.291
NP_442168.1_6 Forward -366 -347 9.53756 0.23
NP_442006.1_2 Forward -188 -171 -16.0874 0.238
NP_442038.1_1 Forward -379 -360 0.884433 0.278
NP_440526.1_3 Forward -159 -148 4.67974 0.267
NP_441432.1_8 Reverse -187 -196 5.21127 0.185
NP_441432.1_8 Reverse -325 -334 5.01461 0.191
NP_443024.1_3 Forward -371 -361 13.943 0.277
NP_442344.1_1 Forward -392 -373 16.6174 0.0817
NP_442344.1_10 Forward -256 -237 17.3057 0.23
NP_440313.1_5 Forward -329 -311 14.3747 0.214
NP_442353.1_4 Reverse -380 -399 3.63691 0.213
NP_442353.1_4 Forward -244 -225 -0.689632 0.29
NP_442400.1_10 Reverse -200 -213 8.94252 0.278
NP_440363.1_9 Forward -226 -208 13.4905 0.249
NP_441040.1_2 Forward -346 -327 -15.2418 0.286
NP_440708.1_6 Reverse -64 -83 -8.65367 0.258
NP_442346.1_5 Reverse -187 -197 7.45319 0.169
NP_442346.1_5 Reverse -319 -329 5.5849 0.238
NP_440352.1_5 Forward -393 -374 14.6998 0.139
NP_440555.1_7 Forward -193 -174 21.3373 0.0859
NP_442875.1_8 Forward -217 -198 10.7175 0.264
NP_441585.1_5 Reverse -238 -257 3.63691 0.255
NP_441502.1_3 Forward -124 -105 10.6192 0.21
NP_441044.1_4 Forward -256 -238 7.68896 0.223
NP_440594.1_6 Reverse -107 -126 4.42355 0.3
NP_441239.1_9 Forward -331 -319 6.72548 0.178
NP_440624.1_6 Reverse -279 -297 12.8997 0.057
NP_440665.1_1 Forward -191 -172 -14.8485 0.264
NP_442270.1_9 Reverse -225 -244 -11.9969 0.285
NP_442052.1_3 Reverse -181 -200 8.94757 0.284
NP_440546.1_4 Forward -269 -259 6.65249 0.288
NP_441474.1_1 Forward -54 -35 -1.8696 0.267
NP_442402.1_4 Reverse -377 -396 -2.36125 0.198
NP_442402.1_4 Reverse -356 -375 -6.19614 0.253
NP_441848.1_4 Forward -102 -86 7.83714 0.288
NP_441848.1_7 Reverse -246 -265 1.27698 0.228
NP_441084.1_6 Forward -169 -155 10.2167 0.25
NP_441811.1_8 Forward -341 -327 11.3077 0.218
NP_440160.1_2 Forward -83 -64 -8.65367 0.286
NP_440160.1_7 Forward -197 -178 10.6192 0.297
NP_440505.1_3 Forward -124 -114 11.2881 0.0803
NP_440505.1_7 Reverse -69 -88 0.294447 0.259
NP_442532.1_7 Reverse -188 -202 1.57289 0.279
NP_442533.1_6 Forward -329 -320 3.7363 0.204
NP_442541.1_10 Forward -197 -183 5.50552 0.248
NP_442232.1_5 Reverse -149 -168 15.2408 0.133
NP_443016.1_1 Reverse -374 -393 -8.06369 0.289
NP_441482.1_7 Reverse -314 -328 -11.9968 0.288
NP_441028.1_6 Reverse -255 -265 7.94438 0.217
NP_441972.1_5 Forward -237 -218 -1.27885 0.177
NP_441106.1_1 Reverse -34 -43 2.26134 0.293
NP_439903.1_6 Forward -47 -28 2.6536 0.222
NP_439903.1_6 Forward -338 -319 2.45694 0.226
NP_441286.1_1 Forward -330 -318 -6.74586 0.278
NP_440092.1_9 Forward -315 -296 13.7658 0.292
NP_440886.1_7 Reverse -112 -122 13.5492 0.0711
NP_442614.1_2 Reverse -320 -334 10.7177 0.234
NP_442072.1_1 Forward -166 -148 10.0489 0.231
NP_442072.1_9 Reverse -150 -168 -22.892 0.266
NP_440028.1_6 Forward -130 -112 12.5072 0.24
NP_441808.1_8 Forward -341 -322 7.57094 0.277
NP_442264.1_2 Forward -339 -322 7.90532 0.225
NP_442264.1_2 Reverse -310 -327 6.72535 0.25
NP_442365.1_7 Forward -200 -181 -4.13045 0.235
NP_442238.1_1 Reverse -188 -207 1.86774 0.229
NP_442238.1_6 Reverse -188 -207 15.8819 0.156
NP_441962.1_4 Reverse -183 -202 -10.7186 0.232
NP_442020.1_1 Forward -170 -151 0.785326 0.255
NP_441836.1_2 Forward -341 -322 -5.70374 0.284
NP_440143.1_1 Forward -398 -379 12.4875 0.284
NP_441174.1_4 Forward -265 -255 9.81313 0.289
NP_440492.1_9 Forward -173 -159 16.4239 0.23
NP_440457.1_1 Reverse -316 -328 -0.354346 0.262
NP_440798.1_1 Reverse -349 -367 10.7351 0.294
NP_441801.1_4 Reverse -174 -184 3.12662 0.231
NP_442130.1_8 Forward -345 -326 9.7334 0.139
NP_440524.1_2 Reverse -337 -356 -4.52377 0.276
NP_442862.1_3 Forward -378 -361 8.7903 0.236
NP_442862.1_3 Forward -303 -286 3.97208 0.298
NP_442341.1_7 Reverse -385 -399 4.91614 0.175
NP_442341.1_7 Reverse -169 -183 2.2612 0.263
NP_440119.1_1 Reverse -59 -75 2.22182 0.223
NP_440191.1_2 Reverse -366 -385 1.47364 0.182
NP_440191.1_4 Forward -360 -350 12.7603 0.291
NP_440804.1_7 Forward -302 -285 7.80625 0.261
NP_442373.1_2 Forward -128 -109 -11.6036 0.297
NP_440216.1_9 Reverse -322 -331 5.50626 0.292
NP_440172.1_1 Reverse -326 -336 4.0116 0.208
NP_442015.1_10 Reverse -69 -82 0.215946 0.237
NP_441226.1_7 Forward -81 -74 8.29857 0.205
NP_440072.1_1 Reverse -113 -127 17.6985 0.189
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGGTGGTGGTAGACAGTGGCAAATTGGTGGATAAATTGGGTTCCACTTTTTTACTGCCGGTGGAAGTGATTCCCATGGCCCTAACTCCTGTAATGCGAGCTTTAGCTAAATTAGGTGGTAAACCAGAACTACGCATGGGGGTGAAAAAAGCTGGCCCCGTTGTCACTGACCAAGGTAACCTCGTCATTGACGTTAAATTTGATGCCATTACCAACCCAGCGGAGTTGGAAAAAACCATTAACAATCTCCCCGGTGTGTTAGAAAACGGCCTATTTGTGGGGGTAGCGGACGTAATTTTGGTAGGGGAAATTATTGACGGCCAACCCACGGTGCGGGAATTCTAGTTCTCTCTCAACTCCATCGTCTTAACTAGAGTCAAGGTGGGAAAATAGAAGGGAT

CDS

ATGGATACCCTTTCCCCCAGACTTTACCTCCAAACATTCACTAACTTGCTCAAGCGGTTTTTAACTTGGGCAGGTTTGTTGCTTTTATTGGGGGGTTGTGGCTATCCCCGTTACTTGAGTCTTTCCTTTGACCGCAGTGGCCGGGGCGTTAACAGTGCCTCCGAGGAAATTTTTCCCCAGGTCACCTATCCCTTTTTGGTCTTTACCTCCGACCGCAACGGGACCCAGGGAATTTATCTATACAATCTCCAAAATAACCGCCTGGAAACCCTGCCCCGCCTCAATGCCCTGGACCAGGTGGCCAGTCATCCCACCATTACTGAGGACGGACGCTATATTGTCTTTGCCCTCAGTCGCCAAGGGAAGACTGACATTGTCCTTTACGATCGCCAAACGGAACAAAAGCGTAATTTAACCGCTGATTTAGCCGCCGACACTAGAAATCCCGTCATCAATGCCAACGGCGATCGCATTGCGTTTGAAGTGGCCCAGGACGGCCAGTGGGACATTATGGTAATGGATGCCCAGGGCAAAATTATTACTACCCCTTAA

Protein

MDTLSPRLYLQTFTNLLKRFLTWAGLLLLLGGCGYPRYLSLSFDRSGRGVNSASEEIFPQVTYPFLVFTSDRNGTQGIYLYNLQNNRLETLPRLNALDQVASHPTITEDGRYIVFALSRQGKTDIVLYDRQTEQKRNLTADLAADTRNPVINANGDRIAFEVAQDGQWDIMVMDAQGKIITTP