Your browser is old and dusty. Try Google Chrome!

Details for slr0192

ORF slr0192
Accession NP_442341.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -169 -183 10.7177 0.0582
NP_441061.1_2 Reverse -271 -285 9.04604 0.0817
NP_441061.1_2 Forward -272 -258 5.01447 0.142
NP_441061.1_2 Forward -364 -350 -1.5737 0.265
NP_441418.1_6 Forward -365 -346 -20.945 0.133
NP_440815.1_5 Forward -56 -37 6.58763 0.273
NP_440897.1_6 Forward -365 -346 9.43841 0.0705
NP_441453.1_4 Forward -365 -357 7.09925 0.0962
NP_441453.1_4 Reverse -356 -364 6.80426 0.121
NP_441623.1_1 Reverse -175 -193 5.03403 0.177
NP_441623.1_1 Reverse -174 -192 -2.24246 0.241
NP_442151.1_6 Forward -183 -169 5.80112 0.262
NP_441818.1_9 Forward -183 -164 -1.57384 0.2
NP_441818.1_9 Forward -189 -170 -8.06369 0.274
NP_440226.1_1 Reverse -356 -375 16.4207 0.0217
NP_442287.1_1 Forward -57 -47 13.9425 0.266
NP_442173.1_1 Reverse -357 -365 5.82095 0.2
NP_442173.1_1 Forward -364 -356 5.72262 0.203
NP_442752.1_4 Reverse -356 -363 13.8055 0.0199
NP_443027.1_4 Reverse -354 -364 10.9931 0.109
NP_442975.1_10 Reverse -352 -366 3.73557 0.252
NP_440784.1_7 Reverse -357 -364 6.23397 0.241
NP_440784.1_7 Forward -364 -357 6.13563 0.241
NP_440061.1_9 Reverse -178 -192 6.19383 0.255
NP_441054.1_2 Forward -126 -107 17.404 0.109
NP_441054.1_2 Forward -199 -180 13.3725 0.203
NP_442062.1_3 Reverse -96 -115 -2.85214 0.273
NP_442062.1_8 Reverse -356 -366 16.9913 0.00317
NP_442062.1_8 Forward -365 -355 9.61647 0.0587
NP_442062.1_8 Reverse -47 -57 9.32148 0.0633
NP_441900.1_2 Reverse -45 -63 -5.38976 0.288
NP_441802.1_1 Reverse -334 -353 6.09597 0.269
NP_442268.1_9 Forward -191 -172 15.6341 0.207
NP_442242.1_4 Forward -364 -357 10.8555 0.127
NP_441781.1_7 Forward -57 -38 -3.24547 0.295
NP_439918.1_2 Forward -189 -170 -0.983855 0.236
NP_439918.1_3 Forward -198 -179 3.44104 0.266
NP_441208.1_9 Reverse -44 -58 9.2427 0.217
NP_441208.1_9 Forward -192 -178 5.21113 0.275
NP_442110.1_7 Forward -365 -351 1.57289 0.222
NP_441925.1_4 Reverse -175 -194 -16.1275 0.281
NP_441925.1_4 Reverse -183 -202 -16.7175 0.285
NP_441925.1_4 Reverse -180 -199 -17.2092 0.29
NP_440014.1_7 Reverse -347 -361 18.7801 0.119
NP_441083.1_5 Forward -365 -355 2.04498 0.195
NP_441083.1_5 Reverse -356 -366 1.84832 0.198
NP_441434.1_7 Reverse -124 -138 8.65272 0.225
NP_441738.1_2 Forward -363 -356 15.28 0.0102
NP_441558.1_5 Reverse -172 -191 6.98095 0.198
NP_441955.1_8 Reverse -350 -367 12.2319 0.199
NP_440209.1_1 Forward -365 -357 14.8674 0.012
NP_440209.1_1 Reverse -356 -364 8.57422 0.0425
NP_441713.1_1 Forward -371 -352 -12.3902 0.244
NP_440178.1_7 Forward -190 -171 -13.2752 0.133
NP_442461.1_2 Forward -111 -92 13.7658 0.237
NP_441792.1_5 Reverse -169 -185 11.6616 0.19
NP_441716.1_1 Forward -231 -217 4.91614 0.246
NP_441716.1_1 Forward -365 -351 3.44117 0.265
NP_442111.1_4 Reverse -355 -369 2.06454 0.291
NP_440906.1_5 Reverse -357 -364 6.23397 0.234
NP_440906.1_5 Forward -364 -357 6.13563 0.241
NP_440747.1_10 Forward -368 -356 7.21714 0.00643
NP_440747.1_10 Reverse -353 -365 -11.7607 0.142
NP_440747.1_10 Reverse -177 -189 -11.7607 0.142
NP_441486.1_1 Reverse -353 -367 2.16287 0.0892
NP_440944.1_2 Reverse -138 -157 -1.37718 0.259
NP_441265.1_3 Forward -371 -357 0.491246 0.248
NP_440403.1_10 Forward -192 -173 2.0644 0.282
NP_440842.1_10 Reverse -261 -275 3.93283 0.254
NP_440842.1_10 Reverse -268 -282 2.65453 0.274
NP_441695.1_8 Reverse -180 -194 11.111 0.269
NP_441014.1_5 Reverse -176 -194 9.55725 0.275
NP_441014.1_8 Reverse -175 -194 -1.37718 0.222
NP_442848.1_4 Reverse -289 -303 7.37441 0.282
NP_442848.1_5 Reverse -179 -197 16.0471 0.201
NP_443018.1_3 Reverse -357 -364 12.6255 0.0471
NP_443018.1_3 Reverse -175 -182 9.38056 0.128
NP_443018.1_3 Forward -364 -357 5.25066 0.214
NP_441634.1_8 Forward -367 -353 -3.93365 0.295
NP_440376.1_1 Reverse -47 -56 11.6028 0.0241
NP_440376.1_1 Reverse -356 -365 9.83282 0.0339
NP_440376.1_1 Forward -365 -356 9.63616 0.0385
NP_440376.1_1 Forward -189 -180 4.52295 0.156
NP_440376.1_1 Forward -177 -168 -0.196935 0.285
NP_441588.1_4 Reverse -176 -186 5.09324 0.297
NP_442687.1_7 Reverse -269 -279 9.12481 0.0994
NP_442687.1_7 Reverse -355 -365 6.76487 0.154
NP_442687.1_7 Forward -57 -47 6.27322 0.175
NP_442687.1_7 Forward -366 -356 5.97822 0.179
NP_441077.1_6 Reverse -100 -116 13.3102 0.136
NP_441077.1_6 Reverse -23 -39 3.2839 0.271
NP_441846.1_10 Reverse -31 -50 -22.715 0.264
NP_440533.1_9 Reverse -356 -375 11.5042 0.112
NP_440667.1_2 Forward -127 -108 -0.983855 0.228
NP_440667.1_10 Forward -358 -339 13.4708 0.233
NP_441950.1_7 Forward -139 -120 -0.295539 0.191
NP_441950.1_7 Forward -201 -182 -0.787193 0.191
NP_441950.1_7 Forward -195 -176 -1.18052 0.191
NP_442658.1_1 Forward -58 -48 8.73102 0.181
NP_442658.1_1 Forward -367 -357 7.45273 0.214
NP_442658.1_1 Reverse -354 -364 6.17443 0.235
NP_442782.1_2 Forward -195 -181 7.76774 0.202
NP_442782.1_2 Reverse -42 -56 4.12949 0.257
NP_442782.1_2 Reverse -169 -183 1.27789 0.281
NP_441414.1_9 Forward -365 -346 -10.9153 0.297
NP_441256.1_8 Reverse -41 -60 3.44104 0.283
NP_442937.1_5 Forward -188 -169 16.0274 0.0479
NP_442937.1_5 Reverse -8 -27 6.09597 0.288
NP_442321.1_4 Forward -66 -47 -8.65367 0.289
NP_441958.1_1 Forward -119 -100 11.791 0.295
NP_441958.1_5 Reverse -355 -365 2.83163 0.0372
NP_441958.1_5 Forward -366 -356 2.43831 0.0422
NP_440984.1_7 Forward -277 -263 5.60446 0.248
NP_441162.1_2 Reverse -190 -209 18.7798 0.261
NP_442376.1_6 Reverse -283 -302 -2.85214 0.295
NP_442690.1_1 Forward -118 -99 -15.4385 0.28
NP_442911.1_2 Reverse -346 -365 -4.52377 0.136
NP_440153.1_5 Forward -364 -350 1.67122 0.245
NP_440153.1_8 Reverse -180 -193 -3.22564 0.292
NP_441591.1_10 Forward -333 -314 4.03102 0.299
NP_443055.1_6 Reverse -181 -199 1.39504 0.231
NP_443055.1_6 Reverse -154 -172 -1.55487 0.28
NP_440827.1_3 Reverse -169 -188 12.6841 0.246
NP_441429.1_4 Reverse -336 -355 8.25844 0.269
NP_441348.1_10 Forward -185 -166 18.2296 0.278
NP_441099.1_5 Reverse -164 -183 0.786102 0.073
NP_441099.1_5 Forward -66 -47 -9.34199 0.219
NP_441099.1_5 Reverse -37 -56 -10.1286 0.243
NP_442002.1_1 Reverse -252 -270 -8.92897 0.272
NP_442002.1_9 Forward -57 -50 12.2322 0.185
NP_442002.1_9 Reverse -355 -362 10.7572 0.185
NP_442032.1_5 Forward -30 -20 17.4824 0.172
NP_440411.1_10 Forward -192 -173 11.9207 0.26
NP_441646.1_1 Forward -196 -177 11.9958 0.098
NP_441646.1_1 Forward -190 -171 3.53937 0.206
NP_442438.1_10 Reverse -351 -365 9.83269 0.0602
NP_442438.1_10 Reverse -277 -291 1.86788 0.188
NP_441473.1_3 Reverse -370 -389 3.44104 0.29
NP_441000.1_6 Reverse -355 -369 4.52282 0.0953
NP_441000.1_6 Forward -366 -352 -5.40861 0.275
NP_440605.1_4 Forward -375 -356 16.7744 0.112
NP_442771.1_1 Forward -58 -40 -4.79907 0.166
NP_440147.1_4 Reverse -354 -367 0.412608 0.255
NP_441295.1_4 Reverse -175 -194 -4.22878 0.29
NP_441916.1_7 Forward -365 -355 15.2213 0.00956
NP_441916.1_7 Reverse -356 -366 8.73149 0.042
NP_441916.1_10 Forward -315 -296 7.66927 0.188
NP_441916.1_10 Reverse -172 -191 0.687771 0.278
NP_441041.1_4 Forward -189 -170 -0.000545616 0.0918
NP_441041.1_4 Forward -183 -164 -10.6203 0.235
NP_441041.1_4 Forward -195 -176 -11.1119 0.241
NP_441041.1_4 Forward -365 -346 -13.0786 0.28
NP_441041.1_7 Forward -368 -356 4.89098 0.289
NP_441547.1_2 Forward -188 -170 17.8171 0.0911
NP_441725.1_5 Forward -364 -354 1.455 0.135
NP_439966.1_7 Forward -367 -357 15.7125 0.0138
NP_439966.1_7 Reverse -354 -364 8.73102 0.13
NP_439966.1_7 Forward -51 -41 5.09279 0.243
NP_439966.1_9 Reverse -354 -363 0.983037 0.253
NP_442941.1_3 Forward -364 -354 1.65166 0.147
NP_442941.1_3 Reverse -357 -367 1.06167 0.153
NP_440289.1_2 Reverse -353 -366 -4.50394 0.288
NP_440983.1_5 Reverse -174 -193 -6.1954 0.276
NP_440983.1_5 Reverse -169 -188 -9.14533 0.3
NP_440260.1_8 Reverse -282 -300 15.1621 0.0902
NP_440260.1_8 Forward -192 -174 7.29564 0.154
NP_440260.1_8 Forward -288 -270 -3.02911 0.246
NP_440260.1_8 Forward -193 -175 -3.81576 0.257
NP_442281.1_1 Reverse -351 -365 6.88214 0.113
NP_442281.1_1 Forward -370 -356 2.26061 0.272
NP_442012.1_1 Reverse -41 -60 1.86774 0.21
NP_442012.1_1 Forward -63 -44 1.0811 0.224
NP_442012.1_5 Forward -196 -177 1.0811 0.277
NP_441457.1_7 Forward -58 -39 -1.08219 0.293
NP_440498.1_1 Reverse -347 -365 1.69077 0.204
NP_440498.1_1 Forward -374 -356 -1.84914 0.232
NP_442982.1_5 Reverse -346 -365 -2.95047 0.289
NP_441644.1_6 Reverse -174 -184 10.9926 0.058
NP_442029.1_6 Forward -340 -321 2.94938 0.286
NP_440253.1_2 Reverse -356 -374 0.609134 0.181
NP_440253.1_2 Reverse -212 -230 -3.02911 0.284
NP_440929.1_8 Forward -365 -356 9.63616 0.0262
NP_440929.1_8 Reverse -356 -365 9.53783 0.0296
NP_442933.1_10 Forward -365 -356 15.1427 0.00958
NP_442933.1_10 Reverse -356 -365 7.96454 0.0937
NP_442933.1_10 Reverse -216 -225 6.29291 0.128
NP_440430.1_6 Reverse -325 -343 17.9835 0.209
NP_441751.2_8 Forward -55 -41 -5.40861 0.206
NP_442554.1_4 Forward -65 -46 14.1591 0.148
NP_442554.1_8 Forward -182 -172 5.09324 0.161
NP_442554.1_8 Reverse -357 -367 4.69992 0.176
NP_442554.1_8 Forward -364 -354 4.0116 0.2
NP_442554.1_8 Reverse -175 -185 3.32329 0.23
NP_441762.1_7 Reverse -355 -367 2.39892 0.0676
NP_441762.1_7 Forward -366 -354 2.20226 0.0676
NP_442142.1_4 Forward -368 -355 9.16348 0.101
NP_442142.1_4 Reverse -353 -366 6.50855 0.163
NP_442142.1_4 Reverse -171 -184 5.52525 0.188
NP_442292.1_1 Reverse -357 -366 -0.0986038 0.239
NP_442292.1_1 Forward -364 -355 -0.196935 0.239
NP_440895.1_8 Forward -192 -178 14.0609 0.269
NP_442381.1_8 Reverse -353 -372 -13.7669 0.279
NP_441523.1_6 Reverse -352 -371 8.65258 0.188
NP_443009.1_5 Forward -57 -46 6.25303 0.169
NP_442406.1_9 Reverse -269 -288 0.884433 0.277
NP_442301.1_2 Reverse -176 -195 3.63691 0.292
NP_442408.2_1 Forward -365 -346 2.55606 0.165
NP_441715.1_4 Reverse -357 -367 9.12481 0.103
NP_441715.1_4 Forward -364 -354 6.46988 0.143
NP_441715.1_9 Reverse -169 -183 17.6992 0.261
NP_441448.1_2 Forward -239 -220 11.0117 0.0815
NP_440379.1_5 Reverse -165 -184 -4.81876 0.217
NP_441468.1_1 Reverse -357 -364 6.13563 0.209
NP_441468.1_1 Forward -364 -357 6.0373 0.223
NP_441020.2_6 Reverse -261 -278 7.512 0.229
NP_441015.1_10 Reverse -169 -188 -6.29373 0.245
NP_441015.1_10 Forward -194 -175 -8.26035 0.272
NP_441015.1_10 Forward -188 -169 -8.45701 0.273
NP_441673.1_1 Reverse -356 -365 11.1111 0.0121
NP_441673.1_1 Forward -365 -356 11.0128 0.018
NP_441826.1_2 Reverse -350 -364 2.2612 0.132
NP_441826.1_2 Reverse -174 -188 -3.44199 0.285
NP_441764.1_8 Reverse -336 -346 12.842 0.284
NP_442868.1_6 Forward -58 -48 2.33998 0.205
NP_442868.1_6 Forward -367 -357 0.471689 0.226
NP_441056.1_1 Reverse -168 -187 -7.4737 0.272
NP_442361.1_3 Reverse -350 -363 10.7374 0.272
NP_441911.1_7 Forward -34 -15 -9.83437 0.201
NP_441911.1_10 Reverse -95 -114 15.5003 0.148
NP_442808.1_1 Forward -366 -356 17.1874 0.00769
NP_442808.1_1 Reverse -355 -365 8.73102 0.0481
NP_442808.1_1 Reverse -179 -189 3.22451 0.247
NP_442808.1_1 Forward -247 -237 1.45457 0.285
NP_442808.1_1 Reverse -124 -134 1.06124 0.296
NP_441101.1_10 Reverse -176 -195 -6.58872 0.29
NP_442542.1_2 Forward -191 -178 10.5407 0.126
NP_442542.1_9 Reverse -349 -363 18.6818 0.0309
NP_442050.1_1 Forward -196 -177 8.35759 0.251
NP_442050.1_1 Reverse -264 -283 6.09597 0.299
NP_442050.1_5 Reverse -199 -209 8.14104 0.241
NP_440558.1_2 Reverse -177 -196 -1.57384 0.215
NP_440558.1_2 Reverse -171 -190 -3.24547 0.234
NP_440111.2_2 Forward -142 -123 -3.44213 0.265
NP_441878.1_6 Forward -190 -180 3.02829 0.0304
NP_441878.1_6 Reverse -355 -365 0.668351 0.139
NP_441878.1_6 Forward -366 -356 0.57002 0.14
NP_441878.1_6 Reverse -46 -56 -6.70647 0.194
NP_441036.1_8 Reverse -355 -365 16.6963 0.00366
NP_441036.1_8 Forward -179 -169 11.1898 0.133
NP_441036.1_8 Forward -366 -356 8.4365 0.174
NP_441557.1_5 Reverse -356 -365 10.2261 0.0144
NP_441557.1_5 Forward -365 -356 10.1278 0.0188
NP_441590.1_4 Reverse -182 -201 12.6833 0.227
NP_441590.1_4 Reverse -181 -200 12.6833 0.227
NP_441590.1_4 Reverse -170 -189 4.71854 0.279
NP_442066.2_9 Reverse -118 -131 12.409 0.154
NP_442579.1_9 Reverse -163 -182 0.687771 0.281
NP_441914.1_2 Reverse -172 -190 14.7688 0.236
NP_440101.1_3 Forward -194 -175 11.1109 0.108
NP_440101.1_10 Forward -189 -170 6.88262 0.195
NP_441574.1_1 Forward -195 -176 11.4058 0.109
NP_441549.1_9 Reverse -176 -194 -4.60241 0.198
NP_440414.1_6 Forward -210 -191 13.2741 0.184
NP_441467.1_5 Reverse -335 -345 17.9746 0.199
NP_442347.1_2 Forward -364 -355 10.9145 0.0571
NP_441037.1_4 Forward -58 -48 6.05075 0.283
NP_440151.1_5 Reverse -280 -299 10.7175 0.178
NP_441633.1_3 Forward -367 -354 3.16588 0.0738
NP_441633.1_3 Reverse -354 -367 -6.07724 0.236
NP_441633.1_3 Reverse -120 -133 -6.47056 0.253
NP_440136.1_2 Reverse -357 -364 6.23397 0.171
NP_440136.1_2 Forward -364 -357 6.13563 0.193
NP_442590.1_10 Forward -202 -183 4.81767 0.27
NP_442998.1_5 Forward -58 -48 8.23984 0.267
NP_442998.1_10 Forward -363 -356 15.5754 0.0102
NP_442998.1_10 Reverse -358 -365 5.84064 0.235
NP_440899.1_1 Forward -194 -175 6.35801 0.283
NP_440299.1_1 Reverse -352 -365 13.9817 0.0271
NP_440299.1_1 Reverse -176 -189 8.86849 0.0835
NP_441799.1_1 Forward -369 -355 4.71887 0.238
NP_440640.1_6 Reverse -30 -49 4.71934 0.212
NP_442334.1_2 Forward -193 -176 -14.3175 0.3
NP_440256.1_1 Forward -368 -349 2.26107 0.0663
NP_440256.1_1 Forward -213 -194 -8.752 0.266
NP_441559.1_3 Reverse -185 -204 18.2882 0.242
NP_441559.1_8 Forward -370 -356 2.45787 0.143
NP_441559.1_8 Reverse -351 -365 -7.2769 0.289
NP_440915.1_6 Forward -60 -46 0.786239 0.153
NP_440915.1_6 Forward -187 -173 0.392915 0.165
NP_440915.1_6 Reverse -43 -57 -1.18038 0.224
NP_442855.1_3 Forward -180 -161 16.7157 0.149
NP_441866.1_4 Forward -115 -102 14.2175 0.273
NP_440243.1_1 Forward -117 -98 18.2863 0.199
NP_440748.1_5 Reverse -165 -184 1.86774 0.224
NP_441464.1_1 Forward -55 -36 6.98095 0.273
NP_441464.1_8 Reverse -180 -194 8.84938 0.194
NP_441464.1_10 Forward -200 -186 10.0294 0.262
NP_440702.1_2 Reverse -220 -239 -4.91709 0.257
NP_440702.1_2 Forward -210 -191 -8.16202 0.287
NP_441494.1_6 Reverse -271 -284 5.72248 0.294
NP_442993.1_1 Reverse -356 -372 -7.61128 0.146
NP_442993.1_1 Reverse -42 -58 -11.7412 0.257
NP_442386.1_9 Forward -366 -357 5.9975 0.23
NP_442386.1_9 Reverse -355 -364 5.9975 0.23
NP_440570.1_5 Reverse -170 -189 14.1591 0.111
NP_441750.1_1 Forward -189 -170 -6.09707 0.224
NP_441340.1_5 Reverse -357 -364 6.23397 0.132
NP_441340.1_5 Forward -364 -357 5.84064 0.208
NP_440168.1_4 Reverse -170 -189 5.01433 0.185
NP_440327.1_6 Forward -189 -170 8.45592 0.221
NP_440327.1_6 Forward -208 -189 3.6377 0.282
NP_440327.1_8 Forward -189 -170 14.2574 0.299
NP_439976.1_5 Forward -115 -101 21.0417 0.225
NP_440586.1_1 Forward -199 -180 4.62101 0.202
NP_440586.1_8 Reverse -357 -364 14.69 0.026
NP_442251.1_6 Forward -364 -357 12.0355 0.0627
NP_441262.1_3 Reverse -356 -363 14.7888 0.0223
NP_440027.1_3 Reverse -174 -192 12.703 0.156
NP_440027.1_3 Reverse -180 -198 7.98318 0.2
NP_440027.1_3 Forward -301 -283 4.24662 0.262
NP_443051.1_1 Reverse -355 -364 0.884706 0.125
NP_443051.1_1 Forward -366 -357 0.589713 0.143
NP_439937.1_9 Reverse -46 -63 -0.846829 0.122
NP_439937.1_9 Reverse -45 -62 -10.2866 0.227
NP_443039.1_7 Reverse -320 -334 3.93223 0.278
NP_440439.1_1 Reverse -353 -366 8.37742 0.0537
NP_440439.1_1 Forward -368 -355 7.88576 0.0582
NP_439943.1_1 Forward -189 -170 -3.73712 0.202
NP_439943.1_1 Reverse -286 -305 -6.58872 0.237
NP_440372.1_2 Reverse -357 -364 6.82395 0.0854
NP_440372.1_2 Forward -364 -357 6.52896 0.188
NP_440574.1_2 Reverse -169 -188 8.25926 0.242
NP_441789.1_7 Reverse -191 -210 -4.52452 0.283
NP_440819.1_4 Reverse -202 -221 17.8957 0.0581
NP_440316.1_10 Forward -184 -174 8.73149 0.239
NP_440316.1_10 Reverse -276 -286 6.27322 0.264
NP_441803.1_2 Reverse -175 -194 -0.000545616 0.263
NP_439977.1_5 Reverse -168 -187 -3.24547 0.298
NP_442384.1_10 Forward -365 -352 7.78743 0.0743
NP_442384.1_10 Reverse -356 -369 0.510939 0.289
NP_441018.1_7 Forward -200 -181 9.0459 0.236
NP_441018.1_7 Forward -199 -180 7.66927 0.268
NP_441018.1_7 Reverse -281 -300 6.98095 0.278
NP_442790.1_4 Forward -192 -173 -14.5535 0.278
NP_442262.1_10 Reverse -357 -364 12.9205 0.0422
NP_442262.1_10 Reverse -175 -182 9.47889 0.187
NP_441689.1_5 Reverse -199 -209 5.28945 0.273
NP_442244.1_3 Forward -362 -343 9.43923 0.148
NP_440344.1_10 Reverse -349 -366 -8.90928 0.135
NP_440282.1_10 Reverse -176 -195 -2.16383 0.225
NP_440487.1_1 Forward -368 -349 6.19431 0.102
NP_441965.1_10 Reverse -353 -369 6.54838 0.171
NP_440297.1_9 Forward -364 -354 -0.511621 0.289
NP_441896.1_3 Forward -374 -355 2.85105 0.183
NP_440894.1_10 Forward -370 -351 7.96426 0.188
NP_440894.1_10 Forward -61 -42 2.65439 0.286
NP_441679.1_5 Forward -196 -177 12.5858 0.125
NP_440999.1_2 Forward -67 -48 11.6025 0.211
NP_440888.1_2 Forward -365 -351 10.0287 0.107
NP_440888.1_2 Forward -286 -272 5.80051 0.262
NP_440888.1_2 Reverse -47 -61 5.70218 0.267
NP_441345.1_8 Forward -289 -270 13.6675 0.26
NP_440052.1_5 Forward -346 -327 -4.22878 0.25
NP_440575.1_1 Forward -37 -18 -2.55791 0.294
NP_441543.1_2 Reverse -357 -366 16.6177 0.00485
NP_441543.1_2 Forward -364 -355 8.65285 0.0968
NP_442845.1_2 Forward -189 -175 16.4209 0.0636
NP_442845.1_2 Forward -279 -265 8.75105 0.187
NP_442845.1_2 Forward -178 -164 4.62115 0.256
NP_442845.1_2 Forward -365 -351 4.03116 0.271
NP_441319.1_8 Reverse -174 -192 6.50899 0.27
NP_441469.1_8 Forward -286 -277 9.73449 0.227
NP_441469.1_8 Reverse -355 -364 6.39124 0.227
NP_441469.1_8 Forward -366 -357 6.29291 0.227
NP_442578.1_7 Reverse -357 -364 14.6904 0.026
NP_441462.1_2 Reverse -356 -366 2.24165 0.0801
NP_441462.1_2 Forward -365 -355 1.74999 0.0811
NP_441621.1_7 Reverse -354 -368 -3.54032 0.19
NP_441929.1_6 Reverse -95 -114 8.65258 0.264
NP_441601.1_4 Reverse -349 -368 -2.65548 0.293
NP_440889.1_4 Reverse -128 -147 17.7974 0.0342
NP_442204.1_1 Reverse -352 -363 7.92515 0.108
NP_442204.1_1 Forward -369 -358 -0.236322 0.289
NP_442204.1_5 Reverse -346 -365 15.0441 0.0486
NP_440544.1_5 Forward -29 -22 14.5681 0.264
NP_441351.1_8 Reverse -172 -191 6.68596 0.202
NP_440516.1_2 Forward -371 -353 6.11567 0.122
NP_440516.1_6 Forward -50 -36 9.24208 0.238
NP_440516.1_8 Reverse -356 -365 8.45619 0.0364
NP_440516.1_8 Forward -365 -356 7.37455 0.0648
NP_440516.1_8 Forward -183 -174 -0.590259 0.283
NP_442428.1_4 Forward -190 -171 9.93088 0.158
NP_442428.1_5 Reverse -357 -364 6.13563 0.209
NP_442428.1_5 Forward -364 -357 6.0373 0.212
NP_440618.1_1 Reverse -265 -284 -10.3253 0.297
NP_442120.1_7 Reverse -169 -188 6.98095 0.1
NP_442120.1_10 Forward -195 -176 -0.885524 0.167
NP_440673.1_3 Forward -363 -356 12.4288 0.0426
NP_440673.1_7 Reverse -345 -364 1.37609 0.251
NP_441052.1_2 Reverse -356 -366 7.15819 0.0797
NP_441052.1_2 Reverse -174 -184 4.50326 0.157
NP_441052.1_2 Forward -189 -179 4.0116 0.168
NP_441052.1_2 Forward -365 -355 0.668351 0.256
NP_440436.1_4 Reverse -357 -366 8.65242 0.0997
NP_440436.1_4 Forward -364 -355 8.55409 0.0997
NP_441884.1_9 Forward -368 -349 -23.1083 0.284
NP_440121.1_7 Forward -397 -378 18.4848 0.292
NP_440314.1_9 Reverse -175 -194 -9.24366 0.262
NP_442907.1_9 Reverse -169 -188 -6.29373 0.289
NP_441719.1_4 Reverse -357 -364 13.5105 0.026
NP_441719.1_4 Forward -364 -357 6.52896 0.188
NP_441733.1_10 Reverse -234 -247 7.09911 0.156
NP_441004.1_1 Forward -189 -170 -2.26216 0.142
NP_441004.1_1 Forward -195 -176 -14.8485 0.271
NP_442813.1_4 Reverse -348 -367 -5.80207 0.299
NP_442366.1_3 Forward -366 -348 12.0155 0.0326
NP_441115.1_4 Forward -366 -348 12.1131 0.115
NP_442854.1_6 Forward -183 -164 5.80098 0.238
NP_440328.1_4 Reverse -350 -369 4.62101 0.162
NP_440094.1_2 Reverse -169 -188 16.0274 0.00955
NP_441851.1_10 Reverse -355 -365 12.0747 0.0568
NP_441851.1_10 Forward -366 -356 6.17489 0.182
NP_441851.1_10 Reverse -46 -56 4.99491 0.233
NP_442856.1_7 Reverse -347 -366 4.03102 0.137
NP_441668.1_4 Reverse -202 -221 -2.95047 0.299
NP_442515.1_1 Reverse -121 -135 -3.63866 0.295
NP_442515.1_1 Reverse -179 -193 -4.81863 0.298
NP_441396.1_5 Forward -201 -192 16.8143 0.199
NP_440593.1_3 Reverse -169 -188 0.687771 0.193
NP_440593.1_3 Forward -278 -259 -5.9004 0.268
NP_440593.1_3 Forward -188 -169 -6.88371 0.282
NP_441349.1_6 Reverse -163 -182 12.0942 0.207
NP_441349.1_10 Forward -188 -169 -5.11376 0.192
NP_442843.1_1 Forward -171 -152 -4.6221 0.239
NP_442843.1_1 Forward -74 -55 -4.6221 0.239
NP_441477.1_10 Reverse -162 -180 4.54237 0.201
NP_441477.1_10 Reverse -349 -367 -0.472507 0.291
NP_442450.1_5 Reverse -354 -364 6.07655 0.204
NP_440588.1_2 Reverse -347 -366 7.66927 0.0487
NP_440588.1_2 Forward -60 -41 -3.44213 0.186
NP_442006.1_2 Reverse -347 -364 -16.7758 0.264
NP_442006.1_2 Forward -322 -305 -17.7591 0.282
NP_441570.1_1 Forward -365 -347 -8.92897 0.124
NP_441078.1_4 Reverse -356 -365 9.93116 0.0203
NP_441078.1_4 Forward -365 -356 9.83282 0.0226
NP_441078.1_4 Forward -189 -180 6.29291 0.079
NP_441078.1_4 Forward -56 -47 -1.57357 0.266
NP_441078.1_4 Reverse -180 -189 -1.6719 0.266
NP_442729.1_5 Forward -184 -174 15.0247 0.199
NP_442443.1_1 Reverse -40 -59 -2.16383 0.252
NP_442443.1_1 Forward -339 -320 -4.72043 0.276
NP_441091.1_5 Reverse -170 -189 4.81767 0.26
NP_440526.1_3 Forward -55 -44 6.74468 0.184
NP_440526.1_3 Reverse -126 -137 5.76138 0.233
NP_441432.1_8 Forward -184 -175 3.44131 0.245
NP_442320.1_8 Reverse -350 -364 -4.7203 0.185
NP_441732.1_2 Reverse -176 -192 -7.61128 0.0861
NP_441732.1_2 Reverse -352 -368 -17.1494 0.24
NP_442815.1_2 Forward -194 -176 4.73903 0.243
NP_442797.1_1 Reverse -272 -291 -6.29373 0.296
NP_442797.1_6 Reverse -321 -340 7.06155 0.294
NP_442797.1_7 Reverse -173 -191 6.31233 0.21
NP_442797.1_7 Reverse -263 -281 0.609134 0.272
NP_442797.1_7 Forward -287 -269 -1.65248 0.299
NP_440199.1_10 Reverse -353 -363 13.2547 0.108
NP_441057.1_3 Reverse -51 -70 -12.5869 0.255
NP_441072.1_2 Forward -200 -181 7.07928 0.259
NP_442400.1_10 Forward -306 -293 7.22367 0.292
NP_442489.1_7 Forward -365 -356 17.306 0.00302
NP_442489.1_7 Reverse -356 -365 10.4228 0.0151
NP_442489.1_7 Forward -189 -180 -1.47524 0.203
NP_442489.1_7 Reverse -47 -56 -1.6719 0.235
NP_440559.1_1 Reverse -357 -366 5.70292 0.137
NP_441659.2_8 Reverse -356 -366 2.43831 0.2
NP_441659.2_8 Forward -365 -355 2.33998 0.205
NP_441659.2_8 Reverse -169 -179 1.65166 0.233
NP_441022.1_1 Forward -213 -204 10.7788 0.285
NP_440363.1_9 Forward -198 -180 14.5721 0.217
NP_441800.1_7 Reverse -175 -193 -1.06249 0.242
NP_442776.1_8 Reverse -342 -361 14.5516 0.21
NP_440545.1_3 Reverse -176 -193 0.825489 0.131
NP_440545.1_3 Forward -193 -176 -3.00942 0.197
NP_440545.1_3 Forward -369 -352 -4.97604 0.237
NP_440545.1_5 Forward -187 -170 5.84037 0.228
NP_440025.1_1 Forward -369 -350 14.7491 0.147
NP_440831.1_3 Reverse -347 -366 15.8036 0.104
NP_440486.1_6 Reverse -256 -275 6.09597 0.283
NP_440459.1_2 Reverse -347 -364 7.41366 0.291
NP_440010.1_4 Forward -369 -350 2.9486 0.221
NP_442551.1_4 Forward -192 -177 -1.88839 0.25
NP_442603.1_7 Forward -365 -351 9.53707 0.146
NP_441050.1_5 Forward -199 -181 5.91901 0.188
NP_441050.1_5 Forward -198 -180 1.00246 0.234
NP_441050.1_5 Reverse -39 -57 -0.669169 0.256
NP_441948.1_4 Reverse -349 -367 -2.3408 0.163
NP_441833.1_4 Forward -364 -357 6.52896 0.0924
NP_441833.1_4 Reverse -357 -364 6.23397 0.163
NP_441329.1_6 Reverse -13 -32 -1.76702 0.293
NP_441895.1_10 Reverse -378 -397 -18.5851 0.282
NP_441112.1_6 Reverse -191 -210 -4.22878 0.296
NP_442162.1_9 Reverse -357 -364 6.62729 0.142
NP_442162.1_9 Forward -364 -357 6.52896 0.178
NP_442140.1_3 Reverse -175 -185 5.38824 0.211
NP_442140.1_3 Reverse -357 -367 4.99491 0.232
NP_442723.1_1 Forward -32 -13 4.22689 0.276
NP_442723.1_1 Forward -60 -41 3.9319 0.276
NP_442021.1_3 Forward -189 -170 5.70265 0.126
NP_440875.1_9 Reverse -358 -368 13.2389 0.0789
NP_441813.1_5 Forward -367 -357 9.81313 0.0214
NP_441813.1_5 Reverse -354 -364 7.45319 0.0746
NP_440590.1_4 Forward -364 -351 3.75586 0.0686
NP_440590.1_4 Reverse -357 -370 -3.32397 0.255
NP_440567.1_1 Forward -364 -350 12.291 0.0241
NP_440719.1_1 Reverse -269 -288 16.9124 0.0467
NP_442497.1_10 Reverse -357 -366 0.688044 0.141
NP_442497.1_10 Forward -364 -355 0.589713 0.153
NP_440821.1_4 Reverse -354 -364 9.32148 0.03
NP_440821.1_4 Forward -367 -357 0.373358 0.18
NP_441239.1_9 Reverse -172 -184 13.412 0.037
NP_441239.1_9 Forward -367 -355 7.4138 0.161
NP_441239.1_9 Reverse -354 -366 6.1355 0.2
NP_441951.1_4 Forward -189 -170 7.57094 0.268
NP_441727.1_8 Forward -194 -175 4.03102 0.197
NP_442044.1_1 Reverse -42 -61 -14.3569 0.289
NP_440796.1_3 Reverse -349 -367 7.19654 0.29
NP_441017.1_6 Reverse -352 -366 13.1753 0.203
NP_442772.1_4 Forward -67 -48 -3.93378 0.244
NP_441874.1_1 Forward -187 -173 9.04604 0.28
NP_440212.1_5 Reverse -345 -364 21.8289 0.0532
NP_440412.1_2 Reverse -284 -303 5.70265 0.283
NP_440546.1_4 Forward -183 -173 13.4395 0.0494
NP_440462.1_6 Reverse -354 -364 12.1731 0.0371
NP_440462.1_6 Forward -367 -357 7.64985 0.0705
NP_442611.1_1 Forward -365 -346 6.98095 0.153
NP_440868.1_4 Forward -369 -357 15.7719 0.0164
NP_440868.1_4 Reverse -352 -364 1.7106 0.174
NP_442499.1_1 Reverse -181 -200 10.0292 0.203
NP_440374.1_1 Forward -76 -57 10.5209 0.292
NP_442402.1_4 Forward -37 -18 -5.60616 0.245
NP_442402.1_9 Forward -283 -264 9.14423 0.277
NP_441848.1_4 Forward -126 -110 7.07321 0.297
NP_441848.1_7 Reverse -108 -127 9.53674 0.196
NP_440696.1_3 Forward -193 -175 5.72234 0.19
NP_441843.2_3 Reverse -349 -368 15.9291 0.294
NP_440843.1_8 Reverse -41 -60 14.1591 0.297
NP_440843.1_8 Forward -183 -164 13.1758 0.297
NP_440843.1_8 Reverse -42 -61 12.4875 0.297
NP_442923.1_4 Forward -189 -170 0.982764 0.183
NP_440008.1_9 Reverse -41 -60 6.39097 0.287
NP_440825.1_6 Forward -192 -173 12.9791 0.244
NP_442837.1_3 Forward -364 -357 12.1338 0.0702
NP_442837.1_3 Reverse -357 -364 6.0373 0.25
NP_440160.1_2 Forward -57 -38 -1.57384 0.243
NP_440160.1_2 Reverse -180 -199 -9.34199 0.293
NP_442053.1_1 Forward -365 -356 16.3227 0.00389
NP_442053.1_1 Reverse -356 -365 8.65285 0.0741
NP_440505.1_3 Forward -367 -357 6.07655 0.197
NP_440505.1_3 Reverse -354 -364 4.99491 0.252
NP_441701.1_3 Reverse -38 -55 8.20031 0.247
NP_441701.1_3 Forward -198 -181 7.70866 0.257
NP_441252.1_6 Forward -59 -52 11.9372 0.25
NP_441203.1_1 Forward -364 -345 -12.2919 0.143
NP_442009.1_5 Forward -288 -269 22.5172 0.0723
NP_441408.2_7 Reverse -172 -191 7.07928 0.165
NP_441011.1_8 Reverse -357 -366 7.27622 0.179
NP_441011.1_8 Forward -364 -355 7.07956 0.179
NP_442533.1_1 Reverse -219 -238 -17.7001 0.293
NP_442533.1_6 Forward -365 -356 7.57121 0.0898
NP_442533.1_6 Reverse -356 -365 7.47288 0.0898
NP_442533.1_6 Reverse -174 -183 3.7363 0.204
NP_442541.1_10 Reverse -180 -194 11.012 0.186
NP_442232.1_3 Forward -197 -178 -14.9469 0.288
NP_442322.1_4 Reverse -166 -183 -2.32179 0.23
NP_442322.1_4 Reverse -178 -195 -8.31994 0.286
NP_442535.1_2 Forward -74 -55 7.7676 0.239
NP_439944.1_9 Forward -188 -178 11.3864 0.0887
NP_442269.1_10 Forward -194 -175 2.94938 0.262
NP_440816.1_2 Reverse -97 -116 6.33814 0.281
NP_441028.1_6 Forward -30 -20 4.7978 0.277
NP_442202.1_4 Forward -367 -353 14.9684 0.197
NP_441527.1_4 Reverse -17 -36 -10.8388 0.275
NP_440007.1_9 Reverse -165 -179 6.3911 0.227
NP_441680.1_4 Reverse -123 -142 0.884433 0.246
NP_441680.1_4 Reverse -351 -370 -1.37718 0.262
NP_441602.1_3 Forward -188 -169 2.3594 0.199
NP_441602.1_3 Forward -278 -259 -3.73712 0.252
NP_441106.1_1 Forward -366 -357 8.55452 0.0538
NP_441106.1_1 Reverse -355 -364 8.45619 0.0548
NP_439903.1_6 Reverse -171 -190 5.01354 0.187
NP_442704.1_7 Forward -133 -114 13.2741 0.181
NP_441286.1_1 Reverse -179 -191 -4.77924 0.175
NP_441286.1_1 Forward -366 -354 -4.87757 0.18
NP_440670.1_8 Reverse -356 -365 9.53783 0.0559
NP_440670.1_8 Forward -365 -356 9.14451 0.0583
NP_441930.1_2 Forward -190 -180 11.9764 0.271
NP_440886.1_7 Forward -366 -356 8.43603 0.0805
NP_440886.1_7 Reverse -355 -365 8.14104 0.0805
NP_440886.1_7 Reverse -121 -131 5.28945 0.188
NP_442614.1_2 Reverse -180 -194 7.86607 0.262
NP_442717.1_2 Forward -74 -55 -6.58872 0.282
NP_442072.1_9 Forward -57 -39 -21.2203 0.206
NP_442213.1_5 Forward -206 -187 11.8975 0.126
NP_441753.1_10 Reverse -347 -366 6.4893 0.186
NP_442022.1_4 Forward -352 -333 6.68596 0.27
NP_442022.1_4 Forward -195 -176 6.39097 0.271
NP_440907.2_8 Reverse -357 -367 4.69947 0.25
NP_441021.1_1 Reverse -48 -67 -9.047 0.206
NP_442893.1_4 Forward -119 -100 7.66846 0.126
NP_441626.1_2 Reverse -357 -364 6.13563 0.177
NP_441626.1_2 Forward -364 -357 5.93897 0.231
NP_442365.1_7 Reverse -176 -195 -0.39387 0.178
NP_442615.1_1 Forward -374 -356 -6.37237 0.244
NP_440387.1_1 Forward -365 -349 5.76173 0.031
NP_440387.1_1 Reverse -180 -196 -3.48138 0.16
NP_441431.1_2 Reverse -171 -185 10.1271 0.169
NP_441431.1_2 Forward -224 -210 8.3571 0.218
NP_441431.1_2 Reverse -170 -184 6.0955 0.28
NP_441488.1_8 Forward -188 -174 8.55376 0.184
NP_441993.1_1 Forward -189 -170 18.7094 0.0372
NP_441993.1_1 Forward -279 -260 3.99329 0.227
NP_441510.2_7 Reverse -163 -177 10.717 0.28
NP_440293.1_3 Reverse -39 -58 -0.787193 0.238
NP_440293.1_3 Forward -191 -172 -2.75381 0.241
NP_440766.1_4 Reverse -352 -366 10.816 0.0841
NP_439988.1_3 Forward -194 -180 10.3243 0.228
NP_439988.1_3 Forward -284 -270 7.66941 0.273
NP_439988.1_3 Forward -363 -349 4.52282 0.295
NP_442743.1_1 Reverse -171 -190 7.57013 0.264
NP_441133.1_1 Forward -189 -170 15.2408 0.2
NP_439910.1_2 Forward -373 -356 -12.7442 0.0944
NP_440457.1_1 Reverse -352 -364 8.59377 0.101
NP_440457.1_1 Reverse -38 -50 4.8572 0.151
NP_440457.1_1 Forward -182 -170 4.8572 0.151
NP_440457.1_1 Forward -333 -321 -0.452677 0.263
NP_442680.1_5 Reverse -95 -114 1.3422 0.243
NP_440801.1_8 Reverse -173 -192 1.0811 0.246
NP_440473.1_1 Forward -368 -349 10.679 0.298
NP_442509.1_9 Forward -56 -46 13.2542 0.0598
NP_442509.1_9 Forward -365 -355 7.55106 0.214
NP_442509.1_9 Reverse -356 -366 6.66608 0.259
NP_440554.1_4 Reverse -357 -367 6.76487 0.114
NP_440554.1_4 Forward -364 -354 4.99491 0.167
NP_442862.1_3 Reverse -49 -66 3.97208 0.298
NP_441885.1_5 Reverse -356 -366 2.04498 0.0868
NP_441885.1_5 Forward -365 -355 1.65166 0.106
NP_441885.1_5 Forward -189 -179 0.373358 0.164
NP_442341.1_7 Forward -366 -352 21.0424 0.00702
NP_442341.1_7 Reverse -269 -283 1.17956 0.297
NP_442341.1_9 Forward -180 -166 16.7152 0.0345
NP_442341.1_9 Forward -361 -347 6.29216 0.233
NP_442341.1_9 Reverse -166 -180 4.91554 0.287
NP_442395.2_4 Reverse -168 -187 1.47364 0.24
NP_442395.2_4 Forward -366 -347 -0.00131823 0.28
NP_440423.1_6 Forward -139 -120 -15.2418 0.229
NP_443000.1_7 Forward -367 -357 1.74999 0.229
NP_440507.2_1 Forward -62 -43 13.3725 0.23
NP_441842.1_10 Reverse -349 -363 17.7975 0.0203
NP_440275.1_3 Forward -367 -357 5.78156 0.131
NP_441902.1_3 Reverse -18 -28 13.5647 0.23
NP_439962.1_4 Reverse -348 -367 -1.47551 0.215
NP_440175.1_7 Reverse -281 -299 8.87516 0.285
NP_442495.1_5 Forward -194 -175 6.29264 0.291
NP_440149.1_8 Forward -365 -346 -5.01543 0.218
NP_440149.1_8 Forward -189 -170 -6.58872 0.255
NP_441105.1_3 Reverse -175 -194 -5.80207 0.224
NP_441105.1_3 Reverse -265 -284 -6.39206 0.234
NP_440216.1_1 Reverse -356 -370 5.80112 0.0174
NP_440216.1_1 Forward -365 -351 -0.983719 0.0288
NP_440216.1_6 Reverse -349 -365 13.4315 0.0679
NP_440216.1_9 Reverse -176 -185 7.37455 0.286
NP_440167.1_3 Reverse -261 -280 12.4875 0.198
NP_442015.1_10 Reverse -352 -365 10.049 0.0415
NP_442015.1_10 Forward -369 -356 2.08423 0.202
NP_441226.1_7 Forward -358 -351 9.77352 0.131
NP_441226.1_7 Reverse -169 -176 5.64364 0.286
NP_440198.1_3 Reverse -184 -203 14.5516 0.277
NP_441111.1_7 Reverse -357 -365 8.96754 0.0463
NP_441111.1_7 Forward -364 -356 8.86921 0.0589
NP_441766.1_2 Reverse -356 -365 7.76787 0.0714
NP_441766.1_2 Forward -365 -356 7.76787 0.0714
NP_440416.1_9 Reverse -349 -368 1.96607 0.0415
NP_440416.1_9 Reverse -173 -192 -8.26035 0.112
NP_443052.1_8 Reverse -346 -365 -1.96717 0.085
NP_443052.1_9 Reverse -321 -340 3.93269 0.159
NP_440885.1_6 Reverse -95 -114 7.2093 0.237
NP_442564.1_10 Reverse -187 -201 8.65272 0.296
NP_440261.1_5 Reverse -357 -370 -4.89726 0.178
NP_440261.1_5 Forward -364 -351 -12.4687 0.297
NP_440988.1_10 Forward -361 -347 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGACTTCACCACTATTTACGATATGAAAGTTACCCGTCGATCGCCGTCGGGCAGAATTTTGCTCCTGGAAGTGCTAACGGATAAAGGCGTAGTGGAATTAGCCAAGAACGAAGCCCGCAGTGCCTTTGGCCCTCCGCGCAGTACCTTGTTTTACCTGGAACCCACCTACGATGCTAACCAGCGACTTCAAAGCGTTTTCTTTGTGGGGGGGGGCTTTGGCCATGGGGTCGGCATGAGTCAATTCGGTTCTTATAAACTGTCCCAGTTGGGTTGGTCGGCGGAACAAATTTTGGCTTTTTATTATCCTGGCACTCAAATCAGACAGCTCAATGAGCAAATTCTGGGGCAAACCCCCCGCCCTTGATATTCATTTTTCTCCCTAATTACCACCTCACTGCGT

CDS

ATGACTTCCATGCCCATCGAAATTTCTGTTCAGGATCTGGCTCTGATGTTGGCTCACCCCAACGGCGATCGCCAGTTGATTGATGTGCGGGAACCCCATGAGGTGGAAATTGCGGCCCTGCCAGGCTTTGAAACCCTATCCTTGAGCGAGTTTGCCCAGTGGTCTGGCACCATTCGGGAGCGCTACGATGGGGAGAAAGAAACCGTAGTGTTGTGTCACCACGGCATCCGTTCAGACCAGATGGCCCACTGGTTAGTGGATCAAGGTTTTAGTAAAGTTAAAAACGTAGTGGGGGGAATTGATGCTTATTCCCGTTTGATTGATGCCACCATTCCCTGTTATTAA

Protein

MTSMPIEISVQDLALMLAHPNGDRQLIDVREPHEVEIAALPGFETLSLSEFAQWSGTIRERYDGEKETVVLCHHGIRSDQMAHWLVDQGFSKVKNVVGGIDAYSRLIDATIPCY