Your browser is old and dusty. Try Google Chrome!

Details for slr0184

ORF slr0184
Accession NP_442006.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -257 -271 12.0943 0.0481
NP_441061.1_2 Forward -222 -208 7.17775 0.106
NP_441061.1_2 Forward -264 -250 2.65453 0.173
NP_441061.1_2 Forward -326 -312 -0.0987402 0.221
NP_440557.1_1 Forward -264 -245 -1.96717 0.28
NP_440795.1_7 Forward -264 -257 14.6904 0.0123
NP_440795.1_7 Reverse -257 -264 14.6904 0.0123
NP_441418.1_6 Forward -265 -246 -18.2901 0.0827
NP_441418.1_6 Reverse -256 -275 -20.945 0.133
NP_442291.1_5 Reverse -255 -271 5.17175 0.0801
NP_440897.1_6 Forward -265 -246 9.83173 0.0705
NP_441453.1_4 Reverse -256 -264 16.539 0.00633
NP_441453.1_4 Forward -265 -257 16.539 0.00633
NP_442151.1_6 Forward -265 -251 20.0591 0.0045
NP_442151.1_6 Reverse -256 -270 15.6342 0.0221
NP_441818.1_1 Reverse -257 -268 18.8393 0.00301
NP_441818.1_9 Forward -303 -284 -10.522 0.295
NP_441642.1_1 Reverse -369 -388 0.196116 0.289
NP_442173.1_1 Forward -264 -256 15.4574 0.00633
NP_442173.1_1 Reverse -257 -265 15.4574 0.00633
NP_442752.1_4 Forward -265 -258 13.8055 0.0199
NP_442752.1_4 Reverse -256 -263 13.8055 0.0199
NP_443027.1_4 Forward -267 -257 14.0414 0.0452
NP_441812.1_3 Reverse -255 -269 10.9143 0.215
NP_442975.1_10 Forward -173 -159 5.70218 0.212
NP_442975.1_10 Forward -269 -255 4.62054 0.241
NP_442975.1_10 Reverse -252 -266 2.65393 0.269
NP_440784.1_7 Forward -264 -257 15.9687 0.0123
NP_440784.1_7 Reverse -257 -264 15.9687 0.0123
NP_440061.1_9 Forward -267 -253 10.422 0.124
NP_440110.1_4 Reverse -245 -264 9.43923 0.125
NP_440878.1_9 Reverse -246 -265 3.14605 0.174
NP_442062.1_8 Forward -265 -255 17.3846 0.00193
NP_442062.1_8 Reverse -256 -266 17.3846 0.00193
NP_440761.1_4 Forward -270 -251 -4.03212 0.132
NP_441859.1_3 Forward -357 -338 4.42355 0.222
NP_441859.1_3 Reverse -255 -274 2.85027 0.254
NP_440304.1_4 Forward -303 -293 10.8948 0.051
NP_440304.1_4 Forward -267 -257 10.8948 0.051
NP_440304.1_4 Reverse -254 -264 1.84832 0.299
NP_442242.1_4 Forward -264 -257 14.3954 0.0124
NP_442242.1_4 Reverse -257 -264 14.3954 0.0124
NP_440044.1_8 Forward -264 -245 -0.4922 0.223
NP_441781.1_7 Forward -152 -133 -0.688862 0.263
NP_442097.1_2 Forward -250 -231 1.76941 0.259
NP_440893.1_5 Reverse -264 -283 12.88 0.172
NP_441208.1_9 Reverse -253 -267 7.07942 0.227
NP_442110.1_7 Forward -265 -251 10.6193 0.0644
NP_442110.1_7 Forward -301 -287 7.37441 0.118
NP_442110.1_7 Reverse -256 -270 0.392915 0.261
NP_441082.1_10 Reverse -184 -197 13.589 0.236
NP_441925.1_4 Reverse -293 -312 -14.0626 0.261
NP_441083.1_3 Reverse -340 -350 12.1726 0.282
NP_441083.1_5 Forward -265 -255 20.3345 0.00053
NP_441083.1_5 Reverse -256 -266 20.3345 0.00053
NP_442827.1_8 Reverse -248 -267 -2.8529 0.29
NP_441738.1_2 Forward -263 -256 15.28 0.0102
NP_441738.1_2 Reverse -258 -265 15.28 0.0102
NP_441558.1_5 Forward -267 -248 11.5042 0.0801
NP_441558.1_5 Reverse -298 -317 4.12936 0.29
NP_440209.1_1 Reverse -256 -264 18.1123 0.00295
NP_440209.1_1 Forward -265 -257 18.1123 0.00295
NP_442889.1_8 Forward -268 -254 13.1753 0.0588
NP_441716.1_1 Reverse -256 -270 6.98109 0.183
NP_441716.1_1 Forward -265 -251 3.93283 0.259
NP_442111.1_4 Forward -266 -252 12.0943 0.0451
NP_442111.1_4 Reverse -159 -173 3.73617 0.233
NP_441831.1_9 Reverse -70 -89 18.1907 0.0573
NP_440906.1_5 Forward -264 -257 15.8704 0.0124
NP_440906.1_5 Reverse -257 -264 15.8704 0.0124
NP_440747.1_10 Reverse -253 -265 24.7201 0.00036
NP_440747.1_10 Forward -268 -256 7.51213 0.00286
NP_440747.1_10 Reverse -157 -169 -12.3507 0.27
NP_441486.1_1 Forward -268 -254 23.5007 0.00162
NP_441486.1_1 Reverse -253 -267 12.586 0.0112
NP_441486.1_1 Reverse -338 -352 -5.40861 0.237
NP_439964.1_10 Reverse -142 -156 17.5025 0.276
NP_441265.1_3 Reverse -250 -264 2.85119 0.181
NP_440403.1_10 Reverse -247 -266 1.37609 0.291
NP_440842.1_6 Reverse -342 -361 12.9783 0.236
NP_441014.1_8 Reverse -287 -306 -0.197208 0.218
NP_441014.1_10 Reverse -255 -274 1.27698 0.23
NP_442848.1_1 Forward -271 -257 -2.36035 0.263
NP_441012.1_4 Forward -325 -312 8.77074 0.272
NP_441012.1_4 Reverse -308 -321 7.98409 0.272
NP_443018.1_3 Forward -264 -257 14.8871 0.0123
NP_443018.1_3 Reverse -257 -264 14.8871 0.0123
NP_441634.1_8 Reverse -254 -268 -4.62196 0.295
NP_440376.1_1 Forward -265 -256 19.4693 0.000692
NP_440376.1_1 Reverse -256 -265 19.4693 0.000692
NP_440376.1_1 Reverse -341 -350 -1.27858 0.297
NP_441857.1_5 Forward -76 -58 2.67408 0.265
NP_441588.1_4 Forward -263 -253 9.02648 0.14
NP_441588.1_4 Reverse -258 -268 8.63316 0.14
NP_442730.1_8 Forward -219 -200 3.83357 0.273
NP_442687.1_7 Forward -266 -256 8.92815 0.0994
NP_442687.1_7 Reverse -255 -265 8.92815 0.0994
NP_442958.1_3 Reverse -152 -171 0.58944 0.267
NP_440642.1_10 Reverse -240 -254 5.21053 0.241
NP_441013.1_2 Reverse -307 -325 6.80398 0.208
NP_441422.1_7 Reverse -310 -327 -7.72931 0.261
NP_442658.1_1 Reverse -254 -264 6.76441 0.214
NP_442658.1_1 Forward -267 -257 6.76441 0.214
NP_440141.1_8 Forward -259 -240 8.75091 0.23
NP_440141.1_8 Forward -318 -299 8.55425 0.23
NP_441971.1_4 Forward -296 -277 18.6815 0.212
NP_442496.1_5 Reverse -189 -207 5.42735 0.288
NP_442496.1_5 Forward -316 -298 5.03403 0.288
NP_441414.1_9 Reverse -143 -162 -0.885524 0.0949
NP_441414.1_9 Reverse -256 -275 -4.81876 0.162
NP_441414.1_9 Forward -265 -246 -8.16202 0.23
NP_439968.1_8 Forward -347 -331 14.2182 0.225
NP_441487.1_9 Reverse -291 -310 -2.75381 0.293
NP_441958.1_5 Forward -266 -256 12.2714 0.00183
NP_441958.1_5 Reverse -255 -265 12.2714 0.00183
NP_440203.1_5 Forward -262 -252 14.2375 0.0886
NP_440203.1_5 Forward -324 -314 13.5492 0.114
NP_440984.1_7 Reverse -251 -265 9.34103 0.127
NP_439990.1_5 Forward -270 -257 16.1456 0.0407
NP_439990.1_5 Reverse -251 -264 11.229 0.128
NP_442911.1_2 Forward -275 -256 -3.44213 0.112
NP_442911.1_2 Reverse -246 -265 -10.0303 0.268
NP_443055.1_6 Reverse -242 -260 -0.0799167 0.252
NP_440993.1_3 Reverse -246 -265 -2.16459 0.297
NP_441348.1_3 Forward -270 -251 6.4893 0.277
NP_441099.1_5 Reverse -150 -169 -10.522 0.256
NP_441099.1_5 Reverse -246 -265 -11.5053 0.283
NP_442002.1_1 Forward -318 -300 2.28076 0.173
NP_442002.1_9 Reverse -219 -226 11.1505 0.185
NP_442002.1_9 Reverse -21 -28 9.47889 0.282
NP_441294.1_7 Reverse -252 -266 9.15464 0.256
NP_441646.1_1 Reverse -249 -268 1.27776 0.232
NP_441646.1_1 Forward -176 -157 -1.57384 0.291
NP_442438.1_10 Reverse -251 -265 9.04604 0.0692
NP_442438.1_10 Forward -270 -256 -0.492064 0.264
NP_442885.1_5 Reverse -258 -277 15.1416 0.236
NP_440147.1_4 Reverse -254 -267 11.3273 0.0326
NP_440147.1_4 Forward -267 -254 2.18257 0.209
NP_441550.1_8 Reverse -254 -264 14.6309 0.0132
NP_441550.1_8 Forward -267 -257 12.3692 0.0336
NP_441916.1_7 Forward -265 -255 10.3048 0.0261
NP_441916.1_7 Reverse -256 -266 10.3048 0.0261
NP_440383.1_1 Reverse -190 -209 16.9124 0.0273
NP_441041.1_4 Forward -265 -246 -8.55534 0.204
NP_441041.1_4 Reverse -256 -275 -13.4719 0.288
NP_441041.1_7 Reverse -253 -265 8.58373 0.133
NP_442396.1_5 Forward -269 -256 9.16406 0.13
NP_442004.1_6 Forward -265 -251 5.80112 0.181
NP_441725.1_5 Reverse -257 -267 11.2881 0.0247
NP_441725.1_5 Forward -264 -254 2.04498 0.115
NP_439966.1_7 Forward -267 -257 15.8108 0.0124
NP_439966.1_7 Reverse -254 -264 7.25606 0.15
NP_442941.1_3 Reverse -257 -267 19.9412 0.00262
NP_442941.1_3 Forward -264 -254 11.0914 0.0116
NP_440289.1_2 Forward -268 -255 13.294 0.0132
NP_440289.1_2 Reverse -289 -302 2.18257 0.102
NP_440289.1_2 Reverse -140 -153 -3.12731 0.265
NP_440289.1_2 Reverse -253 -266 -4.9956 0.294
NP_440983.1_5 Reverse -300 -319 -6.58872 0.278
NP_440260.1_8 Reverse -247 -265 4.24738 0.154
NP_440260.1_8 Forward -303 -285 3.95239 0.158
NP_441514.1_6 Reverse -195 -202 14.2971 0.248
NP_441678.1_9 Forward -380 -361 -3.83545 0.288
NP_442281.1_1 Reverse -251 -265 17.6002 0.00542
NP_442281.1_1 Forward -270 -256 8.16044 0.0845
NP_441334.1_7 Forward -267 -248 -20.1584 0.275
NP_442256.1_2 Forward -267 -249 -6.86402 0.214
NP_440437.1_1 Reverse -250 -269 4.62101 0.099
NP_442049.1_6 Reverse -248 -267 3.24438 0.276
NP_441556.1_10 Reverse -251 -265 14.018 0.178
NP_441644.1_6 Forward -265 -255 17.3841 0.00127
NP_441644.1_6 Reverse -256 -266 17.3841 0.00127
NP_441644.1_6 Forward -217 -207 7.74772 0.117
NP_441644.1_6 Reverse -312 -322 6.46942 0.157
NP_442215.1_2 Forward -267 -251 16.1848 0.0155
NP_442215.1_2 Reverse -254 -270 11.5633 0.039
NP_442215.1_2 Forward -352 -336 -6.43131 0.271
NP_442215.1_10 Forward -107 -88 -2.06626 0.299
NP_440253.1_2 Reverse -256 -274 0.805796 0.176
NP_440929.1_8 Forward -265 -256 19.2726 0.000701
NP_440929.1_8 Reverse -256 -265 19.2726 0.000701
NP_440566.1_2 Forward -325 -306 11.6025 0.166
NP_442933.1_10 Forward -265 -256 17.601 0.00325
NP_442933.1_10 Reverse -256 -265 17.601 0.00325
NP_440382.1_2 Forward -43 -24 5.01354 0.27
NP_441751.2_8 Reverse -257 -271 21.0424 0.00597
NP_442926.1_5 Forward -306 -287 8.61992 0.299
NP_442554.1_8 Reverse -257 -267 15.9097 0.00747
NP_442554.1_8 Forward -264 -254 15.3197 0.00882
NP_441762.1_7 Forward -266 -254 0.432302 0.0747
NP_441762.1_7 Reverse -255 -267 -6.84419 0.284
NP_442142.1_4 Forward -268 -255 14.1783 0.0311
NP_442142.1_4 Reverse -253 -266 12.2117 0.0464
NP_442292.1_1 Forward -264 -255 18.486 0.00229
NP_442292.1_1 Reverse -257 -266 18.486 0.00229
NP_442143.1_8 Reverse -248 -267 11.5033 0.23
NP_443009.1_2 Reverse -258 -277 1.0811 0.216
NP_443009.1_5 Reverse -255 -266 8.90795 0.0965
NP_443009.1_5 Forward -266 -255 8.90795 0.0965
NP_441715.1_4 Reverse -257 -267 14.828 0.0268
NP_441715.1_4 Forward -264 -254 7.94484 0.107
NP_440357.1_6 Reverse -331 -350 4.916 0.279
NP_440015.1_9 Reverse -256 -274 -0.275845 0.256
NP_440379.1_5 Reverse -204 -223 -11.5053 0.297
NP_440464.1_10 Forward -264 -254 13.0082 0.169
NP_441468.1_1 Forward -264 -257 15.8704 0.0124
NP_441468.1_1 Reverse -257 -264 15.8704 0.0124
NP_442099.1_1 Forward -264 -246 12.9988 0.287
NP_441020.2_6 Forward -303 -286 12.8219 0.0847
NP_441020.2_6 Forward -267 -250 7.90532 0.215
NP_441015.1_10 Reverse -203 -222 -4.42544 0.203
NP_441015.1_10 Forward -270 -251 -4.6221 0.209
NP_441673.1_1 Forward -265 -256 20.8459 0.000698
NP_441673.1_1 Reverse -256 -265 20.8459 0.000698
NP_441673.1_1 Reverse -341 -350 -8.06341 0.254
NP_441673.1_1 Reverse -292 -301 -8.06341 0.254
NP_441731.1_3 Forward -303 -284 -4.6221 0.284
NP_441826.1_2 Reverse -250 -264 6.98109 0.0899
NP_441826.1_2 Forward -271 -257 5.99778 0.0946
NP_442811.1_2 Forward -323 -304 -0.885524 0.252
NP_442490.1_9 Forward -321 -302 -3.73712 0.244
NP_442868.1_6 Forward -267 -257 9.91146 0.038
NP_442868.1_6 Reverse -254 -264 9.81313 0.038
NP_442868.1_6 Reverse -141 -151 0.57002 0.217
NP_442719.1_2 Reverse -235 -253 -7.15971 0.232
NP_441612.1_2 Reverse -256 -266 8.54929 0.21
NP_441612.1_2 Forward -265 -255 8.54929 0.21
NP_441612.1_2 Reverse -160 -170 6.70984 0.277
NP_442361.1_3 Reverse -250 -263 17.7189 0.0481
NP_442361.1_3 Reverse -286 -299 11.0324 0.272
NP_442427.1_8 Forward -274 -255 10.8159 0.156
NP_442808.1_1 Reverse -255 -265 8.63269 0.0481
NP_442808.1_1 Forward -266 -256 8.63269 0.0481
NP_440145.1_4 Reverse -301 -311 19.1541 0.0863
NP_442542.1_2 Forward -311 -298 7.29578 0.187
NP_442542.1_2 Reverse -141 -154 4.93583 0.29
NP_442050.1_5 Forward -267 -257 16.4991 0.00812
NP_442050.1_5 Reverse -254 -264 7.64939 0.243
NP_442050.1_8 Reverse -196 -215 14.474 0.272
NP_442342.1_9 Reverse -298 -314 7.33503 0.207
NP_441114.1_3 Reverse -367 -376 6.39124 0.277
NP_442789.1_4 Reverse -214 -233 -6.58872 0.286
NP_441878.1_6 Forward -266 -256 10.4031 0.0176
NP_441878.1_6 Reverse -255 -265 10.4031 0.0176
NP_441878.1_6 Forward -302 -292 1.455 0.0979
NP_441878.1_6 Forward -310 -300 -7.98478 0.285
NP_441036.1_8 Forward -266 -256 8.33817 0.174
NP_441036.1_8 Reverse -255 -265 8.33817 0.174
NP_442650.1_2 Forward -265 -251 8.25939 0.13
NP_441557.1_5 Forward -265 -256 19.9609 0.000699
NP_441557.1_5 Reverse -256 -265 19.9609 0.000699
NP_441557.1_8 Reverse -301 -311 12.2709 0.236
NP_441445.1_1 Forward -274 -255 16.3224 0.0383
NP_442066.2_4 Forward -265 -246 -7.76869 0.286
NP_442066.2_9 Forward -269 -256 9.06573 0.181
NP_441433.1_8 Forward -264 -245 5.60432 0.178
NP_442579.1_9 Reverse -307 -326 2.45773 0.26
NP_440101.1_5 Forward -221 -202 2.55606 0.219
NP_440101.1_10 Reverse -312 -331 5.11266 0.208
NP_441458.1_10 Reverse -247 -266 16.0274 0.0723
NP_442183.1_1 Reverse -256 -270 10.6193 0.0821
NP_442166.1_7 Forward -320 -306 11.701 0.19
NP_442397.1_9 Reverse -256 -275 4.916 0.254
NP_441116.1_6 Reverse -8 -27 16.7157 0.128
NP_441574.1_1 Forward -356 -337 -0.787193 0.211
NP_441549.1_9 Forward -269 -251 -5.58572 0.198
NP_442347.1_2 Forward -264 -255 12.4878 0.056
NP_442347.1_2 Reverse -257 -266 12.4878 0.056
NP_442645.1_2 Forward -273 -254 -16.8151 0.242
NP_442645.1_2 Reverse -233 -252 -18.2901 0.27
NP_442965.1_2 Reverse -215 -234 -4.32711 0.255
NP_442965.1_2 Reverse -198 -217 -5.70374 0.255
NP_441037.1_4 Reverse -254 -264 7.9999 0.237
NP_442594.1_8 Reverse -196 -215 3.14605 0.288
NP_442594.1_8 Forward -318 -299 1.67108 0.298
NP_442594.1_9 Reverse -52 -71 8.75009 0.228
NP_441633.1_3 Reverse -254 -267 1.10092 0.109
NP_441633.1_3 Reverse -158 -171 -0.865694 0.15
NP_441633.1_3 Reverse -290 -303 -4.30728 0.191
NP_441633.1_3 Forward -267 -254 -5.97891 0.236
NP_442764.1_8 Reverse -307 -326 1.76941 0.298
NP_440136.1_2 Forward -264 -257 15.9687 0.0123
NP_440136.1_2 Reverse -257 -264 15.9687 0.0123
NP_442590.1_10 Forward -271 -252 3.53937 0.29
NP_442998.1_5 Forward -334 -324 9.51814 0.238
NP_442998.1_5 Reverse -357 -367 7.25653 0.298
NP_442998.1_10 Forward -263 -256 15.5754 0.0102
NP_442998.1_10 Reverse -258 -265 15.5754 0.0102
NP_440899.1_1 Reverse -219 -238 11.2376 0.164
NP_440899.1_8 Forward -28 -9 -4.72043 0.231
NP_440299.1_1 Reverse -252 -265 22.3398 0.000547
NP_440299.1_1 Forward -325 -312 6.70522 0.133
NP_440299.1_1 Forward -269 -256 4.34528 0.209
NP_441799.1_1 Forward -269 -255 12.2903 0.0441
NP_441799.1_1 Reverse -252 -266 8.84875 0.105
NP_440640.1_6 Forward -277 -258 3.93269 0.213
NP_441007.1_10 Forward -270 -257 2.96921 0.183
NP_441007.1_10 Reverse -251 -264 -0.669033 0.287
NP_440256.1_1 Forward -268 -249 0.294447 0.085
NP_440256.1_1 Reverse -253 -272 -7.27704 0.232
NP_441559.1_8 Reverse -251 -265 -6.88358 0.281
NP_440915.1_6 Forward -313 -299 10.9143 0.0297
NP_440915.1_6 Reverse -252 -266 3.73617 0.1
NP_440717.1_3 Reverse -303 -317 8.55376 0.264
NP_441704.1_8 Reverse -245 -264 17.5998 0.0715
NP_441704.1_8 Reverse -307 -326 10.7167 0.15
NP_441939.1_3 Forward -264 -245 11.1109 0.118
NP_441494.1_6 Reverse -158 -171 9.85238 0.227
NP_439985.1_7 Forward -271 -252 2.16274 0.296
NP_442993.1_1 Reverse -256 -272 9.69497 0.0178
NP_442993.1_1 Forward -118 -102 -11.2495 0.24
NP_440677.1_1 Reverse -247 -266 7.47261 0.236
NP_440677.1_1 Forward -274 -255 7.07928 0.243
NP_442386.1_9 Reverse -255 -264 13.8639 0.0289
NP_442386.1_9 Forward -266 -257 13.8639 0.0289
NP_440570.1_5 Forward -319 -300 -2.0655 0.277
NP_440570.1_5 Reverse -308 -327 -3.3438 0.289
NP_440570.1_7 Forward -44 -25 16.4207 0.199
NP_441340.1_5 Forward -264 -257 15.6737 0.0124
NP_441340.1_5 Reverse -257 -264 15.6737 0.0124
NP_441340.1_9 Reverse -6 -16 8.25522 0.256
NP_442484.1_2 Reverse -245 -264 0.786102 0.244
NP_442484.1_2 Reverse -301 -320 -0.295539 0.26
NP_440168.1_2 Reverse -248 -267 -3.54046 0.276
NP_442714.1_5 Forward -258 -239 5.89931 0.238
NP_440586.1_4 Reverse -201 -219 10.7372 0.288
NP_440586.1_8 Forward -264 -257 13.2151 0.026
NP_440586.1_8 Reverse -257 -264 13.2151 0.026
NP_442251.1_6 Forward -264 -257 15.2804 0.0124
NP_442251.1_6 Reverse -257 -264 15.2804 0.0124
NP_440684.1_9 Forward -271 -257 10.1277 0.209
NP_441262.1_2 Forward -217 -203 19.683 0.182
NP_441262.1_3 Reverse -256 -263 14.7888 0.0223
NP_441262.1_3 Forward -265 -258 14.7888 0.0223
NP_440027.1_3 Reverse -286 -304 6.01657 0.23
NP_443051.1_1 Reverse -255 -264 10.4228 0.00754
NP_443051.1_1 Forward -266 -257 10.4228 0.00754
NP_439937.1_9 Reverse -299 -316 -12.8431 0.276
NP_440408.1_7 Forward -265 -246 9.3409 0.262
NP_440372.1_2 Forward -264 -257 16.3621 0.0124
NP_440372.1_2 Reverse -257 -264 16.3621 0.0124
NP_440372.1_3 Reverse -50 -64 18.5371 0.1
NP_441181.1_4 Reverse -360 -379 15.4366 0.271
NP_440316.1_10 Forward -310 -300 7.55152 0.246
NP_441803.1_2 Reverse -251 -270 2.45773 0.212
NP_441803.1_2 Reverse -326 -345 0.58944 0.249
NP_442384.1_10 Forward -265 -252 17.4239 0.00585
NP_442384.1_10 Reverse -256 -269 8.18076 0.0685
NP_441604.1_4 Reverse -248 -267 -6.78538 0.293
NP_441877.1_7 Reverse -330 -349 12.1917 0.109
NP_440476.1_2 Forward -20 -1 17.1082 0.217
NP_442458.1_6 Forward -285 -266 13.2741 0.0939
NP_442262.1_10 Forward -264 -257 14.1988 0.0123
NP_442262.1_10 Reverse -257 -264 14.1988 0.0123
NP_441689.1_5 Forward -267 -257 15.3192 0.0403
NP_441689.1_5 Reverse -254 -264 5.78111 0.197
NP_440163.1_10 Forward -268 -258 11.3864 0.169
NP_440344.1_10 Forward -272 -255 0.92382 0.033
NP_440344.1_10 Reverse -249 -266 -1.23946 0.0516
NP_440344.1_10 Reverse -334 -351 -9.00761 0.137
NP_440282.1_10 Reverse -198 -217 -7.67036 0.253
NP_440531.1_6 Forward -273 -254 14.8474 0.0384
NP_440531.1_6 Reverse -248 -267 -5.11376 0.293
NP_440531.1_8 Forward -391 -372 4.22769 0.269
NP_440562.1_10 Reverse -247 -265 6.214 0.284
NP_441965.1_10 Forward -268 -252 10.5799 0.107
NP_440297.1_9 Reverse -257 -267 9.32148 0.0917
NP_440297.1_9 Reverse -313 -323 0.176696 0.282
NP_440297.1_9 Forward -264 -254 -0.118297 0.282
NP_442280.1_10 Reverse -246 -264 11.7855 0.205
NP_442280.1_10 Forward -232 -214 4.87002 0.292
NP_441592.1_4 Forward -265 -246 -3.73712 0.288
NP_440894.1_10 Forward -270 -251 4.42435 0.254
NP_440999.1_9 Reverse -252 -266 3.24451 0.133
NP_440999.1_9 Forward -269 -255 1.27789 0.168
NP_440888.1_2 Reverse -256 -270 15.4369 0.0107
NP_440888.1_2 Forward -265 -251 10.717 0.0861
NP_440888.1_2 Forward -301 -287 5.60385 0.272
NP_440600.1_4 Reverse -248 -266 -2.63579 0.204
NP_440491.1_1 Forward -268 -249 20.4636 0.0243
NP_440052.1_5 Reverse -245 -264 5.89931 0.107
NP_442225.1_10 Reverse -246 -265 5.11187 0.3
NP_441543.1_2 Forward -264 -255 16.9127 0.00359
NP_441543.1_2 Reverse -257 -266 16.9127 0.00359
NP_442845.1_2 Forward -271 -257 15.4376 0.0727
NP_442845.1_2 Forward -265 -251 7.37441 0.195
NP_442845.1_2 Reverse -250 -264 5.70279 0.225
NP_442845.1_2 Reverse -208 -222 5.1128 0.243
NP_440982.1_1 Reverse -300 -319 15.5349 0.0853
NP_441469.1_8 Forward -266 -257 6.48957 0.227
NP_441469.1_8 Reverse -255 -264 6.48957 0.227
NP_443064.1_6 Forward -265 -255 12.5669 0.0796
NP_443064.1_6 Reverse -256 -266 12.5669 0.0796
NP_442578.1_7 Forward -264 -257 14.5921 0.026
NP_442578.1_7 Reverse -257 -264 14.5921 0.026
NP_440220.1_4 Forward -236 -217 11.6017 0.151
NP_441462.1_2 Forward -265 -255 11.5831 0.00406
NP_441462.1_2 Reverse -256 -266 11.5831 0.00406
NP_443062.1_6 Forward -273 -254 3.83436 0.228
NP_442204.1_1 Reverse -252 -263 8.7118 0.0852
NP_441560.1_8 Forward -306 -287 12.3892 0.255
NP_440516.1_6 Reverse -241 -255 8.65209 0.246
NP_440516.1_8 Forward -265 -256 16.9127 0.00442
NP_440516.1_8 Reverse -256 -265 16.9127 0.00442
NP_440516.1_8 Forward -309 -300 -0.491928 0.262
NP_441785.1_1 Reverse -235 -249 12.4475 0.245
NP_442428.1_5 Forward -264 -257 15.8704 0.0124
NP_442428.1_5 Reverse -257 -264 15.8704 0.0124
NP_441443.1_1 Forward -252 -233 -0.787193 0.237
NP_442823.1_9 Forward -89 -70 16.2067 0.196
NP_441867.1_2 Forward -318 -299 -3.93378 0.178
NP_441867.1_2 Reverse -85 -104 -10.1286 0.194
NP_440673.1_2 Reverse -246 -265 7.95079 0.286
NP_440673.1_3 Forward -263 -256 12.4288 0.0426
NP_440673.1_3 Reverse -258 -265 12.4288 0.0426
NP_440673.1_3 Forward -325 -318 8.98723 0.203
NP_441714.1_3 Reverse -249 -267 14.0797 0.198
NP_441052.1_2 Forward -265 -255 19.9412 0.00106
NP_441052.1_2 Reverse -256 -266 19.9412 0.00106
NP_441052.1_2 Forward -169 -159 5.09324 0.132
NP_442219.1_8 Forward -269 -250 6.52434 0.294
NP_442219.1_9 Forward -264 -255 17.7976 0.00718
NP_442219.1_9 Reverse -257 -266 17.7976 0.00718
NP_440436.1_2 Forward -279 -260 16.3229 0.224
NP_440436.1_4 Forward -264 -255 17.2072 0.00233
NP_440436.1_4 Reverse -257 -266 17.2072 0.00233
NP_441884.1_9 Forward -268 -249 -3.24547 0.0594
NP_441884.1_9 Forward -304 -285 -22.125 0.275
NP_441719.1_4 Forward -264 -257 16.3621 0.0124
NP_441719.1_4 Reverse -257 -264 16.3621 0.0124
NP_441719.1_6 Reverse -239 -258 11.8967 0.269
NP_441719.1_6 Reverse -296 -315 5.99684 0.288
NP_441004.1_1 Forward -315 -296 -10.6203 0.224
NP_441004.1_2 Forward -320 -301 6.39097 0.182
NP_442366.1_3 Forward -266 -248 4.9357 0.0899
NP_442366.1_5 Reverse -253 -263 14.0409 0.0497
NP_442366.1_5 Forward -353 -343 12.2709 0.137
NP_442206.1_1 Reverse -241 -260 -11.1119 0.219
NP_442206.1_10 Forward -265 -250 3.71647 0.181
NP_443054.1_2 Forward -267 -253 1.57289 0.245
NP_443054.1_2 Reverse -290 -304 -0.0987402 0.284
NP_440864.1_9 Forward -325 -306 -7.37537 0.29
NP_441851.1_10 Forward -266 -256 15.8113 0.00552
NP_441851.1_10 Reverse -255 -265 15.8113 0.00552
NP_442856.1_7 Reverse -247 -266 1.76941 0.167
NP_442515.1_1 Reverse -255 -269 10.7177 0.0469
NP_442515.1_1 Reverse -159 -173 -4.22864 0.298
NP_442515.1_1 Forward -266 -252 -4.81863 0.298
NP_441683.1_7 Reverse -190 -209 -3.04881 0.241
NP_441349.1_10 Forward -360 -341 -4.42544 0.171
NP_441349.1_10 Reverse -246 -265 -7.76869 0.258
NP_441409.1_6 Forward -271 -252 -6.39206 0.124
NP_441409.1_6 Reverse -250 -269 -10.6203 0.209
NP_442314.1_1 Forward -261 -243 1.78911 0.231
NP_439960.1_10 Reverse -249 -267 2.96908 0.165
NP_440474.1_8 Reverse -257 -271 7.17714 0.207
NP_441150.1_6 Forward -330 -311 16.0265 0.19
NP_442450.1_5 Forward -267 -257 9.32148 0.115
NP_442450.1_5 Reverse -254 -264 7.55152 0.13
NP_440588.1_2 Reverse -247 -266 -1.47551 0.155
NP_440588.1_2 Reverse -253 -272 -2.0655 0.16
NP_439950.1_1 Forward -187 -178 12.2911 0.287
NP_440195.1_4 Forward -277 -258 6.58763 0.27
NP_440195.1_5 Forward -256 -237 0.294447 0.299
NP_442006.1_1 Forward -152 -133 31.072 0.0000413
NP_442006.1_2 Forward -259 -242 27.0799 0.00108
NP_442006.1_2 Reverse -190 -207 -16.3824 0.25
NP_442006.1_3 Forward -315 -297 26.9618 0.000731
NP_441003.1_9 Reverse -247 -266 8.75091 0.224
NP_441003.1_9 Reverse -241 -260 3.04771 0.3
NP_442243.1_1 Reverse -250 -268 2.77167 0.204
NP_441570.1_1 Forward -265 -247 -0.570838 0.0486
NP_441570.1_1 Reverse -256 -274 -15.0255 0.227
NP_441570.1_1 Reverse -341 -359 -17.5821 0.283
NP_440078.1_4 Reverse -245 -264 10.3242 0.265
NP_441078.1_4 Forward -265 -256 19.6659 0.0007
NP_441078.1_4 Reverse -256 -265 19.6659 0.0007
NP_441078.1_4 Forward -350 -341 -1.27858 0.246
NP_441078.1_4 Forward -169 -160 -1.37691 0.254
NP_441078.1_4 Reverse -341 -350 -2.06522 0.295
NP_442729.1_5 Forward -260 -250 13.648 0.228
NP_442729.1_8 Forward -269 -256 9.75405 0.125
NP_441663.1_8 Reverse -250 -269 -3.73712 0.295
NP_442348.1_2 Forward -390 -381 12.2911 0.218
NP_442443.1_1 Forward -317 -298 -4.13045 0.268
NP_440526.1_3 Reverse -257 -268 10.1862 0.0646
NP_440526.1_3 Forward -264 -253 8.02298 0.126
NP_441432.1_8 Reverse -255 -264 16.8143 0.00595
NP_441432.1_8 Forward -266 -257 16.8143 0.00595
NP_441432.1_8 Reverse -317 -326 5.50626 0.151
NP_442320.1_8 Forward -271 -257 -3.83532 0.134
NP_442320.1_8 Reverse -250 -264 -4.32697 0.159
NP_441732.1_2 Reverse -252 -268 1.82849 0.026
NP_441732.1_2 Reverse -337 -353 -16.4611 0.167
NP_441732.1_2 Forward -269 -253 -16.5594 0.174
NP_440760.1_1 Forward -265 -246 -17.0118 0.191
NP_442797.1_7 Reverse -249 -267 10.3439 0.169
NP_440199.1_10 Forward -268 -258 16.7946 0.0381
NP_441057.1_4 Forward -304 -286 4.24738 0.231
NP_442353.1_4 Reverse -250 -269 4.22689 0.205
NP_441072.1_2 Forward -276 -257 5.50599 0.296
NP_440713.1_4 Reverse -308 -327 3.04771 0.251
NP_442489.1_2 Forward -270 -251 8.84924 0.168
NP_442489.1_2 Forward -276 -257 5.70265 0.191
NP_442489.1_2 Reverse -301 -320 0.982764 0.296
NP_442489.1_7 Forward -265 -256 20.1576 0.000695
NP_442489.1_7 Reverse -256 -265 20.1576 0.000695
NP_442489.1_7 Forward -301 -292 -1.77023 0.247
NP_440565.1_3 Reverse -239 -258 17.6113 0.192
NP_440559.1_1 Forward -264 -255 17.4043 0.00658
NP_440559.1_1 Reverse -257 -266 17.4043 0.00658
NP_441659.2_8 Forward -265 -255 18.1713 0.00133
NP_441659.2_8 Reverse -256 -266 18.1713 0.00133
NP_441659.2_8 Forward -350 -340 2.33998 0.205
NP_442913.1_10 Reverse -247 -266 1.17943 0.146
NP_440708.1_6 Forward -209 -190 -11.0136 0.296
NP_440442.1_3 Reverse -311 -325 14.8476 0.287
NP_442776.1_1 Reverse -366 -385 3.83436 0.279
NP_440779.1_5 Forward -265 -248 -14.9075 0.287
NP_442346.1_5 Forward -266 -256 16.6963 0.00248
NP_442346.1_5 Reverse -255 -265 16.6963 0.00248
NP_442346.1_5 Forward -351 -341 7.74818 0.159
NP_440352.1_5 Forward -263 -244 15.3812 0.13
NP_440545.1_3 Reverse -252 -269 2.39878 0.102
NP_440545.1_3 Forward -325 -308 -6.05768 0.268
NP_441856.1_3 Reverse -146 -165 2.3594 0.199
NP_440025.1_3 Reverse -238 -252 13.8056 0.235
NP_440831.1_3 Forward -318 -299 7.55207 0.248
NP_440831.1_3 Reverse -283 -302 6.38714 0.275
NP_441710.1_9 Reverse -249 -268 10.9134 0.256
NP_440459.1_2 Reverse -283 -300 9.38028 0.229
NP_441653.1_2 Forward -320 -301 7.00843 0.223
NP_440010.1_4 Reverse -308 -327 -1.37794 0.267
NP_440010.1_10 Forward -277 -258 2.3594 0.279
NP_440847.1_3 Reverse -243 -257 16.2235 0.139
NP_440847.1_3 Reverse -242 -256 14.0603 0.206
NP_442603.1_7 Forward -265 -251 12.2903 0.1
NP_442603.1_7 Reverse -256 -270 9.83206 0.139
NP_441833.1_4 Forward -264 -257 15.9687 0.0124
NP_441833.1_4 Reverse -257 -264 15.9687 0.0124
NP_440751.1_3 Forward -215 -196 7.4718 0.287
NP_442162.1_9 Forward -264 -257 16.2637 0.0124
NP_442162.1_9 Reverse -257 -264 16.2637 0.0124
NP_440671.1_4 Forward -271 -257 8.65272 0.193
NP_441973.1_1 Reverse -247 -262 0.569883 0.235
NP_442140.1_3 Forward -264 -254 12.2714 0.0632
NP_442140.1_3 Reverse -257 -267 4.40493 0.243
NP_441813.1_5 Forward -267 -257 15.9097 0.01
NP_441813.1_5 Reverse -254 -264 8.63316 0.0367
NP_440590.1_4 Forward -264 -251 10.934 0.0235
NP_440590.1_4 Reverse -257 -270 4.64084 0.0601
NP_440567.1_1 Forward -264 -250 12.9793 0.0213
NP_440567.1_1 Reverse -257 -271 3.63784 0.139
NP_442497.1_10 Forward -264 -255 10.4228 0.0087
NP_442497.1_10 Reverse -257 -266 10.4228 0.0087
NP_440821.1_4 Forward -267 -257 18.2696 0.00448
NP_440821.1_4 Reverse -254 -264 9.41981 0.0286
NP_441239.1_9 Reverse -298 -310 5.34885 0.223
NP_441239.1_9 Forward -267 -255 4.36554 0.253
NP_441239.1_9 Reverse -254 -266 3.38223 0.285
NP_441892.1_1 Reverse -309 -326 2.39878 0.14
NP_441892.1_1 Reverse -247 -264 -3.20608 0.235
NP_441892.1_1 Forward -274 -257 -4.87771 0.269
NP_440604.1_6 Forward -265 -246 -5.99873 0.289
NP_442270.1_9 Reverse -245 -264 -8.26035 0.217
NP_440900.1_9 Forward -42 -23 14.8474 0.222
NP_441617.1_6 Reverse -223 -242 -7.57203 0.292
NP_441617.1_8 Reverse -220 -239 10.815 0.261
NP_440546.1_4 Forward -265 -255 10.046 0.109
NP_440546.1_4 Reverse -256 -266 10.046 0.109
NP_440675.1_1 Reverse -253 -272 1.96607 0.28
NP_440462.1_6 Forward -267 -257 7.74818 0.0699
NP_440462.1_6 Reverse -254 -264 1.35667 0.294
NP_440868.1_4 Forward -269 -257 8.20045 0.0602
NP_440868.1_4 Reverse -252 -264 6.1355 0.0878
NP_442402.1_2 Forward -113 -99 11.9953 0.272
NP_442039.1_4 Forward -264 -257 15.1821 0.0124
NP_442039.1_4 Reverse -257 -264 15.1821 0.0124
NP_441811.1_8 Forward -271 -257 6.58777 0.267
NP_442625.1_3 Forward -364 -345 10.0292 0.282
NP_440825.1_7 Forward -264 -254 12.9096 0.152
NP_442696.1_6 Reverse -376 -395 -13.3736 0.276
NP_442837.1_3 Forward -264 -257 15.7721 0.0124
NP_442837.1_3 Reverse -257 -264 15.7721 0.0124
NP_439994.1_3 Reverse -255 -274 8.82876 0.274
NP_442053.1_1 Forward -265 -256 18.3876 0.0007
NP_442053.1_1 Reverse -256 -265 18.3876 0.0007
NP_440505.1_3 Forward -267 -257 16.303 0.00696
NP_440505.1_3 Reverse -254 -264 9.22315 0.122
NP_441203.1_1 Forward -264 -245 -19.7651 0.297
NP_441408.2_7 Forward -280 -261 4.52268 0.191
NP_441408.2_7 Forward -267 -248 -0.688862 0.234
NP_440914.1_1 Forward -265 -255 17.5935 0.000537
NP_440914.1_1 Reverse -256 -266 17.5935 0.000537
NP_441011.1_8 Forward -264 -255 8.25953 0.144
NP_441011.1_8 Reverse -257 -266 8.25953 0.144
NP_442101.1_10 Reverse -248 -267 -7.4737 0.212
NP_442533.1_1 Forward -268 -249 -15.2418 0.253
NP_442533.1_1 Reverse -199 -218 -17.2085 0.281
NP_442533.1_6 Forward -265 -256 17.2076 0.00137
NP_442533.1_6 Reverse -256 -265 17.2076 0.00137
NP_441482.1_7 Reverse -250 -264 -8.5552 0.193
NP_439944.1_9 Reverse -257 -267 19.0562 0.00329
NP_439944.1_9 Forward -264 -254 10.5014 0.0887
NP_439944.1_9 Forward -349 -339 4.79825 0.296
NP_441028.1_6 Reverse -246 -256 3.71617 0.281
NP_440115.1_6 Reverse -253 -263 9.32148 0.115
NP_440115.1_6 Reverse -315 -325 7.15819 0.158
NP_440007.1_9 Forward -269 -255 7.07942 0.213
NP_440007.1_9 Reverse -252 -266 0.786239 0.29
NP_440608.1_6 Forward -264 -245 6.48849 0.238
NP_441972.1_5 Forward -264 -245 -3.93378 0.201
NP_441972.1_5 Forward -326 -307 -5.9004 0.226
NP_441972.1_5 Reverse -301 -320 -7.08038 0.241
NP_441106.1_1 Forward -266 -257 9.63616 0.0311
NP_441106.1_1 Reverse -255 -264 9.63616 0.0311
NP_441815.1_6 Reverse -301 -320 1.86696 0.24
NP_439903.1_6 Forward -268 -249 1.96529 0.236
NP_441286.1_1 Reverse -255 -267 21.3768 0.00196
NP_441286.1_1 Forward -266 -254 12.9203 0.00815
NP_441286.1_1 Forward -351 -339 -0.551008 0.135
NP_442674.1_3 Reverse -248 -267 12.1917 0.174
NP_440670.1_8 Forward -265 -256 18.3876 0.000699
NP_440670.1_8 Reverse -256 -265 18.3876 0.000699
NP_440886.1_7 Forward -266 -256 7.94438 0.0805
NP_440886.1_7 Reverse -255 -265 7.94438 0.0805
NP_440886.1_7 Forward -170 -160 5.48612 0.181
NP_440886.1_7 Reverse -299 -309 4.60114 0.227
NP_440828.1_1 Forward -325 -306 2.16195 0.234
NP_442614.1_2 Reverse -256 -270 15.1426 0.0814
NP_442614.1_2 Reverse -285 -299 10.0294 0.235
NP_442614.1_2 Forward -265 -251 8.16106 0.255
NP_442072.1_9 Reverse -255 -273 -20.827 0.204
NP_442401.1_2 Reverse -291 -310 8.55343 0.241
NP_440028.1_6 Forward -326 -308 10.1472 0.289
NP_440907.2_8 Forward -264 -254 7.64939 0.117
NP_442264.1_2 Forward -269 -252 11.7402 0.179
NP_441021.1_1 Reverse -301 -320 -0.000545616 0.0949
NP_440841.1_4 Forward -267 -248 -11.1119 0.295
NP_441463.1_3 Forward -179 -160 -5.11376 0.22
NP_441463.1_6 Forward -267 -253 11.151 0.224
NP_441463.1_6 Forward -329 -315 9.41158 0.25
NP_441626.1_2 Forward -264 -257 15.7721 0.0124
NP_441626.1_2 Reverse -257 -264 15.7721 0.0124
NP_442365.1_7 Reverse -156 -175 -2.85214 0.205
NP_442794.1_1 Reverse -252 -264 21.9668 0.00123
NP_442615.1_1 Reverse -247 -265 7.19731 0.0324
NP_442615.1_1 Forward -274 -256 -5.58572 0.217
NP_441962.1_1 Reverse -311 -330 16.3224 0.027
NP_441962.1_4 Reverse -251 -270 -11.3086 0.239
NP_440387.1_1 Forward -265 -249 4.3851 0.0426
NP_440387.1_1 Reverse -256 -272 -3.57971 0.162
NP_440387.1_1 Reverse -160 -176 -3.8747 0.169
NP_441431.1_2 Reverse -282 -296 8.25877 0.221
NP_441431.1_2 Reverse -297 -311 5.89884 0.284
NP_441488.1_2 Reverse -202 -221 16.5191 0.26
NP_441488.1_8 Reverse -251 -265 13.7653 0.146
NP_441836.1_2 Reverse -202 -221 11.4058 0.0736
NP_441836.1_2 Forward -271 -252 -3.3438 0.237
NP_441836.1_2 Reverse -306 -325 -5.99873 0.29
NP_441993.1_1 Forward -315 -296 2.53143 0.257
NP_440114.1_10 Reverse -256 -270 7.9644 0.219
NP_442437.1_3 Reverse -145 -164 15.4366 0.106
NP_442323.1_7 Reverse -251 -270 3.24359 0.245
NP_441500.1_6 Reverse -3 -21 15.4571 0.168
NP_440287.1_5 Reverse -235 -254 6.48849 0.292
NP_440287.1_6 Forward -274 -255 6.19431 0.169
NP_440293.1_3 Forward -317 -298 -1.47551 0.239
NP_440293.1_3 Reverse -310 -329 -2.26216 0.239
NP_440293.1_3 Forward -376 -357 -6.88371 0.294
NP_441237.1_9 Forward -264 -254 14.828 0.0242
NP_441237.1_9 Forward -151 -141 11.3864 0.184
NP_442743.1_4 Forward -264 -245 -7.27704 0.279
NP_441311.1_2 Reverse -250 -264 14.5519 0.229
NP_439910.1_2 Forward -273 -256 -12.1542 0.0788
NP_442867.1_8 Reverse -243 -262 9.3409 0.224
NP_442867.1_8 Reverse -242 -261 4.03102 0.293
NP_440457.1_1 Forward -313 -301 5.34885 0.141
NP_440457.1_1 Forward -269 -257 -0.0593532 0.25
NP_440457.1_1 Reverse -252 -264 -0.452677 0.263
NP_440798.1_6 Forward -264 -251 4.34585 0.145
NP_441801.1_4 Reverse -304 -314 2.53664 0.292
NP_442297.1_2 Reverse -174 -191 17.9681 0.129
NP_441984.1_1 Forward -315 -297 9.36059 0.226
NP_442509.1_9 Forward -265 -255 8.14104 0.192
NP_442509.1_9 Reverse -256 -266 8.14104 0.192
NP_442439.1_8 Reverse -207 -226 6.78429 0.299
NP_442514.1_5 Reverse -183 -202 -4.03287 0.238
NP_440554.1_4 Reverse -257 -267 7.05986 0.106
NP_441885.1_5 Forward -265 -255 20.9245 0.000538
NP_441885.1_5 Reverse -256 -266 20.9245 0.000538
NP_441885.1_5 Forward -350 -340 0.57002 0.137
NP_441885.1_5 Forward -169 -159 0.275027 0.174
NP_442341.1_7 Forward -266 -252 16.1259 0.0186
NP_442341.1_7 Reverse -255 -269 14.3559 0.0299
NP_442341.1_7 Reverse -299 -313 4.12949 0.2
NP_442341.1_9 Forward -267 -253 9.14375 0.156
NP_442341.1_9 Reverse -254 -268 8.65209 0.166
NP_441173.1_9 Forward -108 -100 12.9004 0.206
NP_441173.1_9 Forward -107 -99 9.75379 0.284
NP_442395.2_2 Forward -222 -203 11.0117 0.257
NP_440423.1_6 Forward -273 -254 -16.0285 0.229
NP_440423.1_6 Forward -317 -298 -18.6834 0.233
NP_443000.1_7 Forward -267 -257 17.0896 0.00865
NP_443000.1_7 Reverse -254 -264 10.3048 0.0345
NP_441842.1_10 Reverse -249 -263 7.37441 0.258
NP_440275.1_3 Forward -267 -257 8.1415 0.0602
NP_440275.1_3 Reverse -254 -264 8.04317 0.0602
NP_440091.1_1 Forward -269 -257 8.88877 0.0567
NP_443060.1_5 Reverse -248 -267 9.83173 0.194
NP_440679.1_5 Forward -262 -243 10.1275 0.29
NP_442451.1_2 Reverse -284 -303 -9.44032 0.259
NP_440149.1_8 Forward -265 -246 2.75272 0.105
NP_440149.1_8 Forward -327 -308 -4.42544 0.207
NP_440149.1_8 Reverse -256 -275 -8.06369 0.298
NP_441105.1_3 Reverse -245 -264 -8.94866 0.281
NP_441105.1_3 Forward -355 -336 -9.44032 0.289
NP_440216.1_1 Forward -265 -251 -0.492064 0.0284
NP_440216.1_1 Reverse -256 -270 -9.63684 0.145
NP_440216.1_9 Reverse -287 -296 11.7011 0.254
NP_440216.1_9 Reverse -216 -225 5.3096 0.298
NP_440172.1_1 Forward -265 -255 15.0247 0.00945
NP_440172.1_1 Reverse -256 -266 15.0247 0.00945
NP_440172.1_1 Reverse -318 -328 2.83163 0.264
NP_442015.1_10 Reverse -252 -265 19.8821 0.00366
NP_442015.1_10 Forward -269 -256 0.510939 0.224
NP_442015.1_10 Forward -221 -208 0.510939 0.224
NP_441226.1_7 Forward -264 -257 14.4934 0.0123
NP_441226.1_7 Reverse -257 -264 14.4934 0.0123
NP_441226.1_7 Reverse -286 -293 6.52862 0.253
NP_441757.1_3 Reverse -255 -274 -1.47551 0.249
NP_441111.1_7 Forward -264 -256 18.7023 0.00294
NP_441111.1_7 Reverse -257 -265 18.7023 0.00294
NP_441766.1_2 Forward -265 -256 17.5026 0.00297
NP_441766.1_2 Reverse -256 -265 17.5026 0.00297
NP_442417.1_5 Forward -265 -251 8.06273 0.164
NP_440416.1_9 Reverse -249 -268 -7.37537 0.0996
NP_440416.1_9 Forward -328 -309 -19.8634 0.279
NP_440416.1_9 Forward -301 -282 -20.945 0.289
NP_441019.1_2 Forward -318 -299 15.7324 0.197
NP_442154.1_1 Forward -320 -302 -11.2889 0.213
NP_442226.1_8 Forward -385 -375 13.0581 0.274
NP_440261.1_5 Forward -264 -251 -0.964025 0.0655
NP_440261.1_5 Reverse -257 -270 -2.93064 0.0983
NP_440988.1_10 Forward -267 -253 15.7419 0.112
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTAACTCGGGGCCTTGTTTGACTGAGCCTTGGAATGTGCCCCGCAGTTGGCTACCGTCATTGAAGGTGTAGATCCATTGCCACGGCTGGGGAGATGGGGCGCTTTCCGTTGGGCGGCTCAAGTTAACGTTAATGGCGATCGCCAAGGGGGAAATGGAGAAACCTGCCCGATAATTTGCCCTGCCCATGATCTTCACCTTCCCCTACACCTAGGGATGATTACTCAGTGCGGTTATCTCCAGCTTATCGGTATTGCGCCTCTCTTGGGTGCCATACACTGAAGAGTCCGTCTTTTACCCAGTTACTAAACCCTTGTTGGAAGCTTTTAGCAGCGATAATTTTCTCTAAATGGTCTGAACTAAACTGGAATTATTCGCCGCTTTAATTTCTCCTAATGTC

CDS

ATGCCTAGAATTTCAATTATTCGGCCTGAGCAAAGTTACACTTTTTCTGATTACTTCAAACTTAACTTTGCACCCCAAGACATTCTGAGGCATTTTGGTGTCACTCTCCAACGTCAATCCCTCGATCTTCCCCAGTATTTAGGGCCCCTTAACCGTCTGGGTGACCTCAAGACTCGCCTGGAAGAAAGCTTACCCCGCCTCAGCCTCACCAGCGAAATGGCAAGGAGAGAATTTCTCATTGCTCCAGTGTTGACCGATGTTCTGCACTATACCCACGCAAACCTGGACGTTGAGTATCCCATTGTGGTTAGTAATCAACTAAAAGGTTCACTGGATTATCTACTACAAAATGATCAAACTTTCTTGGTAGTTGAGGCAAAAAATGAGGATTTGGAACGGGGTTTTGTTCAGCTTGCCATTGAATTGATCGCCCTTGACCAATGGATAGAGTCAGACCAGTCCGTCCTACAGGGGGCAATTTCCACGGGTAATATTTGGCAATTTGGCCAACTAGACCGGCAATCCCGTTGCGTAACCCAAGACCTTGACCTTTACCGCGTCCCAGCGGATCTTGAACATCTCCTAAGAGTTCTGGTGCAAATCTTACGACCAGTAAGCTAG

Protein

MPRISIIRPEQSYTFSDYFKLNFAPQDILRHFGVTLQRQSLDLPQYLGPLNRLGDLKTRLEESLPRLSLTSEMARREFLIAPVLTDVLHYTHANLDVEYPIVVSNQLKGSLDYLLQNDQTFLVVEAKNEDLERGFVQLAIELIALDQWIESDQSVLQGAISTGNIWQFGQLDRQSRCVTQDLDLYRVPADLEHLLRVLVQILRPVS